(data stored in SCRATCH3701 zone)

EMBL: CP000993

ID   CP000993; SV 1; linear; genomic DNA; STD; PRO; 930981 BP.
XX
AC   CP000993;
XX
PR   Project:PRJNA18233;
XX
DT   17-SEP-2008 (Rel. 97, Created)
DT   26-NOV-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Borrelia recurrentis A1, complete genome.
XX
KW   .
XX
OS   Borrelia recurrentis A1
OC   Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
XX
RN   [1]
RP   1-930981
RX   DOI; 10.1371/journal.pgen.1000185.
RX   PUBMED; 18787695.
RA   Lescot M., Audic S., Robert C., Nguyen T.T., Blanc G., Cutler S.J.,
RA   Wincker P., Couloux A., Claverie J.M., Raoult D., Drancourt M.;
RT   "The genome of Borrelia recurrentis, the agent of deadly louse-borne
RT   relapsing fever, is a degraded subset of tick-borne Borrelia duttonii";
RL   PloS Genet. 4(9):e1000185-e1000185(2008).
XX
RN   [2]
RP   1-930981
RA   Audic S.;
RT   ;
RL   Submitted (17-MAR-2008) to the INSDC.
RL   Institut de Biologie structurale et Microbiologie (IBSM), CNRS-Information
RL   Genomique et structurale, CNRS - UPR2589, Parc Scientifique de Luminy - 163
RL   Avenue de Luminy - Case 934 FR-13288, Marseille cedex 09, France
XX
DR   MD5; d92ebf933dd3ed379d2bcb337fddda80.
DR   EnsemblGenomes-Gn; BRE_199.
DR   EnsemblGenomes-Gn; BRE_203.
DR   EnsemblGenomes-Gn; BRE_212.
DR   EnsemblGenomes-Gn; BRE_251.
DR   EnsemblGenomes-Gn; BRE_394.
DR   EnsemblGenomes-Gn; BRE_396.
DR   EnsemblGenomes-Gn; BRE_419.
DR   EnsemblGenomes-Gn; BRE_420.
DR   EnsemblGenomes-Gn; BRE_426.
DR   EnsemblGenomes-Gn; BRE_427.
DR   EnsemblGenomes-Gn; BRE_428.
DR   EnsemblGenomes-Gn; BRE_461.
DR   EnsemblGenomes-Gn; BRE_462.
DR   EnsemblGenomes-Gn; BRE_464.
DR   EnsemblGenomes-Gn; BRE_465.
DR   EnsemblGenomes-Gn; BRE_51.
DR   EnsemblGenomes-Gn; BRE_52.
DR   EnsemblGenomes-Gn; BRE_538.
DR   EnsemblGenomes-Gn; BRE_539.
DR   EnsemblGenomes-Gn; BRE_540.
DR   EnsemblGenomes-Gn; BRE_577.
DR   EnsemblGenomes-Gn; BRE_612.
DR   EnsemblGenomes-Gn; BRE_613.
DR   EnsemblGenomes-Gn; BRE_614.
DR   EnsemblGenomes-Gn; BRE_615.
DR   EnsemblGenomes-Gn; BRE_621.
DR   EnsemblGenomes-Gn; BRE_627.
DR   EnsemblGenomes-Gn; BRE_633.
DR   EnsemblGenomes-Gn; BRE_638.
DR   EnsemblGenomes-Gn; BRE_695.
DR   EnsemblGenomes-Gn; BRE_714.
DR   EnsemblGenomes-Gn; BRE_715.
DR   EnsemblGenomes-Gn; BRE_751.
DR   EnsemblGenomes-Gn; BRE_752.
DR   EnsemblGenomes-Gn; BRE_766.
DR   EnsemblGenomes-Gn; BRE_794.
DR   EnsemblGenomes-Gn; EBG00001069593.
DR   EnsemblGenomes-Gn; EBG00001069594.
DR   EnsemblGenomes-Gn; EBG00001069595.
DR   EnsemblGenomes-Gn; EBG00001069596.
DR   EnsemblGenomes-Gn; EBG00001069597.
DR   EnsemblGenomes-Gn; EBG00001069598.
DR   EnsemblGenomes-Gn; EBG00001069599.
DR   EnsemblGenomes-Gn; EBG00001069600.
DR   EnsemblGenomes-Gn; EBG00001069601.
DR   EnsemblGenomes-Gn; EBG00001069602.
DR   EnsemblGenomes-Gn; EBG00001069603.
DR   EnsemblGenomes-Gn; EBG00001069604.
DR   EnsemblGenomes-Gn; EBG00001069605.
DR   EnsemblGenomes-Gn; EBG00001069606.
DR   EnsemblGenomes-Gn; EBG00001069607.
DR   EnsemblGenomes-Gn; EBG00001069608.
DR   EnsemblGenomes-Gn; EBG00001069609.
DR   EnsemblGenomes-Gn; EBG00001069610.
DR   EnsemblGenomes-Gn; EBG00001069611.
DR   EnsemblGenomes-Gn; EBG00001069612.
DR   EnsemblGenomes-Gn; EBG00001069613.
DR   EnsemblGenomes-Gn; EBG00001069614.
DR   EnsemblGenomes-Gn; EBG00001069615.
DR   EnsemblGenomes-Gn; EBG00001069616.
DR   EnsemblGenomes-Gn; EBG00001069617.
DR   EnsemblGenomes-Gn; EBG00001069618.
DR   EnsemblGenomes-Gn; EBG00001069619.
DR   EnsemblGenomes-Gn; EBG00001069620.
DR   EnsemblGenomes-Gn; EBG00001069621.
DR   EnsemblGenomes-Gn; EBG00001069622.
DR   EnsemblGenomes-Gn; EBG00001069623.
DR   EnsemblGenomes-Gn; EBG00001069624.
DR   EnsemblGenomes-Gn; EBG00001069625.
DR   EnsemblGenomes-Gn; EBG00001069626.
DR   EnsemblGenomes-Gn; EBG00001069627.
DR   EnsemblGenomes-Gn; EBG00001069628.
DR   EnsemblGenomes-Gn; EBG00001069629.
DR   EnsemblGenomes-Gn; EBG00001069630.
DR   EnsemblGenomes-Gn; EBG00001069631.
DR   EnsemblGenomes-Gn; EBG00001069632.
DR   EnsemblGenomes-Tr; BRE_199-1.
DR   EnsemblGenomes-Tr; BRE_203-1.
DR   EnsemblGenomes-Tr; BRE_212-1.
DR   EnsemblGenomes-Tr; BRE_251-1.
DR   EnsemblGenomes-Tr; BRE_394-1.
DR   EnsemblGenomes-Tr; BRE_396-1.
DR   EnsemblGenomes-Tr; BRE_419-1.
DR   EnsemblGenomes-Tr; BRE_420-1.
DR   EnsemblGenomes-Tr; BRE_426-1.
DR   EnsemblGenomes-Tr; BRE_427-1.
DR   EnsemblGenomes-Tr; BRE_428-1.
DR   EnsemblGenomes-Tr; BRE_461-1.
DR   EnsemblGenomes-Tr; BRE_462-1.
DR   EnsemblGenomes-Tr; BRE_464-1.
DR   EnsemblGenomes-Tr; BRE_465-1.
DR   EnsemblGenomes-Tr; BRE_51-1.
DR   EnsemblGenomes-Tr; BRE_52-1.
DR   EnsemblGenomes-Tr; BRE_538-1.
DR   EnsemblGenomes-Tr; BRE_539-1.
DR   EnsemblGenomes-Tr; BRE_540-1.
DR   EnsemblGenomes-Tr; BRE_577-1.
DR   EnsemblGenomes-Tr; BRE_612-1.
DR   EnsemblGenomes-Tr; BRE_613-1.
DR   EnsemblGenomes-Tr; BRE_614-1.
DR   EnsemblGenomes-Tr; BRE_615-1.
DR   EnsemblGenomes-Tr; BRE_621-1.
DR   EnsemblGenomes-Tr; BRE_627-1.
DR   EnsemblGenomes-Tr; BRE_633-1.
DR   EnsemblGenomes-Tr; BRE_638-1.
DR   EnsemblGenomes-Tr; BRE_695-1.
DR   EnsemblGenomes-Tr; BRE_714-1.
DR   EnsemblGenomes-Tr; BRE_715-1.
DR   EnsemblGenomes-Tr; BRE_751-1.
DR   EnsemblGenomes-Tr; BRE_752-1.
DR   EnsemblGenomes-Tr; BRE_766-1.
DR   EnsemblGenomes-Tr; BRE_794-1.
DR   EnsemblGenomes-Tr; EBT00001672269.
DR   EnsemblGenomes-Tr; EBT00001672270.
DR   EnsemblGenomes-Tr; EBT00001672271.
DR   EnsemblGenomes-Tr; EBT00001672272.
DR   EnsemblGenomes-Tr; EBT00001672273.
DR   EnsemblGenomes-Tr; EBT00001672274.
DR   EnsemblGenomes-Tr; EBT00001672275.
DR   EnsemblGenomes-Tr; EBT00001672276.
DR   EnsemblGenomes-Tr; EBT00001672277.
DR   EnsemblGenomes-Tr; EBT00001672278.
DR   EnsemblGenomes-Tr; EBT00001672279.
DR   EnsemblGenomes-Tr; EBT00001672280.
DR   EnsemblGenomes-Tr; EBT00001672281.
DR   EnsemblGenomes-Tr; EBT00001672282.
DR   EnsemblGenomes-Tr; EBT00001672283.
DR   EnsemblGenomes-Tr; EBT00001672284.
DR   EnsemblGenomes-Tr; EBT00001672285.
DR   EnsemblGenomes-Tr; EBT00001672286.
DR   EnsemblGenomes-Tr; EBT00001672287.
DR   EnsemblGenomes-Tr; EBT00001672288.
DR   EnsemblGenomes-Tr; EBT00001672289.
DR   EnsemblGenomes-Tr; EBT00001672290.
DR   EnsemblGenomes-Tr; EBT00001672291.
DR   EnsemblGenomes-Tr; EBT00001672292.
DR   EnsemblGenomes-Tr; EBT00001672293.
DR   EnsemblGenomes-Tr; EBT00001672294.
DR   EnsemblGenomes-Tr; EBT00001672295.
DR   EnsemblGenomes-Tr; EBT00001672296.
DR   EnsemblGenomes-Tr; EBT00001672297.
DR   EnsemblGenomes-Tr; EBT00001672298.
DR   EnsemblGenomes-Tr; EBT00001672299.
DR   EnsemblGenomes-Tr; EBT00001672300.
DR   EnsemblGenomes-Tr; EBT00001672301.
DR   EnsemblGenomes-Tr; EBT00001672302.
DR   EnsemblGenomes-Tr; EBT00001672303.
DR   EnsemblGenomes-Tr; EBT00001672304.
DR   EnsemblGenomes-Tr; EBT00001672305.
DR   EnsemblGenomes-Tr; EBT00001672306.
DR   EnsemblGenomes-Tr; EBT00001672307.
DR   EnsemblGenomes-Tr; EBT00001672308.
DR   EuropePMC; PMC2525819; 18787695.
DR   EuropePMC; PMC2580676; 18757545.
DR   EuropePMC; PMC2991353; 21124792.
DR   EuropePMC; PMC3165610; 21775542.
DR   EuropePMC; PMC3347450; 22354035.
DR   EuropePMC; PMC3367985; 22679518.
DR   EuropePMC; PMC3561136; 23390560.
DR   EuropePMC; PMC4019183; 24686059.
DR   EuropePMC; PMC4128717; 25111141.
DR   EuropePMC; PMC4157404; 25229054.
DR   EuropePMC; PMC4182126; 24813576.
DR   EuropePMC; PMC4451892; 25988268.
DR   EuropePMC; PMC4696720; 26690334.
DR   EuropePMC; PMC4734540; 26812354.
DR   EuropePMC; PMC4858251; 27149282.
DR   EuropePMC; PMC4861516; 27088458.
DR   EuropePMC; PMC5544103; 28722620.
DR   EuropePMC; PMC5805056; 29016302.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000993.
DR   SILVA-SSU; CP000993.
XX
CC   DNA/Bacteria source is available for Michel Drancourt, Unite de
CC   Recherche sur les Maladies Infectieuses et Tropicales Emergentes,
CC   Faculte de Medecine, Marseille, France:
CC   michel.drancourt@medecine.univ-mrs.fr
CC   Genome sequence lacks part of the telomeres.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930981
FT                   /organism="Borrelia recurrentis A1"
FT                   /strain="A1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:412418"
FT   gene            complement(1..420)
FT                   /pseudo
FT                   /locus_tag="BRE_1"
FT                   /note="pseudogene; vlp-a gene, 5' part"
FT   gene            complement(826..1242)
FT                   /pseudo
FT                   /locus_tag="BRE_2"
FT                   /note="pseudogene; vlp gene, 3' part"
FT   gene            complement(2174..3295)
FT                   /gene="vlp-a"
FT                   /locus_tag="BRE_3"
FT   CDS_pept        complement(2174..3295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vlp-a"
FT                   /locus_tag="BRE_3"
FT                   /product="vlp protein, alpha subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_3"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94266"
FT                   /db_xref="GOA:B5RQI2"
FT                   /db_xref="InterPro:IPR000680"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI2"
FT                   /protein_id="ACH94266.1"
FT                   /translation="MIKKGKSKMRGIRGIKDKEEMRGGIWKMRGVIKRSLVIMMVMGVM
FT                   GCGQQVGKEKGKSLNEVLIDVGRSAENVFYSFLELVSGTLGFTVTKDTKKSEVETYFIN
FT                   IGKKIASASEELEQVAVKATADIDKDSILNKTIRSAVDSAKKTLEVLRGHLDSLKDIGD
FT                   SDKVGVAVSQNQGVAVAEPELKKAYNAFKGIVDTSVGLGVDRLKESNVTLAQASIGVAN
FT                   PENGAKVLAAGANAGAAVGDKAALIVSAVRGKEMLESIVKSAEDKAVKIEANATADTTP
FT                   LEFAVGGTAANVANANAKAAAVAGGIALRSLVKGGKLAAHDNNDDKAVQSAGVSAVNKL
FT                   LVSLEDIVKKTVKNVLENVKQEVDKARVPKAEV"
FT   gene            complement(6895..7989)
FT                   /gene="vlp-d"
FT                   /locus_tag="BRE_4"
FT   CDS_pept        complement(6895..7989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vlp-d"
FT                   /locus_tag="BRE_4"
FT                   /product="vlp protein, delta subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_4"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94267"
FT                   /db_xref="GOA:B5RQI3"
FT                   /db_xref="InterPro:IPR000680"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI3"
FT                   /protein_id="ACH94267.1"
FT                   /translation="MSLSLFQYSISTSFVGCNNGIAELEKKNEFLSSIANLGKGFLDVF
FT                   VAFGDMVSGTLGIKAETKKSEIGKYFGDIENTMKTTKAKLNEILEKNGNYEKVKEEVLK
FT                   FIDKLTKIEEGAKKAALGATGGVIGEVVKSNAAGNGPDAGSIKNLVEGIKGIVDLVITG
FT                   GDGGADKTNPVDDDKKNIGKLFGAKTEDSKGAEDKHVAAASASVGAVTEADILKAIAAA
FT                   NADAKRDGKVNEAEDVAALALAKGTNIDNDDQIKDSARKDAIIAAGIALRAMAKDGKFV
FT                   VKDTADKKTEAVVAKGVATQNNPDADDAGKASAILASVSGEEILASIVSSKESNAALVG
FT                   ECKCRYKCNFFCERGSSSSLSTYN"
FT   gene            complement(9377..10306)
FT                   /pseudo
FT                   /locus_tag="BRE_5"
FT                   /note="pseudogene; vlp gene, partial"
FT   gene            12958..13524
FT                   /locus_tag="BRE_6"
FT   CDS_pept        12958..13524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_6"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_6"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94268"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI4"
FT                   /protein_id="ACH94268.1"
FT                   /translation="MLHFLIHTMTKLKLISYLILITYSHAWCYTRTNNQFTNIKPLQIG
FT                   IIQHNYINLTPYNQKHKYRSFLGITIIYNDWIDFNIIPIHFYPHSANLLSNSYFNFSIS
FT                   LYILKYKIQIYPFIINILIGPQLPITLRTDIITGNNISAFLFPALPFLSIKLNIPINNV
FT                   FSITSTFSSSLSEYFLVDAAIIFAI"
FT   gene            complement(13640..14737)
FT                   /locus_tag="BRE_7"
FT   CDS_pept        complement(13640..14737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_7"
FT                   /product="beta-N-acetylhexosaminidase, putative"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_7"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94269"
FT                   /db_xref="GOA:B5RQI5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI5"
FT                   /protein_id="ACH94269.1"
FT                   /translation="MVLIMYYRINIIWILRKVNGMFRLILFVLLFFHFVLLGSIPDIDY
FT                   DYFESDKFDLIDVDKFLGKVNSKDILNGSCIFIGIRNVSNPSSVQSLSKSELMKIQEIN
FT                   PVGVILFRENFKDAEQTKKLIEKLKKYLGSKLLIAVDEEGGLVSRASENEKLGVYNFPS
FT                   MESVGKTKDVQLAYKIGEILGKQLRRLGINMNMAPVADSKFAPDSPLGNRTFGYSFYDI
FT                   GLMVEAFVDGMQREGVFAVVKHFPGLGGTKIDTHKDLALLSYSKNFLMLNNFVPFVFGK
FT                   EAKFLMLAHILVPNISKDVSSMSRDIVEIIRDNLNIFSIIMTDAYDMGAIVNNFNLEYA
FT                   IKQSLNSGIDIVLIPEGFKGINIEK"
FT   gene            complement(14670..16163)
FT                   /locus_tag="BRE_8"
FT   CDS_pept        complement(14670..16163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_8"
FT                   /product="uncharacterized conserved protein"
FT                   /note="2 amidation motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_8"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94270"
FT                   /db_xref="GOA:B5RQI6"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI6"
FT                   /protein_id="ACH94270.1"
FT                   /translation="MYLFTLCLNEVFSMCEVIDKVFSQKVLNMLNMHDLKGLDISFKNF
FT                   PSESHSNILSLTDNFVKLKFRKELIENNLKKYFDDYRKFLFSSEGDFYVFTADNLIKIG
FT                   LSLYPYFSFGILNGGSATSYFDLLKNSDFNNDLYFLYANKILEAKEFFGHLPKGITPAY
FT                   VNADGSYGFSFLELKIRHLLLLSRQYYELYGENIKPSIFQMTSVKTYKLISDFLDGIFD
FT                   NNLIKSLNYCDFCKSDILTAIQPLVYCYKELSDGHYEYFDYVNNGKKVFLALPAGHGQN
FT                   FKVLRDIYMQLYNSGKKFVYIGNIDNVGFTVNLKTLAIMAITNDSAGFEFSVKTPLDTK
FT                   GGILILDDDNNLNCVDIGSVISRETVLQFEYKGGKIFFNCATGLFNLEYLIKNIDRIIS
FT                   DMPMRVVKQTKEFGKYTSIEQITWEVIKMVDNPLIFEVNREDRFLPAKLFINTLIMSNY
FT                   MSDKFSDAFFDIAKYLNIGLNNVLQNKYNLDFKKGKWNV"
FT   gene            16218..18008
FT                   /gene="femD"
FT                   /locus_tag="BRE_9"
FT   CDS_pept        16218..18008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femD"
FT                   /locus_tag="BRE_9"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_9"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94271"
FT                   /db_xref="GOA:B5RQI7"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI7"
FT                   /protein_id="ACH94271.1"
FT                   /translation="MLKNYILNMRNLKKSINEMILSPSGFRKIFAQSKKENSMDNEINE
FT                   DDKILVAIISLTISNYFQDKPKQYINVGLDSRATGNVISQIIIKTLILNNNKINFFGIL
FT                   PIPEILAYTKISKNSKGFIYISASHNPKGYNGIKTGLDDGGVLNSNEINKIIKQIKSNI
FT                   QNENLIKNLIKKLQNFNNNTKYLKTYETIIASKDKLKAQSYNAYKSLMQQIIYSDEYNQ
FT                   ENIDILKANIKKEQIGIIAEMNGGSRINSIDKEILQSLGLKLEFYNTEIGIFKHGMTPE
FT                   GKSLNMCKKILEQKFQKDNSFQLGYVPDCDGDRGNLITINKNGQANIISSQKIFALSVL
FT                   SELSYLYHIGIKKNLAVVVNDATSLNIEKIASLFNAKVYRVEVGEANLTEMADILRNKG
FT                   LIIKIFGEGSNGGNITHPSKVRDPLATVFSIIKLLKIKNLYKIWCTLSQNSYNEYYNLD
FT                   DILKTINFYSNVEVSSKEAILKIRVQNQETLKTNYEKLLKTEFNKNNTIINQLQINNYE
FT                   ILNYEGITQTTTRTRDASGGLKVLLKNDKHEIIGSLWMRGSKTEPIFRVLSEVKSEYHN
FT                   LLYDILDFHKHLIKTANSII"
FT   gene            complement(18085..19137)
FT                   /gene="trsA"
FT                   /locus_tag="BRE_10"
FT   CDS_pept        complement(18085..19137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trsA"
FT                   /locus_tag="BRE_10"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_10"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94272"
FT                   /db_xref="GOA:B5RQI8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI8"
FT                   /protein_id="ACH94272.1"
FT                   /translation="MMQKKVILTGDRPTGSLHLGHYVGSIVNRLKYQEEYETYIIIADL
FT                   HTLTTQSDLKSISEISINVREIVLDYLSCGIDPERVNIYLQSAIPELLELNLILSMIVM
FT                   VNRLQRIPSIKDMSINAGLSEIPYGLLGYPVLMSADILMAKADFVPVGRDNESHIELTR
FT                   ELARKFNFLYGENFFPIPEAIFTDFHTLVGIDGKTKMSKSLGNAIFLNDDERSLRKKVM
FT                   SMFTDPKRIRADIPGEVDGNPVFIYHDLFNSDMDELCELKSRYKKGTIGDIEVKERLFN
FT                   VLNQFLIPIRERREFFKAKKGYVDEIIFEGTNKARKVALETVRDAKNLMGISKTWNGIR
FT                   RNIEKMAKYK"
FT   gene            complement(19134..20225)
FT                   /locus_tag="BRE_11"
FT   CDS_pept        complement(19134..20225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_11"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_11"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94273"
FT                   /db_xref="GOA:B5RQI9"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQI9"
FT                   /protein_id="ACH94273.1"
FT                   /translation="MALEIKTTDRFKFVRLQSIFYVVALIIMLITILKVAQTIFKPLSI
FT                   AVLLGFLVYPIYTFLKKLKIPRVLIIFIIFFVLFLFSYLVFSFVYYSVTVLIDQLPYYQ
FT                   KQLIFIIVDILEKYKLDSAIISNIDFSKYIYPFLTRISNEIIGFASSLVVLFLLLYFLL
FT                   SEIHIFDIKVKNAFKRSVSSMFIEVLSTINNQISKYLGIKVFVSFLTGLLVFIGLKLFG
FT                   QDFPRVWAVLTFVFNFIPSIGSILAVFFIMIAALVQFYPDLNLVLYIFIYNTFVQMLIG
FT                   NILEPKMQGHRLDLSPFLLLCFLFFWGWLWGIVGLLIAYPFTVIIKVIVDNIVYLRPFS
FT                   VFLSGSKILTLDNIDNNFNNKKN"
FT   gene            complement(20338..21195)
FT                   /locus_tag="BRE_12"
FT   CDS_pept        complement(20338..21195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_12"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_12"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ0"
FT                   /protein_id="ACH94274.1"
FT                   /translation="MSKKEKIIAFIFDFDDTLIYGNMQQVLFDEYNVDANLFWSEVENL
FT                   SVTYNENSCNIITNEMIYLSHFLTYVREGIFRGLNNKILFELGSKLKFFEGVIDLFKEI
FT                   SDINESLKKSDAIVNIYIVSSGFRQMILGSSIASYVTKVWACEFVDSYLMPFYQSLDNK
FT                   FSENSVLSSVCYFVDHTIKTRVIFELNKGSYDKINKRIPKSRREIPFENMFYIADGFND
FT                   IPAFEILNNNLNHYKNTLTVYYGNNENAKKLVKEKRVGDLAEANYGKGTKLYNWIMEKI
FT                   FSNI"
FT   gene            21315..22091
FT                   /locus_tag="BRE_13"
FT   CDS_pept        21315..22091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_13"
FT                   /product="uncharacterized conserved protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_13"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94275"
FT                   /db_xref="GOA:B5RQJ1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ1"
FT                   /protein_id="ACH94275.1"
FT                   /translation="MLMIDINNINQIKDIISRILDISLISILVYYIYKNVINSYSVNLL
FT                   KGMIIITSIGIISYYFNLYTINWLLTYIANILPIAMLILFHQEIKKIIMQIGNFNLSFK
FT                   LVNNKEETIKTITEIIKAIKHLSENKSGSLICIEKKIQLEQIINKGIKLDSIVSNEILI
FT                   SIFDYETPLHDGAVIISNNKIVYAGSFLPLSNVESISKTFGTRHRAGLGISENSDAITI
FT                   ITSEETGSISLTRNGKLEYNLSLNEVKKKLNIALIE"
FT   gene            22095..23087
FT                   /locus_tag="BRE_14"
FT   CDS_pept        22095..23087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_14"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_14"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94276"
FT                   /db_xref="GOA:B5RQJ2"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ2"
FT                   /protein_id="ACH94276.1"
FT                   /translation="MMITKKFINIIKLLFEDWQNKAISILIAIIMFITFYFNSIESVNI
FT                   EKNFNILLENEVTLGKMPDFNKILLTVKINKKDSKYLDFERIILSVEANNIKEAGEYEL
FT                   PIKIKNFNPIPIVEYKLSKNKIKINLDKKISKLVKVEPKFKLIEKEGKGEYFIAKYNIV
FT                   PERLTIHGPEKVIKSINTIKTKIKEFDTNTVFISDHLEVISPDQLITLEKNHVILNITL
FT                   GKKYIQTTITKPNLIFNNLKNGLEIKNKEKILDSENEMFIKIRSGLSEKITKMHINNNN
FT                   INLNLDLSKIENPGIYDIKTDIILKNNTYGIEVYEYEPKTIQVEITANE"
FT   gene            23080..23469
FT                   /locus_tag="BRE_15"
FT   CDS_pept        23080..23469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_15"
FT                   /product="holo-acyl-carrier protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_15"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94277"
FT                   /db_xref="GOA:B5RQJ3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ3"
FT                   /protein_id="ACH94277.1"
FT                   /translation="MNNKMTKSIGCDIIKVMRLSSFLKNKKKLERFFTQREIENLKMKG
FT                   KGVLESLAGKFSAKESLLKALSPLVNSKIKYSLKDIEIISLPKGNVTFQLHNDIKKLIA
FT                   KMNLKLYLTISHEREYAVTFVIVEN"
FT   gene            23473..24321
FT                   /locus_tag="BRE_16"
FT   CDS_pept        23473..24321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_16"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_16"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94278"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ4"
FT                   /protein_id="ACH94278.1"
FT                   /translation="MKKISYFTKEEIECPLCKQKFRKEELLTGSSRLISGKLKVDLKRE
FT                   YITNEKYGDIYPRIYSIIVCPNCYLSAFPNEFHTITLINNKTKQLLINHTNERKQIKEI
FT                   FEDDLNFNQPRRLQEGAASYILAIMCYEHLDKNHNPTLNQAKCAIRAAWTLEDLEKKYP
FT                   NKNYNYLQKIFYHKAAYLYKLTIEKEQNNSEPINFAIIFGPDTDKNYGYDSVLYLSGLL
FT                   EYFYGNIENKQYRYNQLIEIKTLLSKIAGMGKSSKEKPSILLDKIKEVYFKISREIKTF
FT                   K"
FT   gene            24322..25059
FT                   /gene="hisT"
FT                   /locus_tag="BRE_17"
FT   CDS_pept        24322..25059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisT"
FT                   /locus_tag="BRE_17"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_17"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94279"
FT                   /db_xref="GOA:B5RQJ5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQJ5"
FT                   /protein_id="ACH94279.1"
FT                   /translation="MKKILAEIAYDGSLYHGFQIQPTKPTIQGEIEKALEKINKTKVKI
FT                   QSAGRTDKGVHAKRQIISFYIKININLKNLKTAINSLLKNDIRIIKLKYVSNEFQPRFH
FT                   AKKRKYTYYILNNENHYPWEEYQAYYVRKKLNINRLNTMAEMLIGLHDFTTFSCIRDQT
FT                   NSKLKEIYLAKFKKKNKFIVFEIIGSSFLWKMVRSIVGTMIDIEIKNESVDTFIKILKS
FT                   KNRKYARTTAPAKALFLDRVFYE"
FT   gene            25052..25621
FT                   /locus_tag="BRE_18"
FT   CDS_pept        25052..25621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_18"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_18"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94280"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ6"
FT                   /protein_id="ACH94280.1"
FT                   /translation="MNKNKLIKKIILFRILKNNISGNIYYNYKEEIEKIKNTIIKVKNV
FT                   DTLEQTHIKENQPIKSVEHNTKQTNTKNLLIIYIDKKHLNKNTNAIIKKWCESISILNY
FT                   KIINNSNTLIAEIDNQQPKAILACEEVELFLNQNLRIQIVRGFELKFKKIPIVFTHLPT
FT                   SQISNPELKKEIWQDLKMIKGIVKYG"
FT   gene            25614..27590
FT                   /gene="priA"
FT                   /locus_tag="BRE_19"
FT   CDS_pept        25614..27590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BRE_19"
FT                   /product="primosomal protein N"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_19"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94281"
FT                   /db_xref="GOA:B5RQJ7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ7"
FT                   /protein_id="ACH94281.1"
FT                   /translation="MDDNLKQNFYYDIAFNIPINRLFLYKYKLTLKTGTRVITNFHGKE
FT                   TIGIIIKRYYKEELKEDFTFSIKYILKVIDDHPIITEHNINLARWISKKTFSGFGETLF
FT                   CGLPKISTSNKKIKNNKSESPKSKVSIQLNEEQNKIYKDIIQSSIQNTFYLFGVPGSGK
FT                   TEIFIKLCENYLEQKKQIIFLIPEISLGYQIIQRLKSSLSTNNIYEYNSKVSNSNKIAI
FT                   WNKVKNGESLIILGIKSALMLPFTNLGLIIMDEEHEHTYKSENTPRFHSRHIGFFLQNT
FT                   FNAKFIMGSATPSLEAYLAMENNQIKKMILKNKFLTKTLKELKIIDMKKEPQIISSELL
FT                   YSIQKSILEKRQALIFINKRGYSNTLECKICEHIICCPNCSVNLTYHQNENKLICHYCN
FT                   HKTNIISTCPKCNSKDIMYKTYGIQFVEKELKKFLPNARIARIDSNINQKEISQSINAF
FT                   ENEQLDILIGTQIIAKGFNFKQIKTLGIINADIGIDFPDFRSSEKIFAIISQVLGRAAR
FT                   FKSDNTIIIQTKNPNYYAIKYAYEGKYEEFYQEEIKIRKELNYPPFKKIIRIVVRSQKQ
FT                   EAAKHKCSEFFDISKEFLNDDIEYIGPSKAPMSKISKYYRYNILYLSKTFNPLEKLIRN
FT                   TKERIKNTKDIYIEIDYYPLSLL"
FT   gene            complement(27587..28207)
FT                   /gene="udk"
FT                   /locus_tag="BRE_20"
FT   CDS_pept        complement(27587..28207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="BRE_20"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_20"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94282"
FT                   /db_xref="GOA:B5RQJ8"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQJ8"
FT                   /protein_id="ACH94282.1"
FT                   /translation="MVKIIGISGGSGSGKTTIVNKISEVISEFVLISQDNYYKSVGDYE
FT                   YEFLDVNFDHPDAFDNNLFYKQLKKLKENQSINMPLYDFINHKRRDETIKIVPTPIIIV
FT                   EGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLERDMSKRGRTLESVIEQYLRTTRAGY
FT                   YRFIEPTKEYADLIIPEGGHNDKALYVLSSFLKTLVKDSSKFF"
FT   gene            complement(28200..28589)
FT                   /gene="glpE"
FT                   /locus_tag="BRE_21"
FT   CDS_pept        complement(28200..28589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="BRE_21"
FT                   /product="GlpE protein (GlpE)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_21"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94283"
FT                   /db_xref="GOA:B5RQJ9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQJ9"
FT                   /protein_id="ACH94283.1"
FT                   /translation="MIVSYLKLICLIVFLFFYIWFFIILKMKRTNIALLEKIKNGAKIL
FT                   DIRSPKEYTKSHYTRAINIPFKNLFAKKDKLGSLDTQIIIYGKSFSKSFEAEKLLKGLG
FT                   FKNVFVAGTLKNMPKLPGSKEEING"
FT   gene            28718..29683
FT                   /locus_tag="BRE_22"
FT   CDS_pept        28718..29683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_22"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_22"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94284"
FT                   /db_xref="GOA:B5RQK0"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK0"
FT                   /protein_id="ACH94284.1"
FT                   /translation="MKKKKNKWTRIKQKFKFIILKILRKQLKNVFKDPKLILISTLQII
FT                   MGSLLMAISTNILYIPHGLLSGGIAGISLMLHYLLDFNLGLTIFMLNIPLFLIGIKFLN
FT                   ITFVIQSWIAMALYSLIVNYSQFLQYKIQLNDMILVSILAGLISGLGLGLIFKAKGSSG
FT                   GTDIISMIIKEKYSISIGTTNFLFNLAVLLIAATFFNIEIALYTLIASFVTAIMTDKTS
FT                   TGFGNQKAILIISDKGKEISYLLTNKLKVAATLLEGKGAWAGNDKTIVFIVVPTMRMSR
FT                   IKYISQKIDPNCFIIVINTNEITGGKKIIETNTNKNDIAS"
FT   gene            complement(29680..30660)
FT                   /locus_tag="BRE_23"
FT   CDS_pept        complement(29680..30660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_23"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_23"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94285"
FT                   /db_xref="GOA:B5RQK1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK1"
FT                   /protein_id="ACH94285.1"
FT                   /translation="MEKLKKEFIVKHNSQRLDIYLSEHLCLFNRSQIKKRELKAFKFND
FT                   GYFSAIKLSKPVFINDRILIEFNESIDLGEYLVPLNLPINILYEDINVIVIEKPQGILS
FT                   HLGISNLENTVVNFLLHHISNLRYKFQENKIRPGIVHRLDKETSGVMICAKNLETLNFL
FT                   FEQFKNRSVKKVYIAIVKGNFKVDSGIIDTFIDRDRYDRKKFTVHKNSGKRALTEYKVL
FT                   ISMKNYSLVVLQPKTGRTHQLRVHMKYLNHPILGDDIYSRLDQEFKEISLMLHSFKLEI
FT                   SIKEGFLKKFISVLPKRFIDFLSNFYDDATLDLLVKDLNVVLDKF"
FT   gene            complement(30661..31167)
FT                   /locus_tag="BRE_24"
FT   CDS_pept        complement(30661..31167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_24"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_24"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94286"
FT                   /db_xref="GOA:B5RQK2"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK2"
FT                   /protein_id="ACH94286.1"
FT                   /translation="MMIIFLLFICNIFILYSNSLGYTKLDFEYLNLSQKFSLENEIYFS
FT                   ENNTNFGNEIFDKFQFNDDFFYKDIQENKDLNIEKTINSNWGKKVFRFSAISIGAFPIA
FT                   LFLGLYCFDLSYYFNSTGAKSFPYPFAINFKLSKDENFKKFVVSTSVGLAISLIIALID
FT                   SLIYS"
FT   gene            complement(31175..32839)
FT                   /gene="pfpB"
FT                   /locus_tag="BRE_25"
FT   CDS_pept        complement(31175..32839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpB"
FT                   /locus_tag="BRE_25"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase,beta subunit"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_25"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94287"
FT                   /db_xref="GOA:B5RQK3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK3"
FT                   /protein_id="ACH94287.1"
FT                   /translation="MISILQKERYKYVPRLPKILTNDFQNISVVFGDKTDALGNKDELR
FT                   EVFENTYGLPVVNFIQGSSNVDFTKILNVGIILSGGPAPGGHNVVAGIFDAIKKSNSNS
FT                   KIFGFKGGPAGLLDDKKIEITQDLIDAYKNTGGFDIVSSGRTKIETYVQYEQVLSVVLK
FT                   NNLNALIIIGGDDSNTNAALLAEFFKKKHHDIQVIGVPKTIDADLRNEHIQISFGFDSA
FT                   TKTYSEMVGNLCRDAMSAGKYWHFIKIMGRSASHVALECALKTHPNICIISEEVLAKNK
FT                   TLSEIVEDIASVVIKRSLKGYNFGVIIIPEGVIEFIPEVKSLMIELCSIFDSNEEEFKG
FT                   LDVKDIRKVFISKLSEYMKKVYVSLPLFIQIELVNSVLEIDPHGNFHVSRVPTEKLFME
FT                   MVSVRLEELRNLGEYSGKFSPIDHFFGYEGRSVTPSNFDSDYCYSLGYNAALLVLNGFT
FT                   GYMSTIKNLNKNSTEWIAGGVPITMMMNMEERYGVLKPVIKKALVDLNGAPFNEFVKHR
FT                   EQWAINNLYVFPGPIQYFGASELVDEITLTLKLELET"
FT   gene            complement(32909..33967)
FT                   /gene="queA"
FT                   /locus_tag="BRE_26"
FT   CDS_pept        complement(32909..33967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="BRE_26"
FT                   /product="S-adenosylmethionine-tRNA
FT                   ribosyltransferase-isomerase (queuine synthetase)"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_26"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94288"
FT                   /db_xref="GOA:B5RQK4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK4"
FT                   /protein_id="ACH94288.1"
FT                   /translation="MILVGSMETKEFYFDLPHHLIAQYPSERRGLAKLMVLDSICQKIY
FT                   HTDSVNDILKYIGSNTFLVFNDSRVRKSRIYAKTDYDGNVEFLILNRLTGDTFTSLISK
FT                   AKRQKVGKVYRFPQDLSAQIISKLDNEFTIKFNRYVDESYFEQYGFIPLPPYIKRDYDK
FT                   EDEDRYQTIYSKYIGSSASATAGLHFSEELFSKFAQNNIEYDFITLHVGLGTFLPVRTK
FT                   TIEKHKMHFESFSIRDSVACRLERAKSLGKKILAVGTTTLRALESAYDKQKGRFTRGEQ
FT                   KTNLFIYPGKNYKFKSVDMLFTNFHTPESTLLMLVSSFGGKDFVFDAYREAVTMNYRFF
FT                   SYGDATLFLSHI"
FT   gene            complement(33951..34973)
FT                   /gene="ruvB"
FT                   /locus_tag="BRE_27"
FT   CDS_pept        complement(33951..34973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="BRE_27"
FT                   /product="Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_27"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94289"
FT                   /db_xref="GOA:B5RQK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK5"
FT                   /protein_id="ACH94289.1"
FT                   /translation="MDLGFLNSEKNFLYDNNEDDLRPEFLKDFSGQSHIKDNLDIFIKA
FT                   SRDRNEALDHVFLSGPPGLGKTTLASIIALEMNTTIKITSAPAFEKPKDIVGILMTLND
FT                   KSVLFIDEIHRLKPAIEEMLYIAMEDYKIDCIVGQGAVARTVRMSIPKFTLIGATTKPG
FT                   KVASPLYARFGIVFRFDLYNEDELSKIIKRSAFILNVKLNDKAALLLAKSSRGTPRMAN
FT                   KLLRRMRDFAQVGGYDLITEDVVTAGLEMLKIDHEGLDEQDRNILKNLILKFRGGPVGI
FT                   ETLAIAVGETADSLEDFYEPYLILRGFIERTNRGRRATDFAYLHLNLNKNNQTIFDISR
FT                   "
FT   gene            complement(35026..35616)
FT                   /gene="ruvA"
FT                   /locus_tag="BRE_28"
FT   CDS_pept        complement(35026..35616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="BRE_28"
FT                   /product="Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_28"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94290"
FT                   /db_xref="GOA:B5RQK6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQK6"
FT                   /protein_id="ACH94290.1"
FT                   /translation="MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVE
FT                   ILTYFHFRDDDVKLFGFLNISEREVFENLIGVDGIGPKAALKILSGIKYDAFRLAIAKE
FT                   DINLISKVKGIGNKIAGKIFLKLRGKLVKGDESSSYMLKFKELEQSIVNMGFDRKLVVV
FT                   AFREIMLSDKFLILKEAEQEQFLFTETLKRLSV"
FT   gene            complement(35699..36430)
FT                   /locus_tag="BRE_29"
FT   CDS_pept        complement(35699..36430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_29"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_29"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94291"
FT                   /db_xref="GOA:B5RQK7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQK7"
FT                   /protein_id="ACH94291.1"
FT                   /translation="MSGHSKWSTIKRKKGTLDAKRNKIFTKLIREISIAARMGGGDIDS
FT                   NPRLRLAVNKARVANMPKDNIEKAIKKGIGDNMGSEYFKLTYEAYALYGVALIIKCLTD
FT                   NKNRTASEVRSVLSKSGGSLGAPGSVSYMFHKKGLISYNLDKYHEDEIIELALEAGAED
FT                   IYSEGSQVEVITSADNFESVSSILRTKFEEDIAEVALVPESKVALDKEQMDKVLAIIEK
FT                   LEDCDDVQEVYHNLEIVDDIC"
FT   gene            complement(36431..37372)
FT                   /gene="folD"
FT                   /locus_tag="BRE_30"
FT   CDS_pept        complement(36431..37372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BRE_30"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_30"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94292"
FT                   /db_xref="GOA:B5RQK8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK8"
FT                   /protein_id="ACH94292.1"
FT                   /translation="MLQTRLVEGRAYVSSVFDGKIFANRYYLLLKEFLIYHNLVSKISL
FT                   KVILANNSPASELYVSVKERVSKEIGINFNVIRLSENLHQDDILRLIEIENTNDYTDGI
FT                   IVQLPLANKIDVNMILNSILSIKDVDGLSFVNLGKLVSGDKRGFIPCTALAILKILFDY
FT                   KIEISGKTVVVIGRSLLVGRAISILLSCKPYNATVIVCHSKTVNLDFYVKQADVIISAV
FT                   GKPKLIDASMIVGHPYVIDIGISRVDVNNSSVLVGDVDFEAVKDRVRFITPVIGGVGPV
FT                   TVLMLMFNTIKAYLIRRKKFDLLEKLMKLVEV"
FT   gene            37501..38136
FT                   /locus_tag="BRE_31"
FT   CDS_pept        37501..38136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_31"
FT                   /product="uncharacterized conserved protein"
FT                   /note="MICROBODIES_CTER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_31"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94293"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQK9"
FT                   /protein_id="ACH94293.1"
FT                   /translation="MKKIFLTGFILVLLLHINTKKLEAYSIDRNGNSIIEVDLSLGIPL
FT                   FYNDLSNIFSSNLYPGGLGAAKYKYHILNNLSIGAELRYIFNFDINHSFNLLNPDSVIG
FT                   KTLTIVPITFLTTYVFDIGELFQIPIFSNIGLTLNYYGDKSDSISNLRTFDTMPVISIG
FT                   SGIFWNFNYKWALGVTTSWWAMFEFGNSAKTAHFLLISLSIIVNMNKL"
FT   gene            38144..39175
FT                   /locus_tag="BRE_32"
FT   CDS_pept        38144..39175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_32"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_32"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94294"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL0"
FT                   /protein_id="ACH94294.1"
FT                   /translation="MNKKNFKKLIIIILTFLNLECSSESIFSQLSKLQKINSNNNILDS
FT                   SSPSGISLINNTLYIAAMHLFKKENGNITRVNFSNSYEFVIDLVNVSGTTYLLVQNKNG
FT                   QLELYSFENNNWKLLFQKNVTPIKFLKSISISEITAAYILAIENNGKQIILDTNGNNQT
FT                   PNSATHNDKFYQISNSNKSITGRFAKIWKLNSSEVTKVNTTNEIMAIIDTNIRGSQETL
FT                   VFTGRNTDSTDNKFEIYSNKDNYKFPIFNRDNIGEFIAYFAREFHDIILIGSSNGFVEL
FT                   IKDKDTFILQPPSQSVLSGSYNGSQLSKTRLNDIIPISKEIIYILTQGKGLWKIENKKL
FT                   IKE"
FT   gene            complement(39161..39592)
FT                   /locus_tag="BRE_33"
FT   CDS_pept        complement(39161..39592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_33"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_33"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94295"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL1"
FT                   /protein_id="ACH94295.1"
FT                   /translation="MLNKIFVDADSCNLEIIKFLQNFVLSRNVELILVANRKLKLKICK
FT                   NTFVKVVSDVDSFILELVDKNSMVITRDILFVKSLLDCQIKVMNDEGQIFDRNNISYLH
FT                   FRAKLNVNLDIKIRKSFYKETNKIKYSNFTMNFHRLFFN"
FT   gene            complement(39582..40217)
FT                   /gene="lepB-1"
FT                   /locus_tag="BRE_34"
FT   CDS_pept        complement(39582..40217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-1"
FT                   /locus_tag="BRE_34"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_34"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94296"
FT                   /db_xref="GOA:B5RQL2"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL2"
FT                   /protein_id="ACH94296.1"
FT                   /translation="MPGYLTFEQRLLRKQRRKIFFKIILLFLLSNYFVTKFVLQIFTFQ
FT                   GDEMFSLITKNNTLVFVSKHIRTFFIPLTLNDIVIYEDPNLRYNFIFKFLRDLFFLNNI
FT                   FNIGSYKIAKIVATWGDLVYVKGFDVLVYRQVNNSYYLNGNLMIGYKLNDFFGFDEVIK
FT                   CYSLKKNEFFLLNENLEILNDSRVFGPVGQADILSFLLLKIMGYKVVK"
FT   gene            complement(40218..41198)
FT                   /gene="lepB-2"
FT                   /locus_tag="BRE_35"
FT   CDS_pept        complement(40218..41198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-2"
FT                   /locus_tag="BRE_35"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_35"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94297"
FT                   /db_xref="GOA:B5RQL3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL3"
FT                   /protein_id="ACH94297.1"
FT                   /translation="MFLEKLDNFANFLVRIVERYLTYRKQKKYFYKLRAKKRGFMLNFL
FT                   LELLGASIFVLGINQYFLQAYRIPSGSMENTLQIGDLLFVDKFSYGPELLPGLCKIVGI
FT                   KEPDESEIVIFENVEYKSKGLFFDILHRLLYMLTFSFVDLDKDEDGNPSVRFLVKRALF
FT                   ADGKLVRFRNGLVFVKREGEEEFIEEDIYKSSLGYNFTVKKNVEEVDYKVYDNLAMFIA
FT                   LNQLNVNLENVSDFSFFNLREIDRFEIERLEYRYLVAFMPYVDYYMEKAIMRDYGIYVP
FT                   YGYVLPVGDNRDNSYDGRFFGVIDKKKILGRAFFMYFPFSRIGLI"
FT   gene            41400..42872
FT                   /locus_tag="BRE_36"
FT   CDS_pept        41400..42872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_36"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_36"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94298"
FT                   /db_xref="GOA:B5RQL4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL4"
FT                   /protein_id="ACH94298.1"
FT                   /translation="MLKENDSLNVTKEQPLTVELKPILGITPKVYVFFTMIILPIILLL
FT                   GFIINAKLNNPGVYLKIKTNIKNSYVYIDEKYIGKTPLNKYVNFNKGTLKIKRFGFETY
FT                   ETKIDIKNKFFANYKLNVNLKLIAPEKIIAKRQKELSVMTKIKNADDNIKLIPVFSLIM
FT                   NDLQNNSEYIKKFFQTSIPHIHSNIMFQDFISAYKTIYSINDNNNKEIWTSLKQNFNLE
FT                   DRAIIWFFENLDPEQQKQVFHEEWFKTFIEKLKNENKILSFENQNINLSLNNFKKIISQ
FT                   NIDSIKNYKLHSQDLILKTTYKLKEFLIQNKNITKAEYQNFLDKNPKWALNNKNNLIKE
FT                   ELVDESYLKTFNQMPSNEDITHISYYAAIEYAKWYSSTLPKGFKARLPISQEWELYQKE
FT                   VPQSIDNLNINEVSKKIGFWNLMQNSSFNEVILFQNKNDIYSENHNFNSLITELRTYTY
FT                   TNNSTLKPLTQASFLKYWCSPNIGFRLVIEKE"
FT   gene            42875..43324
FT                   /gene="smpB"
FT                   /locus_tag="BRE_37"
FT   CDS_pept        42875..43324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BRE_37"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_37"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94299"
FT                   /db_xref="GOA:B5RQL5"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL5"
FT                   /protein_id="ACH94299.1"
FT                   /translation="MSSILLENKKARFNYFIEDRLSCGIVLKGTEVKSIKLKKFTFNDS
FT                   FANIKKDEIWLENLHIAKYKEGNIFNHEETRRRKLLITKKEIQKLKKFKEKEGYTLVPI
FT                   SIYLKNSLIKVELGICKGKKLFDKREILKQKSIKKDLSREIKQYK"
FT   gene            complement(43481..44083)
FT                   /locus_tag="BRE_38"
FT   CDS_pept        complement(43481..44083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_38"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_38"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94300"
FT                   /db_xref="GOA:B5RQL6"
FT                   /db_xref="InterPro:IPR008420"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL6"
FT                   /protein_id="ACH94300.1"
FT                   /translation="MNNSFNMYIMQTLGCLFWGYFMKRVLILVLFLFCIFESFAQSYDE
FT                   MKTDIGSNSINGSGNLEKLLLYESYKQNALIPFLLNLFVGFGIGSLVQGDITGGLLILG
FT                   FDALSLGLLGYGVYSTLNSKSVEVPVIGLSLMTLGGITMFVTRIVEVVLPFTHAASYNK
FT                   KLRQNLGIALGSFHPEVDLSFDENSRVIFELSFTKKY"
FT   gene            complement(44104..45987)
FT                   /gene="parC"
FT                   /locus_tag="BRE_39"
FT   CDS_pept        complement(44104..45987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="BRE_39"
FT                   /product="DNA topoisomerase IV"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_39"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94301"
FT                   /db_xref="GOA:B5RQL7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL7"
FT                   /protein_id="ACH94301.1"
FT                   /translation="MNIKTLLRDNFLQYSSYVIKDRAIASVIDGFKPVQRRIIHSLFEM
FT                   NDGNFHKVANVVGNTMKYHPHGDTSIYEALVNMANKDLFIEKQGNFGNLLTGDPASASR
FT                   YIECRLTPLAFEVLYSKEITTYEPSYDGRNAEPLIFPAKIPVILIQGSEGIAVGMAAKI
FT                   LPHNFNEILRAVKSELLGEAYKLYPDFPTGGIVDVNEYADGNGKVLVRAKIETTDDNKA
FT                   ILIKELPFGETTESLIASIERAIRKNYIKVSSINDFTTENVEIELTLPRGVYANEIIEK
FT                   LYHYTNCQVSISVNLLLLSDRYPVIYTVTDIIKFHAEHLQKVLKMELELERSKILEKIF
FT                   SKTLEQIFIEHKIYKILETISKESDVVDIVMSEIVKYGDRFSRKIVLDDIENLLKIPIR
FT                   KISMFDIDKNNKDIQILSKELKSVESNIKSIKNYAINFIDKLLAKYSKMYHRKTEISLI
FT                   ESKNAREIATKNMKIYVSLKAGFVGTSLIDGEFIGNASYYDKILIFKKDSYILKNIEDK
FT                   TFIEKNNVSVLVYDINNSKEQVFSIIYLNKVDNFYYVKRFRIDKFLTDKVYYFLNKDDE
FT                   FIDFTFNAQFVAFSTSRDVVKMIDINNFMIKSRISVGKRISNNIIKKVKFK"
FT   gene            complement(45987..47783)
FT                   /gene="parE"
FT                   /locus_tag="BRE_40"
FT   CDS_pept        complement(45987..47783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="BRE_40"
FT                   /product="DNA topoisomerase IV"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_40"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94302"
FT                   /db_xref="GOA:B5RQL8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL8"
FT                   /protein_id="ACH94302.1"
FT                   /translation="MKKNCYDESKIVTLSSLEHIRLRSGMYIGRLGDGSNIDDGIYILI
FT                   KEIVDNSIDEFIMGYGKEIVIKREDNVITVRDYGRGIPLGKVVESVSVINTGAKYNDNV
FT                   FQFSVGLNGVGTKAVNALSSKFLIRSIREGNFFEAVFSKGNLINTTEGKSDEQNGTYIE
FT                   FLADTEIFGKYKYSEDFLQRRFFHYVCLNKGLEINYNDQIFRSDNGLLNFIRAEIKYED
FT                   LLYDFVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTSDGGTHQTGFREGFARAINDFLK
FT                   KTYSSTDIREGLVATLSIKIKDPIFESQTKNKLGNIETRGNIAKEVQRLILEILYKDKT
FT                   LAKTIESKVIDNERLRKELSSVRKEAKERAKKISFKIPKLKDCKFHFNEKSVHSDATMI
FT                   FLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNRSEIYKNEELYNMMVALGIEES
FT                   IENLRYNKVVIATDADFDGFHIRNLLLTFFLTYFEDLVLNGHMHILETPLFRVRNKSAT
FT                   IYCYSEEDKQKALLKLKNPEVTRFKGLGEISPNEFKGFIDVANIKLTKVDLVNIKEIKE
FT                   QLGFYMGPNTPERRNFIMENLI"
FT   gene            complement(47795..48547)
FT                   /gene="plsC"
FT                   /locus_tag="BRE_41"
FT   CDS_pept        complement(47795..48547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="BRE_41"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_41"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94303"
FT                   /db_xref="GOA:B5RQL9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQL9"
FT                   /protein_id="ACH94303.1"
FT                   /translation="MKILRSIITYISFFFFVLFFTVLFFVFLVFKIFGFENAFIKFIFV
FT                   LIRFAIKTCLWLSGIKVVITKDDDCCLNKDGGVVIIANHIASMDPIFLIYVFIRPFVIV
FT                   AKRSLLSIPLVNFILLSMGAIFVNRSSIRSSAVTQQKATKIIKEGGAIGIFPEGTRNRG
FT                   GKTKDFKRGSVNLALRTNSPIVPVTLLNTHKVFIKNLILNSGLSVYVHIHSLIDVSNLT
FT                   DDEKEQLHVIVRDKIVKKLEKMKIQYNC"
FT   gene            complement(48555..50015)
FT                   /locus_tag="BRE_42"
FT   CDS_pept        complement(48555..50015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_42"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_42"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94304"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM0"
FT                   /protein_id="ACH94304.1"
FT                   /translation="MFFKQYFIFLFFVLFSCVKGNKDFIIFNKDFNKKMSNSKLNYSDA
FT                   NVSEDSGENVFGSLIDLKGYKILSVHQENLNLDVYFEQVVLAQNFADLKTHLFIIGFDP
FT                   KSHEAVVLFKTQVNIDSKNSYNMYLEDITGDYDFDIVVQGFLDEYAVLYVFKRAVANDV
FT                   SSYRPIFFDKVNGNIIINKYSRSSAYDDKKSRESYSISLERYEKQGEDMIVSKIEKYVY
FT                   SQAQGKYYPLSTSEKVRRIDNDVYQTLKNLPKDEVYKFLYGIWYDNDSHQRSGKLDLKN
FT                   ILLLSFNRHFNEISIFKNNSQEIAHIEYISRPAYNILNISTKSVFSDLIVYNFWIKIVD
FT                   IDNIEIKIDTGTDAYDKYGFSGIFKRFNNSVLENDDQKFLFIPNGNYVYKDVIYDFSYP
FT                   SLTYIVKDNIYYGIFNVLNLNNNLVLEYEISMDENKVSESFIVEYSERIVNNQKFSTII
FT                   LHPIKILKDEVSLLKRQKLKLERIEKLG"
FT   gene            complement(50078..51586)
FT                   /locus_tag="BRE_43"
FT   CDS_pept        complement(50078..51586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_43"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_43"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94305"
FT                   /db_xref="GOA:B5RQM1"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM1"
FT                   /protein_id="ACH94305.1"
FT                   /translation="MRKRISQTKSVISGGENDKRVGMWGIFALILIVFGFIIAPLMPGL
FT                   FDTTDSSNLKFGFYKGQPIYYAKDNKFAQYVNFYSNFYSKLKRDNNYDIDYFIWRLAFM
FT                   KYVEDIAFLDLAKSSNFYISKSVLSQNVMNSPVYLDSNGNFSPKRYNKVSDYQKFKIYS
FT                   DAVENLLSSNIQIFLNSSFVFSDFLLSAVKNMSKIRKNIAYITLSYEDFPKDKVISYAE
FT                   DNQKLFKSLDLVSISFKNLSNANDAYDKLSKGMPFEEVAKFYSEDVANFKGIASSRQYY
FT                   FDLDLMLKEKEGLSSIFSLKINEFTNPIKSKSSGEYKIYKALSDIYNFDQNSNNDISAV
FT                   KNYIETYEPNVIETYLENKLNAILSEINSDVGEERSLQKYNLKVKEDVVNLAYNMNIYS
FT                   STLKELSIFSNSQGFYDLIFDLKEGQWSKPFLADHKVYSFYLRSSSNDSYESDVLVQED
FT                   RIIDNFSKANSKLLLDNVLKKNNFKENFNEAFFSLKDFSLNAGN"
FT   gene            51775..52647
FT                   /gene="cheR-1"
FT                   /locus_tag="BRE_44"
FT   CDS_pept        51775..52647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR-1"
FT                   /locus_tag="BRE_44"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_44"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94306"
FT                   /db_xref="GOA:B5RQM2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM2"
FT                   /protein_id="ACH94306.1"
FT                   /translation="MNINNEFNIKINKEEFQRLTKIIYNNFGINLSEKKKLLIESRLSS
FT                   TIKAKNLNNFTEYINYLENQKNQISLIELVDKISTNHTYFFREPNHFEFLANNILPKMI
FT                   KKITQTQEKEIRIWSAGCSSGEEAYTIAMILNEYINNNKIQCNAKILATDISITVLKEA
FT                   KEGIYPEDRVKTLPKHLKNKYLNKLQNDKFEVKDELKEMTVFKKLNLMNDVFPFNKKFD
FT                   LIFCRNVMIYFDEKTRNKLADKFNQYLKDDSYLLIGHSETIRGNKNLEYVMPATYKKKS
FT                   IQLKNNHND"
FT   gene            complement(52681..53358)
FT                   /gene="phoU"
FT                   /locus_tag="BRE_45"
FT   CDS_pept        complement(52681..53358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="BRE_45"
FT                   /product="phosphate transport system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_45"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94307"
FT                   /db_xref="GOA:B5RQM3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM3"
FT                   /protein_id="ACH94307.1"
FT                   /translation="MNMIRRKLTKQLEIIKDYLWEMKECVLKMIENSLIALESRDKNLA
FT                   KKIINEDEKMIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHSTKI
FT                   VKVVLLLESNVGDFSSVDIYQKPLREMADTAKDMLANIFDAYFDGDFIKILKIVKYDNI
FT                   IDKLFSKQKTLVIDAMKNNPENLDYLLNILFLNSFLERVGDHVATIGELLYFVKVGEKV
FT                   NLT"
FT   gene            complement(53365..54414)
FT                   /locus_tag="BRE_46"
FT   CDS_pept        complement(53365..54414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_46"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_46"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94308"
FT                   /db_xref="GOA:B5RQM4"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM4"
FT                   /protein_id="ACH94308.1"
FT                   /translation="MNKGNFIYCNFLFFIINIVSSFAFEKNKQNIYELDFNSERQEFLV
FT                   NINSKFNLCFKDEAWIYIKNNKNNPFIKFLSESYQDGAMFSFQTSKNVGIVMLTFKYQN
FT                   VKDSREFTKNVILRIVNQEKSLNLDQMDSEGNLNLDKDIKNGEDFGLNNQSGHNVDLKD
FT                   IMRRALNLYHINDYKGAIELLNKYDFNSDEYILLKAELYYKNGDYLNSYLNYLSLRDDF
FT                   FYQIFVNLISLGIKLNKVENVLRDVRFLVENDIDFDEDTYLDILEFLLTNGEHEFYSSL
FT                   SSLYYPKYVSSKFEDRYNYLLGKFYETESKYKDFVKSLSYYKRVIDSYPFSSYYELSKL
FT                   RFLFLKRFF"
FT   gene            complement(54411..54797)
FT                   /locus_tag="BRE_47"
FT   CDS_pept        complement(54411..54797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_47"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_47"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94309"
FT                   /db_xref="GOA:B5RQM5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM5"
FT                   /protein_id="ACH94309.1"
FT                   /translation="MREKKFHFQQYFLILIFLLIIVSFLTYLYSSKIIDESKNNTEENV
FT                   NLKLKLLNIEDFYFDLNSSFNMDDFFFPKPSLPDGKLGDSVMHYRTINEDILQDLWVKS
FT                   DNLFNIDLEKENELLVDKILENYK"
FT   gene            complement(54825..57290)
FT                   /locus_tag="BRE_48"
FT   CDS_pept        complement(54825..57290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_48"
FT                   /product="P115 protein"
FT                   /note="ATP_GTP_A and LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_48"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94310"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM6"
FT                   /protein_id="ACH94310.1"
FT                   /translation="MGVVLFLEKIGLLGFKSFVKMQELKLNSSLNFIVGPNGCGKSNLL
FT                   DAIRFCIGEDNLSILRIKHITDLISVSKSKESNFAEVTLFFNNEDLSIGDFRDKFYIRR
FT                   RLYKDGTSEYFLNNDNLNLKNYMDLVNKLRFKNSPYMFINQGKIERISSSGNINLKSLI
FT                   EEASGIDMLRVEEEQAYKSLEKSRENLTSLLMLRDELNEKYEKIKNDFLIKDKYQKLKN
FT                   DLEVLDKNLSLKKLFNLNFELTKLKNGLNIKDIDNILHLSSFSIESIKEKLEFYSLREK
FT                   NVIKNIELIKKEIEMLKSKLLTMEIKIQKLEHDKRGKLNLANIFMGNKSQIESVKVSIN
FT                   EELMNLNNSLQSKKKDFFILTDEINRYTRSFFELVDLVLSIVKESNIEEFEQLKKNILN
FT                   SLKLFEDTLSIKYLKNIRENLLKYIVKEDKLLNLLREKIEPIFEQNVDLRKFLLTRNNS
FT                   KTSLAKEITTIESLVSEKTLKLNEILGEIEYTELSRLKNEDEIKLIDSNLKFLFETRDE
FT                   LKERLNNLNLKLDELNLERSDINVNLDKFLSDAKGSELVGNKEVNTLSVLDAFKNSSYY
FT                   EYMKKQAEYDILLHSNLDIKDEIKDFNFVNKDMEKFDLEDDLVQIASLRKEMSMIEHDN
FT                   YIFFNVEREYNEIKDKVEKINLQINDLNATKESLDKLRKRIKREINKKFNDAFDKISDH
FT                   FIYFFSRIFKGSGSLFYDKDLDEIEIKINFKDKLVKGNKMLSGGEHSLISIAFLFALYY
FT                   YSPASFCVLDEIDASLDFENSNKLSTLLNELGQKVQLLIITHNMYVAKGSKNLIGVTSD
FT                   NGESVIFNI"
FT   gene            57348..57893
FT                   /gene="rnhB"
FT                   /locus_tag="BRE_49"
FT   CDS_pept        57348..57893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BRE_49"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_49"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94311"
FT                   /db_xref="GOA:B5RQM7"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQM7"
FT                   /protein_id="ACH94311.1"
FT                   /translation="MICGIDEVGRGCIFGPVLSAAVIFKTKPNFLNELDDSKKLTKTKR
FT                   EYLSSLILENAYYAFADISNEIIDKINIHNASLLAMQIAYQKLNIECNLVLVDGKFIPK
FT                   IQAKQIRAIIKGDSMIDEIKAASIIAKVQRDKLMVEYDKIYPLYGLKKNKGYPTKEHKD
FT                   AIKKHGILSLHRKSFRLI"
FT   gene            complement(57974..58267)
FT                   /locus_tag="BRE_50"
FT   CDS_pept        complement(57974..58267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_50"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_50"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94312"
FT                   /db_xref="GOA:B5RQM8"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM8"
FT                   /protein_id="ACH94312.1"
FT                   /translation="MEDLMGERGEVYSDKLFTNSDRTYFFNVKENRKGDYFLNIVESKR
FT                   NVNGDFERHSVFVYEENIDEFESNLLKAISVIKKKVTGNLVKKGEYHNDRRS"
FT   gene            58407..58478
FT                   /locus_tag="BRE_51"
FT   tRNA            58407..58478
FT                   /locus_tag="BRE_51"
FT                   /product="tRNA-Gly"
FT   gene            complement(58510..58873)
FT                   /locus_tag="BRE_52"
FT   tmRNA           complement(58510..58873)
FT                   /locus_tag="BRE_52"
FT   gene            58999..59709
FT                   /locus_tag="BRE_53"
FT   CDS_pept        58999..59709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_53"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_53"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94313"
FT                   /db_xref="GOA:B5RQM9"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQM9"
FT                   /protein_id="ACH94313.1"
FT                   /translation="MIQGDFLNNEMLWCIMLICTYSILIITYNFFGQKGLLAWLVSSVI
FT                   IANIQVLKQITIFGLHATLGNIIYASSYVATDILSEIHGHKNSKKAVYIGFISFIAFAF
FT                   ITNIQLYFSTNNSDIYLENLENIFSSIPILLIASIIAYIISQLNDIYLFRFIKEKFPKF
FT                   LFIRSNGSTLVSEFIDTIIFVSIATYFNIFPKEAYLNIIISTYFIKGIAGIMGTPFIYI
FT                   AKYIYQNKKIQINE"
FT   gene            59754..60449
FT                   /locus_tag="BRE_54"
FT   CDS_pept        59754..60449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_54"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_54"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94314"
FT                   /db_xref="GOA:B5RQN0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN0"
FT                   /protein_id="ACH94314.1"
FT                   /translation="MINIILWTILITFVYSQLTLLYYLFGKSGLFCFNIIMNILSNLII
FT                   LKKVTIFEQQISLSGITFLSTLCSLNLITEKYNEKSAIESITLNMLSHITFVIMMHFTL
FT                   YFHQNEFDTSNIHLKVLFYNASYISIIFTGTYIIFLSNYVNIKVYSMLQKNNINSKWIS
FT                   HNVSRFCSSCIAYMLANISMYIIEQLYPGNNINMVKSSWIFTIAIMIIDTFIYCFLNKL
FT                   KIRKTAISQ"
FT   gene            complement(60424..61080)
FT                   /gene="spoU"
FT                   /locus_tag="BRE_55"
FT   CDS_pept        complement(60424..61080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="BRE_55"
FT                   /product="spoU protein"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_55"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94315"
FT                   /db_xref="GOA:B5RQN1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN1"
FT                   /protein_id="ACH94315.1"
FT                   /translation="MVSDTLKRIEILAEFITRRRRERIDEVLNNRTNYLTLVLEDIFQS
FT                   QNASATMRTIEILGLSNIHIIETNNKYTLNPGVVLGASKWIGINKYKCVKVAFEHLKAN
FT                   GYKIVATSLDNEAISLEDFPIDTKMAVFFGTELTGLSHTILQNADLHLKIPMYGFTQSY
FT                   NLSVAVAIVFYSLINRLRSSSIDYLLNEDEKLNLKLEYYRKIIKRYKVIEKLQFF"
FT   gene            61174..61845
FT                   /gene="ung"
FT                   /locus_tag="BRE_56"
FT   CDS_pept        61174..61845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="BRE_56"
FT                   /product="uracil DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_56"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94316"
FT                   /db_xref="GOA:B5RQN2"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQN2"
FT                   /protein_id="ACH94316.1"
FT                   /translation="MEVKIEESWKEMLKSEFCKGYFKRLVSFIKNEYKTKKDKIFPPPR
FT                   LIFNAFDTLPFKDIKVVILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERSLK
FT                   IKTIPNGDLTRWAEQGTFLLNSILTVEEGRPSSHKDIGWKIFTNEVIKIISKNLNNVVF
FT                   MLWGNFAKGKKKLIDTSKHLILETSHPSPYSAHNGFLGSNHFSKTLRYLQEHNKTTINF
FT                   Q"
FT   gene            complement(61903..62265)
FT                   /locus_tag="BRE_57"
FT   CDS_pept        complement(61903..62265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_57"
FT                   /product="preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_57"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94317"
FT                   /db_xref="GOA:B5RQN3"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN3"
FT                   /protein_id="ACH94317.1"
FT                   /translation="MILELVRFLVFIFFVIISFMIILLVLFQDEQGDGIGGVFGGGSSS
FT                   IFGARSSSVAIKITAFFITLFFVFVIALSFINTKRVDSDLLRNVKVDEKSSTFWNDDEN
FT                   KNNEDDALNKENQEDR"
FT   gene            complement(62271..63035)
FT                   /gene="tpi"
FT                   /locus_tag="BRE_58"
FT   CDS_pept        complement(62271..63035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="BRE_58"
FT                   /product="triosephosphate isomerase (TIM)"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_58"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94318"
FT                   /db_xref="GOA:B5RQN4"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQN4"
FT                   /protein_id="ACH94318.1"
FT                   /translation="MRKVFLAGNWKMHYTSVEAADVAKQIVDGVYNINNNVVVMVTPTF
FT                   TSLCKVCRVTKGTNVLLGAQNMSYENSGARTSEIAPSMLLEFGVDYVILGHSECRTYLG
FT                   ENDEIINKKVLTGLKHPFKYLILCVGETLEEREKGKTLDVVLNQVRNGLASVYESDLQR
FT                   IILAYEPVWAIGTGKTATKEEAQEVHKAIRLEIQSLYSKSAADNIIIQYGGSVNVDNVE
FT                   GLMGENDIDGALIGGSSLKADSFLKIINKISK"
FT   gene            complement(63037..64215)
FT                   /gene="pgk"
FT                   /locus_tag="BRE_59"
FT   CDS_pept        complement(63037..64215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="BRE_59"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_59"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94319"
FT                   /db_xref="GOA:B5RQN5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQN5"
FT                   /protein_id="ACH94319.1"
FT                   /translation="MSIRTIKDCDFSGKRALVRCDFNVPLREGNITDDTRIKAALPTIE
FT                   YLKSQGARVVLMSHLGRPKGEKNLRYSLMPIARRLSELLGQDVKMLSDCIGDEVVTAVS
FT                   CMQNGDVVLLENVRFYKEEEENSDAFAMQLSKSGDIFVNDAFGTAHRAHASTSGVASYL
FT                   PAVGGFLMEREDEFLGKILKNPESPFVSIIGGSKVSSKIAVLESLLPKSNVMVIGGGMA
FT                   YTFLKVEGYSIGKSLLENEYIDVASSFLKKAKELSVEVILPIDHVVASEFQEYSMPEYV
FT                   DSVNIPDSKIGMDIGEKTLKKIEGVLSSAKTVIWNGPLGVFEFDSFAKGTAKVAEYVAN
FT                   CPGITVVGGGDSVAAVNKFNLSGKITHVSTGGGASLEYLEGKVLPGIKVLEV"
FT   gene            complement(64245..65252)
FT                   /gene="gap"
FT                   /locus_tag="BRE_60"
FT   CDS_pept        complement(64245..65252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="BRE_60"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase (GAPDH)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_60"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94320"
FT                   /db_xref="GOA:B5RQN6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN6"
FT                   /protein_id="ACH94320.1"
FT                   /translation="MKLAINGFGRIGRNVFKIAFERGIEVVAVNDLTDPKTLAHLLKYD
FT                   STFGVYNKKVEARDGAIVVDGKEIKIIAERDPKKLPWGKLGIDVVIESTGVFTSATSDR
FT                   GGYLDHVEYAGAKKVILTVPAKDDIKTIVLGVNEHEITSDLKAVSNASCTTNCLAPLAK
FT                   VLHEAFGIEKGLMTTVHAYTNDQKILDFPHADLRRARAAALSIIPTSTGAAKAVGLVLP
FT                   ELKGKLNGTSMRVPVPTGSIVDLTVQLKKKDVTKEEINSVLKKASESRELSGILGYTED
FT                   PIVSSDIKGNSHSSIVDGLETMVLLDGFVKVLSWYDNEFGYSTRVVDLAQKLVK"
FT   gene            complement(65325..67310)
FT                   /locus_tag="BRE_61"
FT   CDS_pept        complement(65325..67310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_61"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_61"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94321"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN7"
FT                   /protein_id="ACH94321.1"
FT                   /translation="MNFKRFFIMLLFFYLNFGSLMGATITAIEYYQKAQTYYLMQKYYD
FT                   AIDELLEAVKINPNYYEAYKFLAEIYYKLKIYNQAQFFIEKAYKMSNRDTEYKILYANI
FT                   LLKNNGASQAKKFYSEVLSKQKNNIDALVGLASIFEEEGLLIAAANYYLSVLEYSRTNY
FT                   SAFDHLMSIYEKLNMNDKAQHLINKVRGTFTSLPDFHRRVAEFSIKTGNLGSAEKYAQN
FT                   YLMLLKTTYKDFGLVDAYRLLALVYLYQVKYDDAVDVLQKAIVIEQDSDELYYLLGYSY
FT                   LKLGEVDKAVFNLERAKNMKKDLEFYDMALEESFFVSNFRSAFQKNNSTNIEISKRYHN
FT                   EGLKAFQDLSLDAAIFNVRNAIDIYPDNDGARFLLAKIYKFMKLDVMAYEELYYLVEQR
FT                   KVTDSAILDFYDMVAFDIRSSLFFKYGYKTIGDLNKLYDNQTVYRIGIFTQNENKVFGA
FT                   NDLILKYAERILDRNLNIEVVNYRFDYNKDKDYLVSSFSEEFSYARNNNLDLFLMFDLD
FT                   VDVFRNLASLKVDVFSGKTGVKVKTFSYNSGGVLYLSNILSSFSRDFNDYLPKKGKILQ
FT                   IKKDDVLINLGYVNDVKLGDVFLVLKEGALKYNSDSASFMSYSKSDILGEISIEEIGDY
FT                   ISRGTLKSSALLRDYIQEGYTVFIKK"
FT   gene            complement(67307..68086)
FT                   /gene="tlyC"
FT                   /locus_tag="BRE_62"
FT   CDS_pept        complement(67307..68086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="BRE_62"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_62"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94322"
FT                   /db_xref="GOA:B5RQN8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQN8"
FT                   /protein_id="ACH94322.1"
FT                   /translation="MMFKFFNFKNKKMKYVEGKDSEEKSRFETSLLNNFNSLKETIVKE
FT                   IMVPRISVIFIDYSVSKDDILKVVTSSNHSRFPVYKETIDDIIGIIHTKDILLHMWKKD
FT                   FYDIDLKDIMRKVMFVPESKKIDSLLKEFQENHVHIAIVVDEYGGISGLVTLEDILEEI
FT                   VGDIQDEFDNEVDEIVPLDDGSYLCTARVLIEDLNEKLGLCLPDGDFDTLGGFVYDLFG
FT                   RIPLKNEKIEYNNLIFTIKNMHQRNIKVIKISQKEGL"
FT   gene            complement(68083..68529)
FT                   /locus_tag="BRE_63"
FT   CDS_pept        complement(68083..68529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_63"
FT                   /product="uncharacterized conserved protein"
FT                   /note="UPF0054 motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_63"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94323"
FT                   /db_xref="GOA:B5RQN9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQN9"
FT                   /protein_id="ACH94323.1"
FT                   /translation="MIKEELNLWAEGVEFRHLDAYYNFILSVLNFLCIKEYELSVILCN
FT                   NEYIQKLNGEFRQKPEPTDVLSFNYFEGSEQINHKIQGDIVISLEYLEFSSLEFNVEMY
FT                   EELQRNTIHGILHLIGYTHDTNDFQNETMLIIQERVLRETRRVF"
FT   gene            complement(68616..68969)
FT                   /gene="trxA"
FT                   /locus_tag="BRE_64"
FT   CDS_pept        complement(68616..68969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="BRE_64"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_64"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94324"
FT                   /db_xref="GOA:B5RQP0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP0"
FT                   /protein_id="ACH94324.1"
FT                   /translation="MAISLTKQEFIDKVFDYKNNQEWNFKGTKPAIIDFYADWCGPCKM
FT                   LAPIYDELSEEYGDKIDFYKVNTDKEQEVSMVLGVQSLPTIIFVPVGDKPRVSVGFIEK
FT                   NSLKDAIKDLFKV"
FT   gene            69047..69766
FT                   /locus_tag="BRE_65"
FT   CDS_pept        69047..69766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_65"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_65"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94325"
FT                   /db_xref="GOA:B5RQP1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP1"
FT                   /protein_id="ACH94325.1"
FT                   /translation="MNLILINTNEFHNGIVLNDPRVKHITEILKLKNNDTFKFGIIGEE
FT                   YIYSCIYHKDVRLFFKKNHKISKSNKLTKVKVVIGFIRPIAAKRIIQHLGSIGISEIIF
FT                   FNSLLSEKSYSHSKLFREKEYEKYLIKGAMQGGITYIPKIKIFNNLIEVLENIKDDNFN
FT                   TTKILLERNSKNKLIDLNIKTENVVVIIGPERGFITKETNLITKYNFNTYNISPNILKT
FT                   ETATIVASTIITSKMND"
FT   gene            complement(69840..70895)
FT                   /locus_tag="BRE_66"
FT   CDS_pept        complement(69840..70895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_66"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_66"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94326"
FT                   /db_xref="GOA:B5RQP2"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP2"
FT                   /protein_id="ACH94326.1"
FT                   /translation="MMDNKTPHNQLFLDSQNLSDGNLHEFRENHDNKIHDLPEHVSRGL
FT                   VLTIVGSLIISCAIFFIFLKSSDIVVVPNLSGLYIEEAITELQHKELIPYVELKFSSTS
FT                   LDKGKVIDQKPKAGTVLRLDSKVKIFISKGSVINKIDNFIGKNIDDVLINLKANAINNN
FT                   RMLYHLLRPVEIESTLPKGTIIRQEPSPGTKIASLVDLQFLVSKGQEDSSVKYIKNYVG
FT                   LYYKDVIISLLNDEIDFDVNVSKGNDFGSVIYQSLSPGNRIENLDKLIITINEPRVNST
FT                   SVFGIMTYKLDVYSSSVDIMLKVKDSSGNSSLFYSFRSKGGLIKLPYEAVKGSTVELYI
FT                   HDKLINQTLVN"
FT   gene            complement(70923..71852)
FT                   /gene="fmt"
FT                   /locus_tag="BRE_67"
FT   CDS_pept        complement(70923..71852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="BRE_67"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_67"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94327"
FT                   /db_xref="GOA:B5RQP3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQP3"
FT                   /protein_id="ACH94327.1"
FT                   /translation="MRIFFASSDGIALEVLKKISDQYDVVGVLTAPDKPSGRGLSLKVN
FT                   DIKREALSRKITVLQPVVLDADVINLVKSLEPELMLVFSYGKIFKQEFLDIFPVGCINI
FT                   HPSLLPKYRGPSPIQTVILNGDSVSGITVQKMTLEMDSGNILAQSQFEIKSFNTSVDIF
FT                   EYVSLNSFDLVIEALNKLLKGDIGIVQDKNNATYCSFLGKEHRTIDFKLSAFDIKNKIN
FT                   AYNPWPLARARLDNNEIIFYRADFISTNDYDDQVIGKIIAFDPSKGLLVKTGDGILVVL
FT                   ELQRIGKKVLDCVSFYHGNRDLIGKVFS"
FT   gene            complement(71849..72346)
FT                   /gene="def"
FT                   /locus_tag="BRE_68"
FT   CDS_pept        complement(71849..72346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BRE_68"
FT                   /product="polypeptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_68"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94328"
FT                   /db_xref="GOA:B5RQP4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP4"
FT                   /protein_id="ACH94328.1"
FT                   /translation="MEIVFYPDDLLRVQTKDVENIDDELRSIIFEMIGLMDKSKGVGLA
FT                   APQVGLDLSIFVVRKNMMSKPLVFINPVITSKSVELSVYKEGCLSIPGVYYDLSRPKSI
FT                   VIEAYDENGKFFKIEDLDILARIIQHEMDHLKGVLFIDYYEDKLRNKLLKSYLKERRLV
FT                   KF"
FT   gene            complement(72374..73069)
FT                   /locus_tag="BRE_69"
FT   CDS_pept        complement(72374..73069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_69"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_69"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94329"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP5"
FT                   /protein_id="ACH94329.1"
FT                   /translation="MKFVNLLAIFIFIVFNSVYLFSNLLNVVFHDSYEDAIDEAKKLYK
FT                   NVLILVGKDIKDNLIRDFLKSFEDDKIFKLIAKHNVFLVIDVNNEIFSEINLKKSPTLF
FT                   FVDAKSEQVRAAYTESIKDTVQYNREFLNYALGVFKLDDIVYKNDNYEINIFDDKVFFY
FT                   KTLDGHWRLRMNGKDKKLLPSKIELKEFLVFQDENGGRLYALPKSKKGGIYFSESEKEE
FT                   WKFFGQIKS"
FT   gene            complement(73066..74844)
FT                   /locus_tag="BRE_70"
FT   CDS_pept        complement(73066..74844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_70"
FT                   /product="peptidase, putative"
FT                   /EC_number="3.4.-.-"
FT                   /note="MICROBODIES_CTER and DDC_GAD_HDC_YDC motifs
FT                   (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_70"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94330"
FT                   /db_xref="GOA:B5RQP6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP6"
FT                   /protein_id="ACH94330.1"
FT                   /translation="MEVNTRILSLRKLMIKNKIDAYLIASHDPHMSEYSHARFNIREFV
FT                   TGFTGSAGTVIITETESVLFTDGRYFLQATNELEGTEFKLIKLGVKGHPDIFSYVNMKL
FT                   KGLRIGVYAEDISIKFYDDLVKNCKFTDIEILHEDLISKIWQDRPYFTGNKIFELKEAQ
FT                   KNDKRINKINKVNAKLEENTIDFYVISSLDEIAWLLNLRGFDIESSALFYAFLFIARSE
FT                   RYKNVLFVNVDKLDFDLIERLEVEGIEVEDYGNFYSFLEEINHEGKFLIPVNSNVKILE
FT                   SIGRSNAVLGLSIVNELKAIKSDYEISKIRDAHIIDAVSLVKFLYKFKNLTKDELADLD
FT                   EVDVSNMLLSFRTLRDEFFSSSFDSIIGFKENSALPHYRPKKGFKKLNQDGLLLIDSGG
FT                   SYLELGTTDVTRTVLIGTASHKEREDYTLVLKSFIALASLKFPFGMLGASLDGIARFPL
FT                   LKHGLNFAHGTGHGVGFFLNVHEFPVSISPLSTYSFKGSEIISIEPGIYRTSEYGIRIE
FT                   NLVFVKQSYLNEFGIFLEFENLTLVPFEKELIVVEMLSKDELDYVNSYHEFVYFALKKY
FT                   LSGDELKFLEMLTSKI"
FT   gene            74968..75861
FT                   /locus_tag="BRE_71"
FT   CDS_pept        74968..75861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_71"
FT                   /product="uncharacterized conserved protein"
FT                   /note="COF_1 and COF_2 motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_71"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94331"
FT                   /db_xref="GOA:B5RQP7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP7"
FT                   /protein_id="ACH94331.1"
FT                   /translation="MKNIKAVVSDLDGTLLLSNSQIGAFSELVIKKLTKENKKFIIATG
FT                   RSKNEIIPLLIQNLNSHVSFFITLNGARVYNNQWQLISSYDLAPDIVKEILNIRENKYK
FT                   DIPHFLQRSDDTDENLYADNITKNAINDIFKKHRLLNKHQYIKHELQDINIRYNEVNNF
FT                   QEIKNFNKIAKILLLHDEEAQLIKYEATILEKYREKVNAYLSTPHSLEIVNSKVSKGNA
FT                   LKDVLTSININLNETIAFGDGFNDVDMLENVKKGLLMGNANYRLKKMLSYLEIINTNHN
FT                   EAVAHYINDNILEDPA"
FT   gene            75875..77113
FT                   /locus_tag="BRE_72"
FT   CDS_pept        75875..77113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_72"
FT                   /product="aminopeptidase II"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_72"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94332"
FT                   /db_xref="GOA:B5RQP8"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP8"
FT                   /protein_id="ACH94332.1"
FT                   /translation="MKKDLIKYAELIILKGINLQKNQCVLITGSIENYEFLRILAQKAY
FT                   EYGAKYVELSIEDTEILKSRLQSTPENLIEFIPDFKHKFFEEMINEKWAKIRIDNTENL
FT                   DALKEYDNKKISKYFQALKLASKNISSAMMNNELAWCTICAPGPKWASKVLNKPESQKT
FT                   LEEFFKIQKKIMLLDTEDPIKAWEIHGNKLHQRCKTLNNLQLEKLIFKNKKTNLEIYLL
FT                   EHSIWTGGSEKISGTEIEFNANMPTQEVFTTPNYKKTNGIMYATRPVKILGNLITGIWM
FT                   EFQEGKIINFGCDNDTLNDILKRHIETDVQAQYIGEVALVDNSSPIYKSGLTFYNTLYD
FT                   ENASCHIALGSAYPSCLSNGSELKTDIAKLDYGCNVSLIHTDFMIGSNDINVIGIAKSG
FT                   KEHIIIQNGQFLI"
FT   gene            77138..77611
FT                   /locus_tag="BRE_73"
FT   CDS_pept        77138..77611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_73"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_73"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94333"
FT                   /db_xref="GOA:B5RQP9"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQP9"
FT                   /protein_id="ACH94333.1"
FT                   /translation="MIKDLFTNDLFLSCLISGIIAQMIKYIIQAIKTKKIKLTPKYFLK
FT                   SIFLETGGMPSSHSSTVTALATSILIKEGINTHFIIALAFALITIRDSFGVRYMAGVQA
FT                   EYLNDLSEQLKMKIKIEPLKIKVVKGHKKKEVFTGILIGIISAWAICNKYYIE"
FT   gene            77639..79105
FT                   /locus_tag="BRE_74"
FT   CDS_pept        77639..79105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_74"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_74"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94334"
FT                   /db_xref="GOA:B5RQQ0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ0"
FT                   /protein_id="ACH94334.1"
FT                   /translation="MNLLKFFYILLIPLLSCNIAQFGDYKPIYLQGEKDLKIANDYINS
FT                   LGYKTISEYTTKVHILDFPNFKEITIDKLIHLNDHDLRKDLFLKKLPNLFNTGSKKILY
FT                   VESSFTNNDLKKLKKDQNIKAEMHSSNYKTKIKYFSITTFIIIIILLLSLNIKYAPFII
FT                   LFLISSCIIFIFSNEISYFYPLTILAYLLFILIDNFSKNYNKIYLKDIGFTVLIKKIKT
FT                   PIFLFLFIVLYFTLSINFLSTNLEALLIICVSISTLCIFLIFTWIKTENNFKHTFLSLI
FT                   KIKEQKRETKILKYKILIHVMLFIVSIMPFFYAQSILNSYNNCNYLYSKKLNYFDYLNP
FT                   NNIYLMVGHNEEIPNIVGYMYHIFYQNELKYKITSQYGKVNTNVKEDYFQIENNKITIN
FT                   SKIIYKVDKEFISKNLNNELSRLFLENGNPILIYKETPVNITINKKNEQTLFTLSLPFF
FT                   LLLFLFKAIRFTILLNMSEKNYRKYIRGSS"
FT   gene            79105..81420
FT                   /locus_tag="BRE_75"
FT   CDS_pept        79105..81420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_75"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_75"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94335"
FT                   /db_xref="GOA:B5RQQ1"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ1"
FT                   /protein_id="ACH94335.1"
FT                   /translation="MFNSQTKIKRQYKINIDEIQIPEYILIPLETANSKSTIYVIENQR
FT                   ISEGQILSKNKNVELYTYAPISGIIEKIYTANLPNKNQIKSALIRFHGRINNEKEISTE
FT                   EESREKTLEKLIRLGIPWFNEDSLFQYMNKCKKIDKMILLINGKDSFTNISEILITTKL
FT                   DKIVYGFENIDKIFKFKEILIITDNHNIKKELEKLNVTKDKRLTIKLISNSPHPYSNHE
FT                   LIMHFLYNEENTKNNINPNKNILLTNIEDLYNVYSTLKTNSPYKEKLITINGNKKIQSK
FT                   ITKVKIGTSIKQIIDKNIDLKKYDIFLNNPTNKIKIDNLNVPITRDIYSITILRKKTIL
FT                   SKVNKIKLLNTPSFSPLCMEQIILEKIKNQDNNENTQQQYLQYTKTEIEEEINKVKKEI
FT                   KENILNISFNNELIYTENNLKDIYLITILALIPNLIFSFANNIKFLIDSIILIITSLCS
FT                   YIPIMLKSKYRYFSFFIYTALITNIILPLNFPITLKIMAIFFTFLMFFYFSRLSKLLIN
FT                   PILISFIFLLLNFPLSFKQTYYKELVKQNDIIPTWNKIISKNTNIHNLEKLKEFKRHEN
FT                   KYIDIIDKFINEQVLSHLNIMIPRFHIENLLGFQNEKYLSPILIYIGFSFILKKFIINK
FT                   LIPLSFYISLLFIAYILQNLSLYNYISFDILSLIMSPIPMILVFTMGTELQTAPHFKFE
FT                   QILYGFALSLGYFITLSYIPLETFSAIISIFILQISATLIKKYSLTFHIRKILHYLRIN
FT                   KEKVRENKNENGEEIIKI"
FT   gene            81417..81989
FT                   /locus_tag="BRE_76"
FT   CDS_pept        81417..81989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_76"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_76"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94336"
FT                   /db_xref="GOA:B5RQQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ2"
FT                   /protein_id="ACH94336.1"
FT                   /translation="MTSNLITYLLANNLLLIHFIGIEDIKIKDNKTLSKKYLTIIITSL
FT                   LIYSCLFYIYKLFVEYNLLFIIPIIYMTLIYILTLMLKTLNNILVVMYNSKTKYSNDFL
FT                   LSNSSLIAIIFFSLDKSHNFLEGITILILSSLSILITIILTKIIKKNLEKKSTFKLITN
FT                   ETMYFFIIFILSLIPNIIILINNSESL"
FT   gene            82023..83066
FT                   /gene="prfB"
FT                   /locus_tag="BRE_77"
FT   CDS_pept        82023..83066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="BRE_77"
FT                   /product="peptide chain release factor RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_77"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94337"
FT                   /db_xref="GOA:B5RQQ3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ3"
FT                   /protein_id="ACH94337.1"
FT                   /translation="MKMYGGSFDSDKIKIQLQKYEKQINNENFWNDNKRAQEILKNQNI
FT                   LKTKIEPWKNLICQLKDLRELCKIAESEDDKAILERDVNKLREQYKHILTLSYFKEDID
FT                   INSAFLTIHSGAGGTEACDWVNMLYRTYLRYSERRGYKIELIDLLESEGGIKSVTIEIK
FT                   GKYAYGFLKSEVGIHRLVRISPFDAAKKRHTSFASVFIDPVIDDKIEIIIKSEDIRVDT
FT                   YRASGAGGQHVNKTSSAVRITHLKTGIVTQSQTDRSQHRNKELAMKVLKSKLYEHYKTL
FT                   EQQKSKSKQQEKKDISWGNQIRSYIFQPYTLVKDHRTKFENPNIMSVMDGNIDNFIEEY
FT                   LKWKNLN"
FT   gene            83048..84457
FT                   /locus_tag="BRE_78"
FT   CDS_pept        83048..84457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_78"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_78"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94338"
FT                   /db_xref="GOA:B5RQQ4"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ4"
FT                   /protein_id="ACH94338.1"
FT                   /translation="MEKFKLIIIMLLSISTTKLAYTQSNIEYRFSYIINTKEENKELQK
FT                   GIEQTLNKIYNAINEHIINDNDKDFIRRIYIYQNIISKEQEFSKLKEDMDKKKLQNAIS
FT                   LKEENKIEVKIKNLKEDIKNIKIQQQELEKYLITLKKIKANYKKNQDKVHLSNLNIEFL
FT                   TSQELFFVNYIHLKKVDKHYLVEISNITPQGIKVYKEIFKLSSSVDDIAYKIAKLSLEE
FT                   ILGREFIKLKINVINNLDAKIYINEEFVSKGLYNNDIWDISKLPDKEIIIDITSTTYKP
FT                   YRIKQKVKSGDTIDLNITLQKANSNKILITSNITSKVFKKGVFIGETPIEIEEPENVES
FT                   ILLQAEEHKNKFIIINNKDKEVYIEMVRNNKSELITKRDLFYINLSIFTLNLIGTAFAI
FT                   TKYNESSELYNIALNNILKNRIRPQDLYNAKVEEMIATFLLGTGITFSVGSFIPLIIHL
FT                   VQYIKEATRGE"
FT   gene            84509..85354
FT                   /gene="ftsY"
FT                   /locus_tag="BRE_79"
FT   CDS_pept        84509..85354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BRE_79"
FT                   /product="signal recognition particle-docking protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_79"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94339"
FT                   /db_xref="GOA:B5RQQ5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ5"
FT                   /protein_id="ACH94339.1"
FT                   /translation="MSIFNKIRNLFKNKEKTQIIERLEDLLLEADIKNDIVIEIVEHIQ
FT                   KIKAKDKQETVLQLKNLLKSYLNQQPLNLENKRLNILLILGVNGVGKTSSIIKLANKFK
FT                   NEGKNVLIAAADTFRAAAIEQLKIQSEKIGIKVISQNQGSDAAAVIFDSISSAKTKNYD
FT                   ILIIDTAGRLQNKENLIKELKKMDQVIKKQILDTNINYKKILVIDSISGKNTNNQTEIF
FT                   DKAIQIDGIIATKFDSSSRAGGIINISKLFQKPIYFFTFGEQVDNIKEFNTENYLNKLL
FT                   "
FT   gene            85351..86406
FT                   /locus_tag="BRE_80"
FT   CDS_pept        85351..86406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_80"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_80"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94340"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ6"
FT                   /protein_id="ACH94340.1"
FT                   /translation="MTTNIIKLILISILIQNIYGKSYFISDVFFNKYQEIYDIPQTGFY
FT                   IEYTKVNEIEKFSLFKDLKLIKYKTQKKIENNKKQLTFYNEKDIKIKEEIYDELNNKIK
FT                   EIKYSPKGIILESVDYFYKNNDVIYKEIKILNQKPKTIHYMKDTNGKLLKITGSDLQIW
FT                   NYGINGEIKSTYLDIKKSKTKVIQYDDQKRHLKNIILDNNKIVSKENNQYLDDNEIINV
FT                   KEEDNTKIISKYKDHNLIKQEVYKDNKITKICDFEYNESGHVTMENVIIKDEDKEYTTK
FT                   TTYEYDSDDKLISKTIYENDLISLKTDYFSDNEYEQKIYHNGNPIFTIRYKNDEIIEQI
FT                   NTDTRDKNETK"
FT   gene            86393..87643
FT                   /locus_tag="BRE_81"
FT   CDS_pept        86393..87643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_81"
FT                   /product="lipoprotein releasing system, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_81"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94341"
FT                   /db_xref="GOA:B5RQQ7"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ7"
FT                   /protein_id="ACH94341.1"
FT                   /translation="MKLNRLLFKRLILDEQNSLSLTIVIILSIVLGQIIIIITISIMNG
FT                   FQNDFFTSISTLESGNLKIENKLNEQEFNSIKKMKEIIQINKIYETQGIGIENYYYPSI
FT                   LNIIAFDTKDVINDKNFLLLTGLTASQIQLNEDEIIIGDVLSYNLDLYAGDTIGLILND
FT                   EITNLHTLKNEVKQFKIKAIFKSNYSKINQSTVFMNINYFYTKQLIKDIDINYQVKTKN
FT                   LYPSKKLINAIKNINQKIKIKPWHEYNKEFYKALKIERNTMLIILTNIFLVIAVNTYYL
FT                   QKRIIINKSKSISIILFLGLRAQKIRKVFLIHSVVICVLGSIIGIISGIIISLNINEIL
FT                   NTIDILINSLINAVNYILKLNLENIEIKIVKNTITPKIFLSDLMLILFFACLFTICSSL
FT                   KVTKKIKYTDKINGATS"
FT   gene            87644..88333
FT                   /locus_tag="BRE_82"
FT   CDS_pept        87644..88333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_82"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_82"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94342"
FT                   /db_xref="GOA:B5RQQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ8"
FT                   /protein_id="ACH94342.1"
FT                   /translation="MHNTQNIICIKEIYKTYTKNKTKIQVLENLNLNVKNGDFISIQGK
FT                   SGCGKSTLFNIISGIDKMDSGDIISCGISLKNANEKTLSLYKNTKIGLVFQNHNLIDEF
FT                   NVFENIILPKIIEGKDNFAEIKKKALRLMKILDIETRKEHYPSELSGGEAQRAAIARAL
FT                   INEPNIILCDEPTGNLDINTAKTVESLLIETSKTFNKTLLLVSHNPEFSNKADIKYELR
FT                   DKTLKRI"
FT   gene            88330..89580
FT                   /locus_tag="BRE_83"
FT   CDS_pept        88330..89580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_83"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_83"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94343"
FT                   /db_xref="GOA:B5RQQ9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQQ9"
FT                   /protein_id="ACH94343.1"
FT                   /translation="MMHSNIKELLKIAYVIFIHSKNKKALIGSGISLSLVMIPLIIVYY
FT                   MSNNIMNATIERYIENEGFSVQIEYNEIQKDEYLKSKLEKFKNEYKHDKLRYFFEKRTY
FT                   GLIGNKKKQGALIRAVENKFINNNKHIKLVDGKKNFNKNEILISRQITEKLNLNINDSI
FT                   YLIVPNNKYQKILPRAQKFTIAGIIETGLREIDKNLVFISLQDANIMTKELSKSIIGLS
FT                   IKTNTKEKTNNLKEKLTKEFKEYKIKTFSELYLNKYTNLNISKKLLIFIMAFIVIFASI
FT                   NISSSLCMLILENKKKIAILKSIGMNNATLKLIFILIALVLSSTSCIIGIIIGNYLTIN
FT                   IEQIINIVDIITNIILKIFGADNTELLNSDYYISEFNIKISTKFSLIILLAYTLISIAT
FT                   TLIPLNIISKFKEKEIL"
FT   gene            complement(89601..90887)
FT                   /locus_tag="BRE_84"
FT   CDS_pept        complement(89601..90887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_84"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_84"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94344"
FT                   /db_xref="GOA:B5RQR0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR0"
FT                   /protein_id="ACH94344.1"
FT                   /translation="MSKTSEERIKIYLSTLSKHKNKILKERRIKEIMGRADISDADMEN
FT                   IEKHFFKIYDRARQLERAGDFAHSLRELDAVYLYSLHNKSLFTLFFNLYKRLVTEINIK
FT                   ETNKKLIHVSLQAREFGIIDGVDLREYDEFSKLKQRILVLLLSFILISVIAFITYRTVY
FT                   PFIVGHEYFGDLERDIKEPVVQGLPSVTRASDLIVESANLIANPNVLYYVEVESAKVLV
FT                   FEDSHTYQLKAGIISSKDSIKNISYSITVYDDLGKPILNKVFEKKSDFPNKWNRGVYVP
FT                   IDFIYNVSKGISSHPKKMVLDIRLIEFFKDVNDFSGINLETSSSILTFKYLGSYFHESF
FT                   EIYEVNSLIEVYNSSSDDVKDLEIEIIYVTKDSQVIRSLKRKLISESNSFLKSRSRQVF
FT                   SLKTIFPKEIYANIKEELSSIKIINVFVK"
FT   gene            complement(90880..91197)
FT                   /locus_tag="BRE_85"
FT   CDS_pept        complement(90880..91197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_85"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_85"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94345"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR1"
FT                   /protein_id="ACH94345.1"
FT                   /translation="MKEIIYRFEKAEDYKLVPINNIYGSVTNTGEIFCDLVFESTEIPE
FT                   EIVYTKTKEGVLEEISGDLRGSKEKVILINSFVGISITKDTAKNIAYWLLKKVDELEDN
FT                   E"
FT   gene            91362..92630
FT                   /gene="nifS"
FT                   /locus_tag="BRE_86"
FT   CDS_pept        91362..92630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="BRE_86"
FT                   /product="nifS protein"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_86"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94346"
FT                   /db_xref="GOA:B5RQR2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR2"
FT                   /protein_id="ACH94346.1"
FT                   /translation="MNINILENKNEKIKNLRKDFPILNKTINNKKIIYFDNAATSHKPQ
FT                   SVISSIVEYYTNYNANVHRSGHQFAIESSLKIEETRKIVKQFINAESPKNIIFNSGTTD
FT                   GTNTIANSLLLSKFFKENDEIITTTLEHNSNVLPWINIAKFLNLKIKLAKFNEMGIIQS
FT                   EQIQNLITDKTKIITMSGINNILGTMQNLEQIGKIASDNKITLFIDAAQMAPHIKIDVK
FT                   KINCDFLVFSGHKMLAPTGIGVLYISDKIINKLNSSKLGGNAIENIYIKNEKLDFQTIN
FT                   SPNKFEAGTPNIAGIIGLGQAIKYINNITMEFIQEHDQELIEYCISKLKEIDEVEFILN
FT                   KNIKRKSIISFTVKNIHSHDIETYLDTMGIATRSGKTCAYLAFFSENIKKDHLLRISFY
FT                   LYNTKEEIDIFISSLKKTIKEFY"
FT   gene            92776..93171
FT                   /locus_tag="BRE_87"
FT   CDS_pept        92776..93171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_87"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_87"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94347"
FT                   /db_xref="GOA:B5RQR3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR3"
FT                   /protein_id="ACH94347.1"
FT                   /translation="MFSEEIKKELIRLSKIKKYCFQVEKNQSPIYHKSKCGDQIIFQTD
FT                   KDNKKIKLKYNAYGCIVFLASTYLLTKICDNQPKKTTLEIITKIINNNFENLEEINKNL
FT                   KIFENFLYTNRKNCFILPYKALKEILK"
FT   gene            93126..94733
FT                   /locus_tag="BRE_88"
FT   CDS_pept        93126..94733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_88"
FT                   /product="magnesium chelatase family protein"
FT                   /note="ATP_GTP_A motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_88"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94348"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR4"
FT                   /protein_id="ACH94348.1"
FT                   /translation="MFYSAVQSFKRNFKVTLNNRQLKENYMQIYSHSSIGYEGELIEVE
FT                   VDIKKEIPGIDIVGLAGSEIKESRERIKAAIKNSEFTFPKDRILINLAPAGIKKIGTAI
FT                   DLSIATSIISTKENKNNNLKVLMLGELQLDEQIRTIKGVLPAISLAKEKGIKCIIIPFD
FT                   NLEEALLISNLNIWGVKTLKETLEIIENLNNNIFPAKPTINFKIEENEEEFEYDFKNIK
FT                   GQHRIKRALEIAVAGGHNIMIFGLPGSGKTLSIKCVQSILPPLTNKEIIETNRIWSIAG
FT                   KLIDTKIIRKRPFRQPHQTASKEGIIGGGANALPGEVSLAHNGILFLDEALEFQKSILQ
FT                   SLHEPIEDKTISIVRASSKSFKYPANFQLMIATNPCPCGNLGKNDIECFCSQQEVSNYW
FT                   KKFEAAMLDRIDIRVPVKPVNNAKLFQEDNESSQEIKKRIIKARNIQNQRYENIKNVHE
FT                   NSDLKPEHIAIFCNLDKILTEEMIYILNKLNISSRATHSILKLARTIADLKDESHISRE
FT                   SLLKAIEHRKHGEKLLEE"
FT   gene            complement(94756..95718)
FT                   /gene="ldh"
FT                   /locus_tag="BRE_89"
FT   CDS_pept        complement(94756..95718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldh"
FT                   /locus_tag="BRE_89"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_89"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94349"
FT                   /db_xref="GOA:B5RQR5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR5"
FT                   /protein_id="ACH94349.1"
FT                   /translation="MEMVMLKRNKVVLVGAGGVGSSFAYALTIDNSLVHELVIIDVAQD
FT                   KAKGEVMDLNHGQMFLKKNIKIEFGSYDDCSDADIVVITAGLNQKPGETRLDLVGKNTK
FT                   IFKEIVTSIVSSGFDGIFVIASNPVDIMTYVTMKYSNFPTCKVIGTGTTLDTSRLRYFL
FT                   AERLNVNTQNIHSYIMGEHGDSSFATWDETKIAMKSLSEYIVDGTILESELDEIHNNVV
FT                   NAAYEVIKLKGSTYYAIGLGIKRIVNAIIGDQNLILPISSYINGQYGDSIKDIYIGAPA
FT                   VVCKDGVKEVLDFKISERELKKFQISANQLKSYLDKIKF"
FT   gene            complement(95896..97563)
FT                   /gene="lepA"
FT                   /locus_tag="BRE_90"
FT   CDS_pept        complement(95896..97563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="BRE_90"
FT                   /product="GTP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_90"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94350"
FT                   /db_xref="GOA:B5RQR6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR6"
FT                   /protein_id="ACH94350.1"
FT                   /translation="MDIERERGITIKSQAVTIDYKCSDGNIYELNFVDTPGHVDFSYEV
FT                   SRAISSCEGALLLVDASQGIEAQTVSNFYMAFEHNLEIIPVINKIDLPSANIDFVKEQI
FT                   ENDLGLDANVAVLISAKNGIGIDELLEAICKYVPFPKGSRESPLKALIFDSHYDSYRGV
FT                   VVHFRIFEGQIRPGYKIKFMHADREYFVEEIGIFKIILEKKDVLEAGDVGYFIAGIKNI
FT                   SDVKIGDTVTLVDNPAVAPLEGFKEVKPVVFSSVYPVDANQYDDLLKAMDRLKLNDASL
FT                   TFEKDASAALGHGFKCGFLGLLHLEVIQERIEREFDLSVILTSPSVRYKIIPKKGNPYF
FT                   IESPEQFPGNENIEVTLEPYIRANIIVPAEFLGNIMSVCLLKRGVQENLIYLDAKRVEV
FT                   IYKMPLAEILFDFYDKIKSVSRGYASFDYTLLGYEETDLVKLDILVNGDRVDALSQLVF
FT                   RDGARAKALNICKKLKDEIARQQFKIAIQGAIGSNIIARETISPVRKDVTAKCYGGDIT
FT                   RKRKLLEKQKEGKKRLKMIGNIEIPQSAFLAVLKSDDN"
FT   gene            complement(97742..98746)
FT                   /locus_tag="BRE_91"
FT   CDS_pept        complement(97742..98746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_91"
FT                   /product="uncharacterized conserved protein"
FT                   /note="RGD motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_91"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94351"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR7"
FT                   /protein_id="ACH94351.1"
FT                   /translation="MRKFNIFMNMLRFFLFFFIFSFILSLNSLGVKELPYWILIEKGRQ
FT                   LIYSKEGFIKSNLTDAINFLQEALLRKGIYPEANYYLSIVYSMIGNVVLQKLHLQKTLE
FT                   DKDYLLDKSFEKNILFSLAKIAEIKNNYVDMIDYLNEILSKFSRGDDYYNYHYIVQKYG
FT                   DTSDNKSDMSFYLNSYLKQVRGTSGIDFTFNLYRFNNYGLIDTHKLLSKVYLKIGAHKL
FT                   AITHGLVAAVGILTRMYHYINYYEPLYEFKNLRSFVKKINEYNDVKSSFESTDFWEIMY
FT                   NISYATYIYDENKHKLRAVDTWKLIVDLAPKFSPYVLKSKTHIKNFLVNKNIH"
FT   gene            complement(98783..99217)
FT                   /gene="atpK"
FT                   /locus_tag="BRE_92"
FT   CDS_pept        complement(98783..99217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK"
FT                   /locus_tag="BRE_92"
FT                   /product="V-type ATPase, subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_92"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94352"
FT                   /db_xref="GOA:B5RQR8"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR8"
FT                   /protein_id="ACH94352.1"
FT                   /translation="MDIGLVGVNSALTVSAIGSALGMGAAGSAAIGAWKRCYMQGKSAP
FT                   FLLIVFVSAPLTQIIYGYILMNTLAEVMTQANPWLLFGAGFGGGLAMAISAFAQGRTAA
FT                   GACDSFAETGKGFATNLLVLGLIESVALFVMVFLMIFKFV"
FT   gene            complement(99237..101072)
FT                   /gene="atpI"
FT                   /locus_tag="BRE_93"
FT   CDS_pept        complement(99237..101072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="BRE_93"
FT                   /product="V-type ATPase, subunit I"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_93"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94353"
FT                   /db_xref="GOA:B5RQR9"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQR9"
FT                   /protein_id="ACH94353.1"
FT                   /translation="MLMIVKMKKVLLLTLLKYKRDSLEILRELGVVHINFCNKVSESLQ
FT                   KVIEERSILNHALSLLGDDSEVQILSSSNENFLDIAKRIVDLGSEIKDLREMRQLLLRN
FT                   RDIISCWGYFSVDLVNKLRGCNIHVQFFKSGMSEYKKLLLFSQVKVALINNYKGTAYFV
FT                   AINDSKQNIDVAEEYEFEFDLDSIETKLKMIDEVLEQKLTQLSVLNKYRNILKDAIKEY
FT                   EQIIEFEQVMADMNVECDEFVYITGFIPEDKQKYLQNATLNGKFVVQFAEPDDNDFIPT
FT                   YVKRKGIAKLAKPIFDVLDTIPGYKERDVSCVFMLFFFVFFGMIIGDAAYGVIFLLIGI
FT                   IINLISVLKNKPLTSAHALIFYLSTSAIIYGSMTGTWFGSGHFVLDLFPILKSLKVEYL
FT                   TGNNGMQNVMFICFTIGVLQLSLAHVWNFVQKVKEKPHIHAIAQIGWLVLMPGLYYFVL
FT                   NLILGSDNFPMHSMILNMIYFGVMLIFVFDKQDGSNFFVCMLKSFGGLIEQFLATVSGF
FT                   ADIISYIRLFAVGLAGLAISDSFNSMSVSLLKSSNIGLIIGGVIVILFGHILNIMLSLL
FT                   SVVVHGVRLNMLEFSNHLGQEWNGYSYRPFKKIKD"
FT   gene            complement(101077..101673)
FT                   /gene="atpD"
FT                   /locus_tag="BRE_94"
FT   CDS_pept        complement(101077..101673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BRE_94"
FT                   /product="V-type ATPase, subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_94"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94354"
FT                   /db_xref="GOA:B5RQS0"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS0"
FT                   /protein_id="ACH94354.1"
FT                   /translation="MPKVKLTKNELKKQKDDLKMFSRYLPTLQLKKQQLHLEIRKVKAL
FT                   KEVKKLERDKLKRNMKFWISLFGERFPFQDWIQIKKVRKGFTNIAGITIPVFESVEYED
FT                   IKHDLLLTPYWVDVGIEAIKNIIQINAELEILDEQANLLELELNITSQRVNLFEKVMIP
FT                   NAKVNIKKINVYLGDQQTAAVVRGKMAKASLIKNR"
FT   gene            complement(101676..102983)
FT                   /gene="atpB"
FT                   /locus_tag="BRE_95"
FT   CDS_pept        complement(101676..102983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BRE_95"
FT                   /product="V-type ATPase, subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_95"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94355"
FT                   /db_xref="GOA:B5RQS1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS1"
FT                   /protein_id="ACH94355.1"
FT                   /translation="MQMKRVYSKIESIIGNVITVIAKSVKYGELAIVKSKNGSSLAEVI
FT                   KLERDKVSLQVYNGTIGISTSDEVKFLGHPMQVTFSENLLGRIFDGAGNPKDGGPRLED
FT                   NLIEIGGPSVNPAKRIVPRNMIRTGIPMIDVFNTLVESQKLPIFSVSGEPYNELLVRIA
FT                   LQAEVDLIILGGMGLKNDDYLTFKDSLESGGALSRTIFFVNTANDPVVESLIVPDISLA
FT                   VAEKFALQGKKVLVLLTDMTNFADAMKEIAITMEQVPSNRGYPGDLYSQLASRYEKAID
FT                   FEGAGSITVLAVTTMPGDDVTHPVPDNTGYITEGQYYLRRGRIEPFGSLSRLKQMVNGK
FT                   TRDDHRTIMDSMIKLYASSRESIEKKAMGFNMTEWDEKLLKYSNMFESKLMDLSLNIPL
FT                   EEALDLGWTILSSCFEPNETGIKTELLEKYWPKNRD"
FT   gene            complement(102987..104717)
FT                   /gene="atpA"
FT                   /locus_tag="BRE_96"
FT   CDS_pept        complement(102987..104717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BRE_96"
FT                   /product="V-type ATPase, subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_96"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94356"
FT                   /db_xref="GOA:B5RQS2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQS2"
FT                   /protein_id="ACH94356.1"
FT                   /translation="MEAKGKVVGVIGNLVTIEMVGTVSMNEIVFIKTGGQSLKAEIIRI
FT                   RDGEVDAQVFEMTRGIAVGDDVEFTDKLLTVELGPGLLSQVYDGLQNPLPELATKCGFF
FT                   LERGLYLSALDRNKKWSFNATAKVGDFIVAGDFLGFVIEGTINHKIMVPFDRRDSYRII
FT                   EIVGDGDYTVDDRIAVIEDDAGGKHIITMSFHWPVKVPVTSYKKRLIPNETMVTQTRII
FT                   DTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDIVIIAACGERAGEVVETLKEFPE
FT                   LTDPRTGKSLMERTCIICNTSSMPVAAREASVYTAITISEYYRQMGLDILLLADSTSRW
FT                   AQAMREMSGRLEEIPGDEAFPAYLESVIASFYERAGVVVLNNGSVGSVTVGGSVSPAGG
FT                   NFEEPVTQATLKVVGAFHGLTRERSDARKFPAINPLDSWSKYRGVVEYEATEYARAFLV
FT                   KGNEVNQMMRVVGEDGVSIDDFVVYLKSELLDSCYLQQNSFDSVDAAVSFERQNYMFNI
FT                   LYKILQSDFKFENKLEARSFINDLRQNILDMNLAPFKQEKFNKLEINLKNLLRSKKLDF
FT                   "
FT   gene            complement(104728..105273)
FT                   /locus_tag="BRE_97"
FT   CDS_pept        complement(104728..105273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_97"
FT                   /product="uncharacterized conserved motif-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_97"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94357"
FT                   /db_xref="InterPro:IPR024492"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS3"
FT                   /protein_id="ACH94357.1"
FT                   /translation="MLSSYYYIISSLPYLDLKVEKVWSISDFFDNVEIVLSREDFLFIK
FT                   DLSELRFNKESSEVAKKFFEFEEIIRYTLAVIRAEKLGFEKDIYLESPYFSSYYLGILK
FT                   PLCLKENPFEVELGIDILKWQFLTELEVGNEFNFEKLIIYFLKLMLISRRSLFREEIGE
FT                   KNFDDVCQKLSIKISKNF"
FT   gene            complement(105283..105879)
FT                   /gene="atpE"
FT                   /locus_tag="BRE_98"
FT   CDS_pept        complement(105283..105879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="BRE_98"
FT                   /product="V-type ATPase, subunit E"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_98"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94358"
FT                   /db_xref="GOA:B5RQS4"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQS4"
FT                   /protein_id="ACH94358.1"
FT                   /translation="MQFEVKDLINKIKKDGLDEAERLASEIILNAKQEAEAIILKAESE
FT                   AKELKIKAEKEAYDYKRYSLEASRQAFRDLVIGTENSIKSLFKSALKDSVSSVYDSNFL
FT                   RELIIRVLDVWGKDDKIDIMLNESDIDNLSSILKTSIRNKFGAEIEIKPFKGINKGFKV
FT                   QQRDGSLYYDFTSEAIADILFEYLNPRFKEIIKLD"
FT   gene            complement(105986..106381)
FT                   /locus_tag="BRE_99"
FT   CDS_pept        complement(105986..106381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_99"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_99"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94359"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS5"
FT                   /protein_id="ACH94359.1"
FT                   /translation="MGILKFQEFESVLFNICLYVDSILEDEFGNAYELHPSRLSRGKAA
FT                   NGCLDGLFRVTTSFTFGYGSKFGRGYLIIIEMITLDVVDVEFNKKIVEKGIEVFGAKLK
FT                   EKFPEKDLSIVYDINVYKIIGNFFHDI"
FT   gene            complement(106384..108741)
FT                   /pseudo
FT                   /locus_tag="BRE_100"
FT                   /note="DNA mismatch repair protein mutS"
FT   gene            complement(108689..109630)
FT                   /locus_tag="BRE_101"
FT   CDS_pept        complement(108689..109630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_101"
FT                   /product="uncharacterized conserved protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="ATP_GTP_A motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_101"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94360"
FT                   /db_xref="GOA:B5RQS6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQS6"
FT                   /protein_id="ACH94360.1"
FT                   /translation="MNSSTFEVLWGVNNIYSVVEVNTNTVYEGVIKGKFLNTREKEYSP
FT                   LVPGDFVCGDIYDEHKVYIKERMERRNVFWRYNKKVALRQVIVSNIDNILIVSSATLPE
FT                   FKNSFIDRTLIVAEEQGITPIILVNKVDEGINLRVDSFIKIYEYLGYRVIKTSVVTLQG
FT                   IDEVKKIIKNSRTSFIGQSGVGKSSLINVIDLNASQAINEISYKYARGRHTTVYAVAFH
FT                   SDNKILIDTPGIKEFGIEGLGYLELKYYFKEFKYFNDLCRFNSCLHINEPNCFVISQIG
FT                   FKIAEARYNSYLKIFSELKRYKSYAREIFGKN"
FT   gene            complement(109627..110391)
FT                   /gene="murI"
FT                   /locus_tag="BRE_102"
FT   CDS_pept        complement(109627..110391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="BRE_102"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_102"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94361"
FT                   /db_xref="GOA:B5RQS7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS7"
FT                   /protein_id="ACH94361.1"
FT                   /translation="MNNLEDVIVIFDSGIGGLAYFEYISKKLFNRNYIYVADNKNFPYG
FT                   DKSSNFILNEFLELISKLREIYNIVSIVVACNTASISVYNKLNFNFPIIYTLPSVSLVK
FT                   ELVFKRVILIATNTTINSEFVKKEQNNHIDLILKSAGELVKFVEYGDIFEKDALEYLKS
FT                   LKFEVQSTKRDMVFLGCTHYLHIKDMIESVLEIPVYDNRKIVADELNKSLKNVENSDYC
FT                   FKRYFYLTQDKNLHFYKNFCKKYNFYFKGIFN"
FT   gene            110510..111895
FT                   /gene="asnS"
FT                   /locus_tag="BRE_103"
FT   CDS_pept        110510..111895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="BRE_103"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_103"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94362"
FT                   /db_xref="GOA:B5RQS8"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS8"
FT                   /protein_id="ACH94362.1"
FT                   /translation="MHKSIKEILNNPITNNTITVKGWIRTKRSNGKISFLEINDGSNIK
FT                   GIQAVIDENNPQFEKKEFKKLTTGASISLTGILILSPAKGQTYEIKTTNFYIIGESDQK
FT                   TYPLQKKRHSFEFLREIPHLRIRTNTFGAVARIKNQISYKIHEYFQKNGFFYIHTPIIT
FT                   SNDGEGVGEIFRVSTLNLNNIENKKEIDFKDDFFGKQAFLTVTGQLHGEAYAMALSKIY
FT                   TFGPTFRAENSNTTRHASEFWMIEPEMAFFTLEDNINLAEDFLKYVLSETLNHCHEDME
FT                   FFDNFIEKGVIKKIEDVINSKFEVITYTQAIKKLENAKKTFEIKPYWGMDLQTEHERYL
FT                   TEEIIKKPTTVIDYPKEFKAFYMKMNQDNKTVKGMDILVPRIGEIIGGSEREDNLDKLN
FT                   NRIKELNLETETLNWYLDLRRFGSTPHSGFGLGLERLLQYTTGMPNIRDVIPFPRTPKT
FT                   LHF"
FT   gene            111923..112471
FT                   /locus_tag="BRE_104"
FT   CDS_pept        111923..112471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_104"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_104"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94363"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQS9"
FT                   /protein_id="ACH94363.1"
FT                   /translation="MQIKILYKIVLMSPVLILFANEKLKDDFKIFSNIEKEITNKTNKS
FT                   KPKINKSNKINYPHKKINYHHEIRRKKNTDFKSYNKEHINNHTNGTVKIKKSKKIYYPQ
FT                   DKINIQEPNLEKNVWYNIKVYPTNIKDRFKKIKLLNNINTKIKKDFALIGPILEDNLGE
FT                   ITKALNIRGYNELEYIKLE"
FT   gene            complement(112474..113064)
FT                   /locus_tag="BRE_105"
FT   CDS_pept        complement(112474..113064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_105"
FT                   /product="uncharacterized conserved protein"
FT                   /note="predicted phosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_105"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94364"
FT                   /db_xref="GOA:B5RQT0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT0"
FT                   /protein_id="ACH94364.1"
FT                   /translation="MKKFVSYEDVRINGLKLAYKIYKDGFIPDIMYVSLRGGAYLGNII
FT                   SEFFKFIKPEKPLLYAAVVARSYDVSNKQKKIMIDGWTYDPKYLRVGDNVLFVDDIFDT
FT                   GRTIIHLREEVLKRGIDSQNVRIAVYDYKERGHIDYEPDYYVNKYSDEDELTTWIHYSN
FT                   HELIGLSEDEYKLNFVNLDDELLDILKFLSKKL"
FT   gene            complement(113414..114871)
FT                   /gene="htrA"
FT                   /locus_tag="BRE_106"
FT   CDS_pept        complement(113414..114871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="BRE_106"
FT                   /product="periplasmic serine protease DO"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_106"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94365"
FT                   /db_xref="GOA:B5RQT1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT1"
FT                   /protein_id="ACH94365.1"
FT                   /translation="MEVYKMNKNFISVFFASFLALAVGFFVGIGYLKSEKNTIVFAQEK
FT                   GDAVHSLQDSFREVSKKILPSTVEIYATGTIKTRDPMQFFFFDIPGLNLEKKAQWGGSG
FT                   VIIGKDSKKTNLFYVLTNSHILENASEFEVGTYNNKSYKAQLVGKDDKKDIALVSFEAD
FT                   DVVDIGVAELGDSDRLEVGDWVIAVGSPYHFSFSVTAGIISGLHRSFNPNLKARNLFIQ
FT                   TDAAINRGNSGGPLVNTKGEVIGINSWISSPSGGNIGLGFAIPINNAKSVFDALMSGQK
FT                   SESSWMGVAFHRLRSKDVEFLKSLGYEDESVSLAIVAGVYDGSPALKAGFRAGDVISKI
FT                   DGVAMNLFFDVKQYINDFYAKEKIKVEVLRGQETKTFEVELGVMPTNIDKEKGNTLDLK
FT                   LMPGFTVYPLTKEVRVQLGLRNWINGVVVDSIDSTLGNNPQIATGDIIMIVNSKNVKTL
FT                   RDFYDAIKHGKNNYSILRNGQTLKVSI"
FT   gene            complement(114912..115664)
FT                   /gene="map"
FT                   /locus_tag="BRE_107"
FT   CDS_pept        complement(114912..115664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BRE_107"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_107"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94366"
FT                   /db_xref="GOA:B5RQT2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT2"
FT                   /protein_id="ACH94366.1"
FT                   /translation="MKLRLKSREEIEKIKASGRLLAQTFLEIEKNIAPGINTKTLDFIA
FT                   SDFITKNGGKSAFKGYNGFKGTICASINEEVIHGIPGSRMLKNGDVISIDCGVVLDGFY
FT                   SDMAKTFKVGKVSSQVSRLLEITEAALYKGIDEMKVGNRILDISKAIENYIKPFKFGIV
FT                   REYTGHGVGFSLHEEPSIPNYYDPFFKNIEIREGMVLAIEPMVNLGSHKVSLKSDGWTV
FT                   FASDLSFSAHFEHTVAVIDGLPLILSKV"
FT   gene            complement(115669..117318)
FT                   /locus_tag="BRE_108"
FT   CDS_pept        complement(115669..117318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_108"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_108"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94367"
FT                   /db_xref="GOA:B5RQT3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT3"
FT                   /protein_id="ACH94367.1"
FT                   /translation="MKTNRLFFILFLVFFVSIFVYLSLNPYVLYILKGERDFNEVIIEI
FT                   DDYISSGNLDSAEKAIKFYSYYADTEYKWLSLVKRAKLYSDKINHYVLMRNILDLSVKS
FT                   LPGNLKLRALEVYSKLKVGAVLEAYDVAKQYLLGYKEYKYLCDEAFIKSLILNYDVKDI
FT                   KSFLIKMEQERDALAFETIGFNLQNNAFLINAMLLYIDKKDFDAARRILLKIKEDKDFA
FT                   KELAYISYGLDNLDFTIANLKLLSDNSEPSLMFLLADAYLKKGDINNAKSEYLKLYTDF
FT                   PDYSMMIYLGLAFIAKKENDLKRAITYLNKANEKFKGNEMMNYYLASMYFEINDYFNAN
FT                   EIVKRYKDNPLFFKLYFILNYSNLKYEAKKSFLWRLFYRSNYSSDIAQFLAWNLLLYSD
FT                   LKDLDLFFNVYNPVDEIQDWYYFYKFYYLFLKKDLVVAEKILLREQTNKYLYGIYYNFG
FT                   VLKFYQKNYKESEEYFSNAVSTLPFAIDDKSSINLKEREDIAKIYLKRGINYLYLGEFE
FT                   KGREAISIANSFYETNEGKLYMNMIKIFKERN"
FT   gene            complement(117305..117745)
FT                   /gene="nusB"
FT                   /locus_tag="BRE_109"
FT   CDS_pept        complement(117305..117745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="BRE_109"
FT                   /product="N-utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_109"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94368"
FT                   /db_xref="GOA:B5RQT4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT4"
FT                   /protein_id="ACH94368.1"
FT                   /translation="MVMDLRHKARILAFQKIYSIDVNCKAKDNIFDIFSFEENGIDLDG
FT                   DLKLFYSVLVNGTYDNLESIDKLISGISLNWRLDRMDKVDLAILRMSVYSLKFQDLDVP
FT                   KRVIIDEAILIAKKYGNKNSDKFVNGILDALLKDMESSFENK"
FT   gene            complement(117764..118774)
FT                   /locus_tag="BRE_110"
FT   CDS_pept        complement(117764..118774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_110"
FT                   /product="basic membrane protein"
FT                   /note="RGD motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_110"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94369"
FT                   /db_xref="GOA:B5RQT5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT5"
FT                   /protein_id="ACH94369.1"
FT                   /translation="MGNFLCFLLFCVLGITSFAQNTPVVIINLHSNEIITKTEFDSKVN
FT                   TLKKTQGRDLSNIEKKQVLQVLIADVLFGQEALKQGIKVADDEVMQTIRSQFGLASLTD
FT                   EQIKQMIESQGTNWNELLASMKRSLAAQKLVLKIAQPKFSEIKAPSEKEVIEYYEANKT
FT                   KFVNPDIARISHVFFSAKDKKRSEVLEQAKDIAKQIKSSKITFEEAVRKYSNDEGSKVK
FT                   NGDLGFLARGDQSAQNVLGADFIKEVFVLKKGNVSNPISSKEGFHIVKVTEMYSQKFLG
FT                   LQDKISPNVNMTVKDAIKNNMINVHQQQIVAKIQQEIYDKLNKSASIQILDSSLK"
FT   gene            complement(118865..120058)
FT                   /gene="fadA"
FT                   /locus_tag="BRE_111"
FT   CDS_pept        complement(118865..120058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="BRE_111"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_111"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94370"
FT                   /db_xref="GOA:B5RQT6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT6"
FT                   /protein_id="ACH94370.1"
FT                   /translation="MKKIAIIGGLRSPITRFGGTLKGMNIVDVSADIVKVLLERNSIDK
FT                   VDEVIVGNVISSGLGQNIARQITLKASLGEAIPAFSVNKVCGSGLKSLELAFNSISLGE
FT                   SEVVVAGGVEDLSNAPYLLPRNVRFDGLKFGDFKIEDSIYKDALVDTPSSTVMGITAEN
FT                   LAEMYEITREMQDQFAYNSHMKAKVARDSGYFNDEIYPLSIFDKKTKLKNVVSSDEEIR
FT                   DNLSLEKLASLKPIFKENGTITAGNSSSLDDGACFLILASGDFVHKMNVKPLAYIGGFK
FT                   SVGLNPLHMGFGAFLAIEGIIEKFSLNSNEIDFIETNEAFAAQSLSVLKALREKYGIKD
FT                   DIVNVNGGAIALGHPFSVSGSRILLTLARLMNMNNKSKGIASLCIGGGQGIAAFLYR"
FT   gene            120249..121604
FT                   /locus_tag="BRE_112"
FT   CDS_pept        120249..121604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_112"
FT                   /product="uncharacterized conserved protein"
FT                   /note="RGD motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_112"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94371"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT7"
FT                   /protein_id="ACH94371.1"
FT                   /translation="MYLAKVSFKTIIIMLIINSHAYNYLMKYQNDGIDKYHFDKLNDGF
FT                   GFALSDFFDDLRSGSLIFIHESKHNFIINAEAHMLTFRGDKESPEQLRKRIDLLELGFM
FT                   YYFPILFKTKTQYFGNFNIDIGIKNLLYGNWGGSLIQRAVHFALRQLRPIPKNYEHYHY
FT                   RGFISTAINYSYMGFFYLENYIDLSYFLDYFFKTSISMDFKNQFIGIETQLFYQIQSKI
FT                   KDIETYLKIQEAETGIGIQYKLYSKNFFSINNLNLNNFSNKEKFFSVGGFGIIITEEYD
FT                   NPIENNLYLLNHNFSIEYDIMLPFQTRNIIYYKIIPQLNYYFAISANYDINAHEINSRT
FT                   NRFSSGITYEFFTKNRLILYIASGLFLAYNKDKKDIKSIYRPLKIKDTLQTGLEIEPGV
FT                   NINAFTYNKTKYNIKIFTKMNYSPLVYNTNNHTLEKHKFICNYLGIGIKINI"
FT   gene            complement(121645..123039)
FT                   /gene="dnaB"
FT                   /locus_tag="BRE_113"
FT   CDS_pept        complement(121645..123039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BRE_113"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_113"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94372"
FT                   /db_xref="GOA:B5RQT8"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQT8"
FT                   /protein_id="ACH94372.1"
FT                   /translation="MAFTSISTTSTLLFNEGAEKAVISSIFYNPGKVEEALLYLKPDDF
FT                   YNQDHEMIFKAMISLYEKRENIDPITVFEEVSTITPKSQLVNNLKALTGLQDYLSFLSG
FT                   YLPTDKTINIYAKIVKEHRIRRDIAKISRELNDLANDSTKKVEQFVEEAQRQVLSIELD
FT                   CSNKNLNHAKVIAERVHAEIYERSVQKREVDFGIPSGFKKVDSLIGGFRESDFIIIGAR
FT                   PSVGKTAFALNIASSIALKGDKKRRVGFFSLEMTSDALIKRIIASQANIDGFKIQNSIL
FT                   SGHEIKAINDVVNDISNSEFYIEDTANISLLTLATQARKLKRFSGIDILFVDYISLISL
FT                   ESKNVPRHEQVASISKALKELARELKIPIVALSQLTRDTEGREPSLASLRESGALEQDA
FT                   DIVILLHRDKDLKNNSDDDDGIVNAIDTKVIVAKHRNGPTGRVDILFLPHVVKFVNKEH
FT                   EMDYYL"
FT   gene            complement(123058..123552)
FT                   /gene="rplI"
FT                   /locus_tag="BRE_114"
FT   CDS_pept        complement(123058..123552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BRE_114"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_114"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94373"
FT                   /db_xref="GOA:B5RQT9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQT9"
FT                   /protein_id="ACH94373.1"
FT                   /translation="MKVILREDFINLGKEGDIVDVKDGFARNYLLPKGFAVFSNKHNID
FT                   IFSQKKRAILKRQESRRKMAVELKEKLDKVNLEFIMQSNDSGKLFHSINSSNIADELLK
FT                   LGFEIERRKIDMHHGALKAFGTYNVIIKLYEGISSVITVEIKREEKKNSLKKSKSVKKE
FT                   V"
FT   gene            complement(123566..123856)
FT                   /gene="rpsR"
FT                   /locus_tag="BRE_115"
FT   CDS_pept        complement(123566..123856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BRE_115"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_115"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94374"
FT                   /db_xref="GOA:B5RQU0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQU0"
FT                   /protein_id="ACH94374.1"
FT                   /translation="MYKDIDSHQRDSRTDGHQDGFKKNPNFRFFKKKTCKFCDMDRVPD
FT                   YKEFDFLKKFITEQGKILPRRITGTSAKHQRRLALEIKKARYMALLPFVKK"
FT   gene            complement(123869..124309)
FT                   /gene="ssb"
FT                   /locus_tag="BRE_116"
FT   CDS_pept        complement(123869..124309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="BRE_116"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_116"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94375"
FT                   /db_xref="GOA:B5RQU1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQU1"
FT                   /protein_id="ACH94375.1"
FT                   /translation="MADINSLVLSGRLTRDSELTYTDSGMAILKFALANNRRIKKLDEW
FT                   IDYAQFFDCVIFAKRAESLSAFLKKGKQVVVSGSLKYESWQDKNTGDKKSKCSILVDEI
FT                   QMFGSSTAVAQGTNNVDFESYKKPDSFKTIDFDNGFNEDIPF"
FT   gene            complement(124321..124725)
FT                   /gene="rpsF"
FT                   /locus_tag="BRE_117"
FT   CDS_pept        complement(124321..124725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BRE_117"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_117"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94376"
FT                   /db_xref="GOA:B5RQU2"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQU2"
FT                   /protein_id="ACH94376.1"
FT                   /translation="MIKKYEGCFLFRSEELEYKSALEEVKKQLVAFGAVDFVENSIGER
FT                   ALEYPVRKQLRGRYEIIEFKMASDNLRELEAQLKLIKNLLRYMILVKINRKVSVKKVKR
FT                   RNFREYRDNKDIKEKEQPSESNVDADLKVN"
FT   gene            complement(125408..127113)
FT                   /pseudo
FT                   /locus_tag="BRE_118"
FT                   /note="PTS system, maltose and glucose-specific IIBC
FT                   component malX pseudogene"
FT   gene            127322..127998
FT                   /pseudo
FT                   /locus_tag="BRE_119"
FT                   /note="hemolysin III (YplQ)"
FT   gene            complement(128044..129324)
FT                   /locus_tag="BRE_120"
FT   CDS_pept        complement(128044..129324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_120"
FT                   /product="zinc protease, putative"
FT                   /EC_number="3.4.24.-"
FT                   /note="ZINC_PROTEASE and amidation motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_120"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94377"
FT                   /db_xref="GOA:B5RQU3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQU3"
FT                   /protein_id="ACH94377.1"
FT                   /translation="MYIFFSILAFTFIIFIHELGHLFFARLFKVKVEVFSIGIGPSLFK
FT                   IKIKDTEYRFSPIFLGGYCKLKGSEHLEHELRLNKQLEANKDSIFGISHFKRILIYFAG
FT                   PLFNLIFALIVFIVIEMIGIVYPDYSNKIIVINKNALSKFRDGDVILNVDNTNIKYYSD
FT                   LKKVLPLKNSKVTFTVLRDGENISFEDNTSLDKFLEEINPWIDLVVAKVKINSSAEVAG
FT                   LQPNDRIVSINDVSISNNRDLDDLISKLDVNVVDIKYERDGEILTSKLVFQDINKNLGI
FT                   YLLPGLKRLVRADNLVIAFTNSFNKVLDILGRILYSIIELFTNFRSNSKNITGPVGMIN
FT                   IFAGSFAFGVLYWLDTLAIFNLLIAGMNLFFVVIPMLDGGQILISFIELVRGKRFKAKI
FT                   IYYFYLFGILMMLILFILGLLNDLSNF"
FT   gene            complement(129341..130306)
FT                   /gene="cdsA"
FT                   /locus_tag="BRE_121"
FT   CDS_pept        complement(129341..130306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="BRE_121"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_121"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94378"
FT                   /db_xref="GOA:B5RQU4"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQU4"
FT                   /protein_id="ACH94378.1"
FT                   /translation="MLIVNLFFQMFYGQIILFFIMREIWNVLRIGRETLGDKGLFSIRS
FT                   KKLTFVARLGTFLFFVPLVLLLIFLEFKSYLFINILIFMFSGIAAKEVNDLLKFKSASV
FT                   SSTLSFFLGIFPPILTYVHFNILDLGINIVFYLVITLVFSNWIVNLVFIKENEIVNFLS
FT                   QATSIIFILIYPGILMSFVVAITTLPKAPILLLILFSMVSGNDTFAYLFGYFFGKNSYK
FT                   PTIISPNKTIMGFFGGILFSIIVVLIVVSLGLINLTYGEAMVFGVLIGFFTIIGDLFES
FT                   GLKRSAGVKDSGKIIPGRGGALDSIDSYLLTGPIFYLYLS"
FT   gene            complement(130194..130886)
FT                   /gene="uppS"
FT                   /locus_tag="BRE_122"
FT   CDS_pept        complement(130194..130886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="BRE_122"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_122"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94379"
FT                   /db_xref="GOA:B5RQU5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQU5"
FT                   /protein_id="ACH94379.1"
FT                   /translation="MSSNSLPSHVGIIMDGNRRWALKKGLSFFEGHKEGLKRAKEIVKH
FT                   SCELGIKCLSLYVFSTENWNRTNSEIEHLMFLIADYLSSEFKFYAENNIKVVVSGDIKT
FT                   LSQKVKKSIKDATNYTKNFDGLILNLAINYGGRNEIVRAIKKVLAKGLSVETLNEVEFA
FT                   KFLDNQELGDLDLLIRTGGDMRVSNFLLWRLAYCEFIFSNVLWPDYFVFHYERDLECFK
FT                   NRKRNFGR"
FT   gene            complement(130891..131445)
FT                   /gene="frr"
FT                   /locus_tag="BRE_123"
FT   CDS_pept        complement(130891..131445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="BRE_123"
FT                   /product="ribosome releasing factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_123"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94380"
FT                   /db_xref="GOA:B5RQU6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQU6"
FT                   /protein_id="ACH94380.1"
FT                   /translation="MEEYKALLDEKMGRVVLSLESEYKSLRTGRVNSALFDKVFVDYYG
FT                   EKTPLTRVANISVPEARLIVIQPWDRSLLSKIEQAILNSDLSMNPSSDGSVLRIKVPVL
FT                   TIERRKEIVKQAKKIAEDHKIATRNIRHELNNKAKKQEKDSQITEDDLRRILDDIQRDT
FT                   NFYIKKIDGIFDLKAKEIMEV"
FT   gene            complement(131483..132319)
FT                   /gene="tsf"
FT                   /locus_tag="BRE_124"
FT   CDS_pept        complement(131483..132319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BRE_124"
FT                   /product="translation elongation factor EF-TS"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_124"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94381"
FT                   /db_xref="GOA:B5RQU7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQU7"
FT                   /protein_id="ACH94381.1"
FT                   /translation="MSISPQEVKKLRDATGAGFGDCKKALSVAGGDFELAKKKLKEMGI
FT                   VSADKRSGRDAKEGRVFSYVNTERVGLLLIACETDFVAMNSDFVAFGNSLIKQLVESGR
FT                   DILDEHQELEIKNLAATIKENIYVSKVYISNIASNELVKNYLHGDHSKIGVFVKFKIDD
FT                   ALKMQDEKLNNFAMDLALHVAAFSPLYLSVNDICLNYIKEQEEIFMRQMESSGKPENVV
FT                   KGIISGKLKKHLGEIALLEQGFVKDDKLTVKEKIEEVSKLILSKIEVVEFKYLSVG"
FT   gene            complement(132341..133105)
FT                   /gene="rpsB"
FT                   /locus_tag="BRE_125"
FT   CDS_pept        complement(132341..133105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BRE_125"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_125"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94382"
FT                   /db_xref="GOA:B5RQU8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQU8"
FT                   /protein_id="ACH94382.1"
FT                   /translation="MAVITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQK
FT                   TLQGIKDSYELVQSVIKNGKKVLFVGTKKQASEIIEQEAKRSEMPYVNNRWLGGMLSNF
FT                   NTIKKSVQKLKKLEKMEVDGTFEMISKKEVSQINREKLKLAKNLTGIKDMEELPGAIFI
FT                   IDPKREQIVINEARKLGITIIAVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIISDAIL
FT                   ESDKEVGIQIVENLNEEDLMSEIEVKNERKES"
FT   gene            complement(133141..133740)
FT                   /gene="maf"
FT                   /locus_tag="BRE_126"
FT   CDS_pept        complement(133141..133740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="BRE_126"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_126"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94383"
FT                   /db_xref="GOA:B5RQU9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQU9"
FT                   /protein_id="ACH94383.1"
FT                   /translation="MIYKENFEIALVSSSLARIEFLNALKLNFVSLSVDIDENLIMRSG
FT                   EMEITKKISLIKLTNAIEKYGKDKCLITVDTLVKNDSIYIGKIQDEKEAFVKIMEYSCK
FT                   LVEVETSLCIFIPVKEKIVKACEVSFIKFRELTPDIVYHYISLGYWKDKSGGISLKNGV
FT                   ADILIEYINGNYSNIVGLPIGLFYDILIKENIISAI"
FT   gene            complement(133730..134008)
FT                   /locus_tag="BRE_127"
FT   CDS_pept        complement(133730..134008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_127"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_127"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94384"
FT                   /db_xref="GOA:B5RQV0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV0"
FT                   /protein_id="ACH94384.1"
FT                   /translation="MLAFFLHLILTNIIISFLVSFFVVFFGILRFKFLLIYFISFLGSV
FT                   LFLFFIPLFYSDYYDRQINILFYLFPIIGSVVLVSLLRFSERSKNDL"
FT   gene            complement(134022..134696)
FT                   /locus_tag="BRE_128"
FT   CDS_pept        complement(134022..134696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_128"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_128"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94385"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV1"
FT                   /protein_id="ACH94385.1"
FT                   /translation="MVDSRASRDILAFKLPYGYFDKSSNAKVRGFDIYYKFYPEGTNHN
FT                   FSGFARSVQRDFDALKSVFNNVSAFNLRGFYKINLDRDHFSGSPTLKLDKSWIQGKFPL
FT                   YIELNFENLRKSIPGSAFITIRKGNNSSSPILKEIKNMYRSYVVDGFYTEFFDVLKKSK
FT                   VSDSKDRPFDLKHISDSFFTRDVSPKYNLVIFVMAAGNAIEGDLYSVIVNLGTLNSFEL
FT                   SN"
FT   gene            complement(134816..135418)
FT                   /locus_tag="BRE_129"
FT   CDS_pept        complement(134816..135418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_129"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_129"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94386"
FT                   /db_xref="GOA:B5RQV2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV2"
FT                   /protein_id="ACH94386.1"
FT                   /translation="MFKNKFFIGILAVIIFVGIIIYFYDFTDINYVKEGGEIVENLEQD
FT                   LNLYLKSKNTEERQNLESKIEKALNSKDDITYEFLPRFYLAKSTYSQSKGLYEEALKDL
FT                   DVVIALKWIERELAYINKAVIYEKIGQVENALLMYDNVINQTKLDFMKIRALLGKAILV
FT                   ELQDKKLAIDIYEKIANFSYEDNLYINIAKNKLFQLK"
FT   gene            complement(135411..137078)
FT                   /gene="rpsA"
FT                   /locus_tag="BRE_130"
FT   CDS_pept        complement(135411..137078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="BRE_130"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_130"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94387"
FT                   /db_xref="GOA:B5RQV3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV3"
FT                   /protein_id="ACH94387.1"
FT                   /translation="MRMENQEDLQENYLKVLEKVELGSSVSGIVINIMKDYVLVDIGYK
FT                   SEGFIKIDEFETIPNVGDKLDAIVTKVGGELGLVLSVSKLDSLNLQDKIDEYIANRKVL
FT                   KGKILVELSSGYKVQINDNVTGFMPFYLSSQLRDEKLKRGSVVEFYVIQADKSDGLRLI
FT                   LDRRTLEREREFLKRKELVSSYSEGDIVDGIVEKITDYGAIIRIKNLVLGVLHKRNIAF
FT                   NRVENVEDFIHVDDKLRLKIIKLSTNTGKMELSLKALKVNPWDSVESKYKVESIVKGKI
FT                   VKILPFGAVVEIDSAISGFLHISNFSWVRSIKSPQELVKVGQIVEVKILEIDKENQKIS
FT                   LGIKQVNENPWNNLADRCGVGKVVQGVVKNITKTGAFVSIEEGIDAYISKFDISWVEEV
FT                   NPEKYFELGSSISGKVIEFDAKRQNIKLGIKQLEENPWDDFSKSYKKGDVLEVEIMEKR
FT                   SKGVQVRVYGKIMGFISKIQLGDTKESSLETFEKLNVGDKIKVIITNIDFKNKLVLLSY
FT                   KAYKEQKSSEEISSYLFKEDDEESYKPFANLLKRDSDV"
FT   gene            complement(137086..137742)
FT                   /gene="cmk"
FT                   /locus_tag="BRE_131"
FT   CDS_pept        complement(137086..137742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="BRE_131"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_131"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94388"
FT                   /db_xref="GOA:B5RQV4"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQV4"
FT                   /protein_id="ACH94388.1"
FT                   /translation="MIIAIDGPSASGKSSVSKALSMKLGFKFISSGYLYRIITLIAQRF
FT                   TLNEYDLLNESKLVDLISQNDIKYNDNSFLLNGVDVISHILTEKIDFQVSLYSSYVNIR
FT                   KIVNKKLREIVKIQDDDYIIEGRDITTVVFPEAKIKIYLDASVEVRTLRRYNQRDDDMA
FT                   LIELEQALEKRDEIDQNKEYGKLKLGKGVFYIDTSYKSLDDVCDIIIKTFNLKKK"
FT   gene            complement(137739..138485)
FT                   /locus_tag="BRE_132"
FT   CDS_pept        complement(137739..138485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_132"
FT                   /product="pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_132"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94389"
FT                   /db_xref="GOA:B5RQV5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV5"
FT                   /protein_id="ACH94389.1"
FT                   /translation="MTNINSKGLRVHVFLAEKGIGSRRFCEELIRKNLIKVNGIFAKLG
FT                   DKVFLGDRVEYGKQVFVFQDSKVVNKIYIALNKPINYLCSNFDPMGRKLAISLVQPLFR
FT                   ERLFSIGRLDFKSSGLLLFTNDGRFANSIVHPKNEIEKEYIIESKRVVSEDLLVNFKNG
FT                   IKVDNELFKLKSYVMLGNNTARLILTEGKNREIRKVFLSRNIFLKKVHRVRIGNITLSN
FT                   LKEGQIKVLSLAKINKLKTQFLGALM"
FT   gene            complement(138457..139230)
FT                   /locus_tag="BRE_133"
FT   CDS_pept        complement(138457..139230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_133"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_133"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV6"
FT                   /protein_id="ACH94390.1"
FT                   /translation="MMNLDNYLIVYNDFKGEIGVFFDYIRNKREILKTFNLNQIIEDFL
FT                   AFSENIEMDVRELIKFYSFTTSLLYLKTQVLYPVKLKDRKFVEKEIVNKLMKFSDKYVV
FT                   SRKVVRKKDEVCLDISKFPFLKENVVFLKNVDDAKNYIANINEVKNKDRTMRVSKERND
FT                   ILSDRFRFNIVLDTYDAKIADKKNKIMSLLAKEDKCRFEFLLRLDDKFYFFERFCYFLI
FT                   VLEYKMSNVIDLVYVNNELIVIKGRGIDEYKQQRA"
FT   gene            complement(139241..140330)
FT                   /pseudo
FT                   /locus_tag="BRE_134"
FT                   /note="recA protein"
FT   gene            complement(140341..143043)
FT                   /gene="greA"
FT                   /locus_tag="BRE_135"
FT   CDS_pept        complement(140341..143043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="BRE_135"
FT                   /product="transcription elongation factor EF"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_135"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94391"
FT                   /db_xref="GOA:B5RQV7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV7"
FT                   /protein_id="ACH94391.1"
FT                   /translation="MSNITIERLDNILQEDKWTRIVVNNYSLAKIKELDELIDNIISEN
FT                   LTEEALDICGKHLKDIKKSIAGLYISGMLIYSRRPLNDMSLLTVVDLFSQNLKWSLVEH
FT                   ICHKMLLTSENKHALYTLAKIYAQNNENDKLPSIWMRIVEADVDNTVFVRQLATHYENV
FT                   DLQKSIYFFRKAIYRFIDKKQMSGIREIWSKLIRYVSDDFDSFLLILQKVEKELGFKKV
FT                   VVLYEDLYEHYAVSGNIDETIEILKGILKLDNKNQKARENLVIFLREKYKDVNNIEEYL
FT                   EKSDIENLDKNFVDVYSDFEKYLFFAKGNFVYHQTWFVGIVKDVNDQGILVDFVSKRGH
FT                   FISFDMAISALSPLEREDIRVLKAIKPKEELVEHLKRDIEWALKVIIKSYKSIDLKGIK
FT                   RELVPSLMTQSAWNLWSVKAKQILKDNPHFVMASGKADCYIYNERASNFNEKIYDKFKV
FT                   EKDFYKRYEIFMHYYTSGGIVKDSHIEEEMLNYFLIYVNNFAKVDHYVISSYVILKSLK
FT                   DFDDKIALKINIERDINLEVLLKEYSKSIVDLFDAILNADIKKELISLIKEELVDWVVY
FT                   YKQLFPCYVNKKLIDSLYKEDIKETEHLFNYVTKNYKMYKDAYIWILKHYTSYSLNLDY
FT                   SDAELLVNLIKILTDSVIKINNKNNSVANKRIYKMVSNLLIKDKYLSIVLSNVMDEELA
FT                   KRIYMTCFYIRDFPPKDLIHIKTAIRTVFGNIEFEDEKMQVSGDKVEIGFLTILSSLSK
FT                   KQKELQYLKDVEIPENSKEIGKARELGDLKENAEYHSAKERQQFLTKRLNTLMSEIDVA
FT                   KVIDIKELQSSVVGFGTKVTMINKDTEREESYLIFGPWESNPDEGIISYKSPFGENLLD
FT                   SREGDSLDFVINNTHFQYYVKKIEPAKIN"
FT   gene            complement(143079..144023)
FT                   /locus_tag="BRE_136"
FT   CDS_pept        complement(143079..144023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_136"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_136"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94392"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV8"
FT                   /protein_id="ACH94392.1"
FT                   /translation="MSSEKIAELIKDIYLSFKKGDFKTALMKSEEAHSLDFDNVEILTA
FT                   LKSSVYWNGQIESLDRIDKDYEKAEFLTREWNNFARRYLKKMNFDFIQGRNSIKYFVFQ
FT                   LCLNIYQNIYRLQPENLDILIKIAKSYKGMGNYERAIAVFLQILGDAKDNADVVAELAD
FT                   SYALIDEIKEAKVLFREAFFINPQKIDIDALESEMILKLVEAIKSDRNISDTLIKEWIP
FT                   VYGALNGVFNIKRELRPIELGHLKQSVYSLRNELKEKSYRSINESILLPRLINKYFWLI
FT                   DHYVRIKEDRVRIDEILSYIKEIDIGIYQQYVN"
FT   gene            144210..145355
FT                   /locus_tag="BRE_137"
FT   CDS_pept        144210..145355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_137"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_137"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94393"
FT                   /db_xref="GOA:B5RQV9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQV9"
FT                   /protein_id="ACH94393.1"
FT                   /translation="METAPKKLINKSINYYNSHKYADVIKLIEKEIFFYKDYYIYHYIL
FT                   GMSYLRMGNLGNAQIYLKKAYTLNPTEPDVKQSIAILLAAQGKEDKAIQIWLKMIEDNQ
FT                   DIKRSELSLEIIRKHPIQGTLFLTKNKIYDKLFPKIKIEKGENFYKLTKIILSIVSISF
FT                   LLIAIFSFTNFKENIKLIINNSQTNIKKTINNVATYIDDIKINDKEKIKNYEGQFVFIL
FT                   TETEIKNSFQKIKSHLKNGKDNFARIEINKILNSNASESIKLKAKNLASFISNPDFITF
FT                   DDFLILKEIKKNPLIYSDVYVKWEGIINNIEKKNNITYFDFYVGYNKDILEGIITTKIN
FT                   FDIEINFKDCVEILGQIKYEYNTNTLLLNAITIRKIKKEKE"
FT   gene            complement(145395..146765)
FT                   /gene="hisS"
FT                   /locus_tag="BRE_138"
FT   CDS_pept        complement(145395..146765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BRE_138"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_138"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94394"
FT                   /db_xref="GOA:B5RQW0"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW0"
FT                   /protein_id="ACH94394.1"
FT                   /translation="MDVRTLKGFRDYLPKEALIRTHIIKQIYSVLVSYNFDLIDTPILE
FT                   YSEFLLKKGGDEVEKQIYRFKDNGDRDVSMRFDLTVPFARFMATNKSKIKFPFRRSQIG
FT                   KVFRGENTQKGRYREFMQFDFDILGEDTFRSDAEILSIVYCGLEEVFLNFIEGINIKFV
FT                   IHFSHIGILNTYIEKLGLKDKSIFILRNIDKLDKIGIEAVRENLLLELSEEHVDLVLEF
FT                   VNLDGTFSNKVKALRSILGDNNAVKRIEDIFVHLNALGIQDAFNFNLKIVRGLDYYTGL
FT                   VFEAEMLGVNMGSICSGGRYDNLLSLFSGSLQKVSGVGGSFGIDRIQDIIEIDKFNYIK
FT                   LFVVKASSRVLIVNIDDTLQDYYYKLADKFRRHDYSKINNIACEVYPKSKDGKNIKIQI
FT                   EYALAKAIRFLIFVGQEEYQEGKLKVRDLTKKEELLLSFDEAIKFIKGNDKFLCTPF"
FT   gene            146905..148785
FT                   /gene="pbp-1"
FT                   /locus_tag="BRE_139"
FT   CDS_pept        146905..148785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp-1"
FT                   /locus_tag="BRE_139"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_139"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94395"
FT                   /db_xref="GOA:B5RQW1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW1"
FT                   /protein_id="ACH94395.1"
FT                   /translation="MMNKNFASSLRLNIILIIFLIITLLTIYQYFILMFSKNMQHFPQK
FT                   INHISRRGNIYDRNGKIIAFSSKSYSVGTDPRKIKNIVNTSETLGAILKIDPQTIKQKL
FT                   LSKKGFQYIKRQITKEESELIKRIQSEGRLKDIILYPDYKRIYPFKELTSNITGFVGID
FT                   NIGLTGIEFSLNSILNEDFTKQQYINDKLSTNNIYLTIDIDLQNNINQIAKKYFQENKP
FT                   ENMITIVMDAKNGEILSMLQFPQYDANYYSQYSKEIWNNFSTSLTYEPGSINKIFTVAI
FT                   LLDSGLLKPNEKFLDNGIYQKKFKSGETIIIKTLNPPYDYIDLSGILLYSSNVGIAHLT
FT                   DKINNEYFYNKLIDFGFGERVGFPFPGETKGILNHHSKWSGRSKATIGFGQEIGVSAIQ
FT                   ILQAASVLSNKGIMLKPKIIKKIINEMQDTIQEFPKEEIKKVISEHTAQKVLKLMREVV
FT                   NKGGIPKLKTKNLSISAKSGTSQVIDQNTGKYSNEDYTSSILVIYPTEDPKYIIYVVYR
FT                   YPKKIIYGTRIAAPMAKEIINLIEQKNNKEEYNKIKISSKISIPKPIIKHNIKETLPNL
FT                   KGLSKRDLMKILKDYINIKINIKGNGFVYKQSHSPNTKLKDIKELEIILQ"
FT   gene            complement(148787..150676)
FT                   /locus_tag="BRE_140"
FT   CDS_pept        complement(148787..150676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_140"
FT                   /product="long-chain-fatty-acid CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_140"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94396"
FT                   /db_xref="GOA:B5RQW2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW2"
FT                   /protein_id="ACH94396.1"
FT                   /translation="MSIVKTFFEIASKHGCGIAQIYKNNKDYFKVTYADLKENVLKFAS
FT                   FLRKINLRYQDKVFICSENRIEWSVIDFAILSLGAVDVPKGIDITLFEAEIIINNIVPN
FT                   VIIVENVDLLDLIIKLKFQIKPTVIVIDDLYEKDKLRFSEFEVYTYKECILIGENARQD
FT                   EEIIETVNNISLNDMATIIYTSGTTGNPKGVMLSHANFLYQVSSFSRMISVTEGQIFMC
FT                   ILPIWHSFQRSFSYNIFLKGMTCLFSNIVPRNMLDDIRNINPHYIAAVPRLWIAIKQNI
FT                   VKEISKKNFFVRLLFRIFVKFACISDICRRIILGLYPDNGLDLLIPFKKILSILGVIVL
FT                   FPLNVLGNLIVFKKIKKVLGNNFVVGISGGGSIPLYVVRFFNAIGINLANAYGLTEASP
FT                   GVASNEYGKIIVGTSGKILPGTIAEIRDENGVKLKKPGKGVLFIKGPQVMIGYYQDIEA
FT                   TRQVIGDDGFLDTGDIVKLSKDNVVQIIGREKDTIVLNNGENIEPAPIEIKLEESLLIE
FT                   KAVVVGQDQKFLGALILPNFEEINKYLESIGHKIRDTNKQQIIANNIVLKAIGDEIKKL
FT                   INRANGFKPFEQILKFVLLEKPFEVGKEMSIKMDIKRNYISNFYRNEIKNLFS"
FT   gene            complement(150892..151185)
FT                   /locus_tag="BRE_141"
FT   CDS_pept        complement(150892..151185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_141"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_141"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94397"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW3"
FT                   /protein_id="ACH94397.1"
FT                   /translation="MYRVEIISNFSLEFDFHECITSIEEELGEVIYYSKVYNVKGKGTK
FT                   GERQGNEVWPEENFIFIVYTDKLIIVEKLKNITEILDKKYPTEGIKFFVIGN"
FT   gene            complement(151198..154437)
FT                   /gene="acrB"
FT                   /locus_tag="BRE_142"
FT   CDS_pept        complement(151198..154437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="BRE_142"
FT                   /product="acriflavine resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_142"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94398"
FT                   /db_xref="GOA:B5RQW4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW4"
FT                   /protein_id="ACH94398.1"
FT                   /translation="MRLIMLVKKVVNKPITMLILFSLLIILSIYTFSRLNINLLPNVED
FT                   ANLYVSTLYAGSSAKEVEEKVARILESNLSLVKNIKTISSISSKGHSEITLNFYHGTNL
FT                   DLALNEVKDTLEFSKGLLPKEAGLPRISRDRLDGIPVISFFMYSDRSVVELKRYAKELL
FT                   KPRLERLAGVGLVNIAGGGDKHIVVEVSQNRLEAYGLTLSDIVPFISSQNVEFSVGEIL
FT                   DNDLQYQVQISGNFNSIKDLEDVVIAYKSYSLQDDSLVQIKLRDVASIKTIFKEEKYVY
FT                   YSDKPSVSISIQKQNDANFVNVSNAVNAEFEKIKLILPKDISLDVFKDNAEHIKNALSS
FT                   VSHSAYSGAVLALCIIFFFLRSFRATIIIGITIPLAIIITFCLMYFANISLNIMSLSGL
FT                   ALSVGMVVDCSIVVIENIYRYRQKGAKLISAAILGTQEMMIPIMAATLTSICVFAPMLI
FT                   FKAELGMIGDFLRDFAFTIVISLTVSLFVAVFLVPVLSSYYIKLYTSFQKPIRNTLVKK
FT                   VDGFLHNVYAFGERFYVVLLNYVLNHKLIFLFIVICSFIVSLVLFPFLNVSFMPNERPS
FT                   VITFSFSFPNRTSLDISKSYSDKVLEILKSEIRAYKSIVSDIDSGGFYFRVLLSSTEEI
FT                   DDWREIQYRVDNRVKSLYPILNSYALSDRNSLGGSPIAIKIRSLNFEYAKEYGELLINL
FT                   LKKRFPSLINPRLNIQEEPQIDIDIDREKAYSYGINIETISREVGANIDGISAGKYVEN
FT                   GVSYDILLKLDRNNIVGLKDLNNIFVINKFGVKIPLSLIANLRKTKGVSSLLREDQSLV
FT                   ITLTAGIAPNESLASVTEDVVDFVTNKVPQRDGILVKFEGEYDSFINSMQQFKVIILMA
FT                   VLLVFGVMAAQFESLLKPFIILFTIPLTLIGVILIYFISGEKISVLSAIGMLMLVGVVV
FT                   NTGIVLVDYINLLIKRGFKLREAIVEAGRSRFRPILMSSLTSIIGLFPMAFSNSNNSEL
FT                   IKPIAFTFIGGMIASTFLALLFIPMLFEAFSKFSIKNFILIKFFFFVFKRDRKKKQDGL
FT                   LNKKENKDVISKIGTDRNVKFNDFFINEDEN"
FT   gene            complement(154441..155247)
FT                   /gene="mtrC"
FT                   /locus_tag="BRE_143"
FT   CDS_pept        complement(154441..155247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrC"
FT                   /locus_tag="BRE_143"
FT                   /product="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_143"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94399"
FT                   /db_xref="GOA:B5RQW5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW5"
FT                   /protein_id="ACH94399.1"
FT                   /translation="MMKARRGAISDYISLNGDVDTKVKVKVFPDVAGKIKSFNIKLGSY
FT                   VEKGQVIAILDPSKPGSFYLQSPVRSPISGYVLFVNCKIGETVTPQTSVALIGKMDVMK
FT                   IKTYVSEKYILDIKVGNNALIEFGSYSDKKFWAKISEISPILDFKSRSAEVYLEPLGSA
FT                   TNKMVVGMFVKLKIVTKNSKNVIKIPKHAFLEREGKLCVFRVNTDSTTVERVFPLVDFE
FT                   VDNIVSIKDGINEDDLIVTEGVSWLSDGAFVNIVDTQNGLDVEDNI"
FT   gene            complement(155427..156794)
FT                   /locus_tag="BRE_144"
FT   CDS_pept        complement(155427..156794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_144"
FT                   /product="uncharacterized conserved protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_144"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94400"
FT                   /db_xref="GOA:B5RQW6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW6"
FT                   /protein_id="ACH94400.1"
FT                   /translation="MYIIILCYYIGIIMNILIINKNILFYFIKTSYNINHLILIFLLSV
FT                   PSYAEEVIKISSMDAVNMALKYSLESKNAKYQEEIKKLYKDRSWNIFVPNVGFSSNISR
FT                   QNPFMSNVRGEHWHLGLGVSAELSISPSVVNKMRLASFNYDEVVIDRERVNRDIKLNVL
FT                   KIYNELLAFKSIVDVLKEQLDKGKLKFEQVSIAYDNGLISEIDYLDSKLKYNKLQPNLD
FT                   EQIIKFEEIKSKFRLLIGLNVLQDFEVVGELSDDILDFSFFNEIVDVYEDLEIRKLNNF
FT                   VKIMQTTLDSLWLDAFLPSLSLSMSYNPGNISFGSGFSGLGQQGFHFVFGLTYSLSEIL
FT                   PFSKSFTEIWKQDYQLKMLRDQIDNKMREFKSKVVQKRKNMRLYKSILDNSKMTLEISK
FT                   KNYQIAFDAFNAGTIDLIKLNDIELSYKQSDLQLIKDKLNYANLVLEYKDLINKLD"
FT   gene            156784..157086
FT                   /gene="hlyA"
FT                   /locus_tag="BRE_145"
FT   CDS_pept        156784..157086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyA"
FT                   /locus_tag="BRE_145"
FT                   /product="alpha-hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_145"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94401"
FT                   /db_xref="GOA:B5RQW7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW7"
FT                   /protein_id="ACH94401.1"
FT                   /translation="MIYIRILKKIFIMINLILILLIKIYQKTLSKIVGFYCIYQPSCSN
FT                   YALNCLKKYNILTAFILITLRIIRCNTLFKGGCESLPTKNPILNSLKEFKTRLIK"
FT   gene            complement(157075..157971)
FT                   /gene="proX"
FT                   /locus_tag="BRE_146"
FT   CDS_pept        complement(157075..157971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proX"
FT                   /locus_tag="BRE_146"
FT                   /product="glycine betaine/L-proline transport system
FT                   substrate-binding protein; lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_146"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94402"
FT                   /db_xref="GOA:B5RQW8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW8"
FT                   /protein_id="ACH94402.1"
FT                   /translation="MKGIFIPVFVSFVLIFVACSKDDSSDNGNPKSLKSVKIAYVNWIG
FT                   ETIATNIVRVVFERIGYNVEILPVTTSIMYQYLASGRVDGMVSSWVPTADKFYYEKFKD
FT                   KFVDLGANYEGTLQGFVVPSYVTISSISELKGRGSEFKNKVIGIDAGAGTQLSVEETLN
FT                   RYGLSKEYELISSSESVMLASLESAINKQEWILVPLWQPHWAFVKYDIKFLDDPLLSMG
FT                   GPESIHSLVKLGLQESDPDAYYLFDNFYWGDDLLLPLIEKNYKEPGQEYKNAVEFVDSH
FT                   KDYIKNWVPDKYKNLFD"
FT   gene            complement(158008..158907)
FT                   /gene="proW"
FT                   /locus_tag="BRE_147"
FT   CDS_pept        complement(158008..158907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proW"
FT                   /locus_tag="BRE_147"
FT                   /product="glycine betaine/L-proline transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_147"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94403"
FT                   /db_xref="GOA:B5RQW9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQW9"
FT                   /protein_id="ACH94403.1"
FT                   /translation="MNRDFIVSSIDKAFDFLVDNFANSSGIGFAKIIDSFYENLKRLFT
FT                   VINPVLFIVMICVFSFLFLKKRLALLIMLGFCFILYFDLWEVSMDTISLIFVSVFFSVL
FT                   WGILIGILGGYCTKFYVFLKPLLDLMQAMPPFVYLIPAISFFDTGTSSAIFATIIFAMP
FT                   PVIRYTRLGIIQVPSEVIEAAKSFGSSSARILFQIQLPLALQSIIEGINQSIMMAISMI
FT                   VIAAMVGSSGLGRTVIYSVERLHFAEGLISGLAVVIIAIILDRIMQAIFIKFSYLNTDN
FT                   YGGKKENKFKRFLEMYNK"
FT   gene            complement(158914..160032)
FT                   /gene="proV"
FT                   /locus_tag="BRE_148"
FT   CDS_pept        complement(158914..160032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proV"
FT                   /locus_tag="BRE_148"
FT                   /product="glycine betaine/L-proline transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_148"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94404"
FT                   /db_xref="GOA:B5RQX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX0"
FT                   /protein_id="ACH94404.1"
FT                   /translation="MYKASVTVRNLYKTFSYNRNKKQIFKAINNYKNGKDRSDIYKEFS
FT                   VFIANANINLDIYENEILVIMGMSGCGKSTFVRCLNGIHKIDSGSILVDNIEMNDINQK
FT                   DLSALRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKSVPKKVRIQRALDILRLVGLEDS
FT                   KYKYISELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIRGEMQCELLRLVDKLKK
FT                   TVVFITHDLIEAFKLGNRIAFMRDGEIIQVGRPLEILREPKTEFITNFIKNLPVLNILK
FT                   IKDIIKVDFDHYGYNDQFNVIIKKENDSFILHDISIGKKYSNVVSLNLDLGDEIKSVVK
FT                   YLNKLDYLIVTKEQGDIIGYIDLGEIAALLAR"
FT   gene            complement(160157..161164)
FT                   /gene="flaB"
FT                   /locus_tag="BRE_149"
FT   CDS_pept        complement(160157..161164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaB"
FT                   /locus_tag="BRE_149"
FT                   /product="flagellar filament 41 kDa core protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_149"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94405"
FT                   /db_xref="GOA:B5RQX1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX1"
FT                   /protein_id="ACH94405.1"
FT                   /translation="MIINHNTSAINASRNNAINVANLSKTQEKLSSGHRINRASDDAAG
FT                   MGVAGKINAQIRGLSQASRNTSKAINFIQTTEGNLDEVEKVLVRMKELAVQSGNGTYSD
FT                   ADRGSIQIEVEQLTDEINRIADQAQYNHMHMLSNRSSAEHVRTAEELGMQPVKINTPAS
FT                   LSESQASWTLRVHVGANQDEAIAVNIYAANVANLFSGEGAQQVAPAQEGAQQEGAQAAP
FT                   APAAAPAQGGVNSPVNVTTAVDANMSLTKIEDAIRMITDQRANLGAFQNRLESVKASTE
FT                   YAIENLKASYAQIKDATMTDEIVASTTNSILTQSAMAMIAQANQVPQYVLSLLR"
FT   gene            complement(161292..163292)
FT                   /gene="fliD"
FT                   /locus_tag="BRE_150"
FT   CDS_pept        complement(161292..163292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="BRE_150"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_150"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94406"
FT                   /db_xref="GOA:B5RQX2"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX2"
FT                   /protein_id="ACH94406.1"
FT                   /translation="MSSGFFVPGVDNKYNTKEIRESMLKPDKSKIDSSVQKLESLQQEK
FT                   RAWQTINKKVSVLNSLAKQITSLDGPFNYMSGNSSNNDVLSVSARYGAKNENYKIGVNQ
FT                   IASSDVFLSANFKQKEINIPVGEYTFLVGKKEIKIRNNGDLESLVRDVNNRGKGFLSAK
FT                   IVKSDSSGNSRLILQSLKEGENNRLIMKDEALNLAKKIGILSERTTNFSPNIREIVNSQ
FT                   QNSSNKIFLDKDDIVLEPLSEIAISIPDNIEIGKGSKIKFEIKYYDMDDKSILNEIVFN
FT                   PGEATFEGAKVEGEDSIINLESDYKPFLKEKKYIQMNMIKIHSGTGSLELPPINVASDF
FT                   EKVEVEVGSLLGLKEINIENKLNNKAFVIRNIEIFDPKNRDGHLPINAKSFAENAKMKF
FT                   DGVDVERDSNTINDLIPNVTLNLKQSSDDTVDVRVEPDYEGIRKLLLDFLIAYNEVLAG
FT                   INIVSLNEDNVDTQKSDLLEEWSYLNEEEKEEAYKNLGILRSEFTLKNLKSRLESIMFN
FT                   VYRTNDPNFSLINQMGVFTSSMSSSGGFSRYLKLDEKKFNEVLQSNISSVKEFFAFDFN
FT                   DDRIYDDGLAKVLGDYLSLLIGAGGFIYNKIKSYDFRIPNQKNMVEDYKRKYEERERKV
FT                   EGELNTLDFTVKRMKEQEEILKSLNLYRQNK"
FT   gene            163467..164672
FT                   /gene="nagA"
FT                   /locus_tag="BRE_151"
FT   CDS_pept        163467..164672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="BRE_151"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_151"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94407"
FT                   /db_xref="GOA:B5RQX3"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX3"
FT                   /protein_id="ACH94407.1"
FT                   /translation="MSNFCLFNAKSVLTGNDKIDNSAVLIRENKIFDIVTSDRLEKLEL
FT                   QDYEMIDIKGNYITPGLYDNHIHGFYGYGTDQCSTNSIIKMSEHLAEYGVVGFLPTLYP
FT                   RPTEEMIETIKACTQAIGKEKGAKILGLHLEGPFFSPEKKGAHPTSYLQKPSIEIMKKF
FT                   IEAAGGTFTDSFGRKRTNIATMTVAPELKGMRELAIFCMENNITLQAGHTNAKYENMIE
FT                   GFQVGILHTTHFFNAMSKLDHRNPNAIGAALIHGDVSCEIIADGHHIHPKLVLMLRKLK
FT                   DISKLVLVTDGLTPTLQPSGELIANGEKVYLKNNDLFYIIESDTIAGSALTMIQGIKNL
FT                   VEFGYSLSDAIQASSYNPIRIINLEKKGLICHGYDANINVLDKDLNLKLTMIESKIIFN
FT                   KL"
FT   gene            164672..165508
FT                   /gene="nagB"
FT                   /locus_tag="BRE_152"
FT   CDS_pept        164672..165508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="BRE_152"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_152"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94408"
FT                   /db_xref="GOA:B5RQX4"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX4"
FT                   /protein_id="ACH94408.1"
FT                   /translation="MLLIQKYKEQQMRLIIRATYNEISRWAANHVARKIKEWEPTKEKP
FT                   FILGLPTGSSPIGMYQNLIELNKLNKISFENVITFNMDEYIGLDKNHPESYYSFMWNNF
FT                   FSHINIQKENINILNGNAINLINECKKYEKKIKSYGGITLFVGGIGPDGHIAFNEPGSS
FT                   LKSRTRIKTLTQDTIIANSRFFENDINKVPKSSLTVGVGTIMDSKEVMIIVNGHNKSRA
FT                   LKHAIEKGVNHMWPISILQLHKNAIIVSDEAATYELKVGTVKYFNDIEKHNYNNEL"
FT   gene            complement(165664..166275)
FT                   /gene="sodA"
FT                   /locus_tag="BRE_153"
FT   CDS_pept        complement(165664..166275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="BRE_153"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_153"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94409"
FT                   /db_xref="GOA:B5RQX5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX5"
FT                   /protein_id="ACH94409.1"
FT                   /translation="MFKLPELGYSYDALEPYIDAKTMEIHHSKHHNAYTVNLNSVLEKT
FT                   KVNCSYDIESILKNIQRFPIEFQKVVKNNAGGYANHNLYFRTLKPGNKDNILKNFEEHV
FT                   NATFGSLDNLKVALKDLAVSIFGSGWAWLVLYANRELQVISRPNQDSPLIEDYKPILGI
FT                   DVWEHAYYLKYQNRRAEYIDAFFKTLNWEEISRIYNEIIE"
FT   gene            complement(166291..168999)
FT                   /gene="secA"
FT                   /locus_tag="BRE_154"
FT   CDS_pept        complement(166291..168999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BRE_154"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_154"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94410"
FT                   /db_xref="GOA:B5RQX6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX6"
FT                   /protein_id="ACH94410.1"
FT                   /translation="MIPNMLRAIFEATVGSKSKRDLKSYLPVLRNINKLESWALSLLDE
FT                   DFSRETEKFKNELQSGKTLEDILERAFALSREAARRRLKERPYDVQLIAGLALHQGKII
FT                   EMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFDLLGVSVGVVLS
FT                   NMDSSRRKIEYGKDITYVTNNELGFDYLRDNMCFDLSQKSLRNFNYCIIDEIDSILIDE
FT                   ARTPLIISGSTEGDTSAYLTVNSLVPFLKECSKDLKTGDYPLEIDDLDGDYTIDEKAKR
FT                   ISFTVNGLNNLERILVSKGIIQGSMYVDSNFNYVHYMTQALKAHLLFLKDREYIVGDFG
FT                   VEIVDEFTGRVLKGRRYSDGLHQAIEAKEGVRVASENKTMATITFQNLFRMFNKISGMT
FT                   GTADTEAKEFHKIYDLDVVVVPTNKLVARIDEDDIIYYTEDFKFRAITDEVFEAYKRGQ
FT                   PVLVGTVSIEKSEILSNMFKNRGIKHEVLNAKNHFREALIIAEAGAKYSVTIATNMAGR
FT                   GTDIKLGGNLEHRVRKKFGTEISFDDLQKAMQSEREQYLKDYEEVKSLGGLYVIGSERH
FT                   ESRRIDNQLRGRGGRQGDPGRSRFYVSLEDDLMRLFAGDNLRALMGKLGMATGEPIAHS
FT                   LLTKSLVNTQRRVEDRNFEIRKHLLEYDDVITKHREFIYSQRNLILADNNIKERILLSL
FT                   REYLDFLFDQVKGDVVTSSVLNEINSVFAYMMESVGSVEKMSIADLKDKLMEVARSNLD
FT                   IKEELIGSELLNEFLKYEYLRNIDSKFQEHLANLDSLRESVYLRSYANKNPITEYKEEG
FT                   FAIFSELIKDIKIETLRRTLQVKIDVDSSNYKNKKPKDVHATHKEFSGIVSRERDDSVG
FT                   VQIVRNTPKIGRNEPCYCGSKKKYKNCHGKN"
FT   gene            169051..170184
FT                   /locus_tag="BRE_155"
FT   CDS_pept        169051..170184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_155"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_155"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94411"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX7"
FT                   /protein_id="ACH94411.1"
FT                   /translation="MKKFYKIHLNIFFIIISCNTKTLNELGEQQFKIPFGTLPGEITPL
FT                   TNKFTNSGFDIKTYNGLVYIVETKANKLMIFTSYGKLIQTYQNGIFKTNDNLKIKKVNF
FT                   ENIQAIYPSKDFIIVSDKINNTKSKFDEKENIAYSTQIFILNKDSSVAILGQEGHNGTP
FT                   FPEVCDINIDDGNNIAIITIYHEGYIIYSYDQDLSPLYKIYINTNILQIPEEEKKKYNI
FT                   SIDKIFFEVNKKIIYVKTTYYENIRTNENINDLGVKIKNQHFYTMSLNKNKEFEIKNKI
FT                   TLPQNLLDDQQESFINIIGIQKNKIIASTNMKNLSNILIWKLDNRGKIKEQMILIEPPN
FT                   LKFLAESLSKDGILSILYAEKSGVSVYWWNLNTLLKL"
FT   gene            170206..170631
FT                   /locus_tag="BRE_156"
FT   CDS_pept        170206..170631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_156"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_156"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94412"
FT                   /db_xref="GOA:B5RQX8"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX8"
FT                   /protein_id="ACH94412.1"
FT                   /translation="MKNNNCKYKVEETNKKLLKKKLMLGIIFVIILITNKVIIIPKLQK
FT                   IENKHNPTITIEHKIKNKNLYLKINIQNNDIKYFGKANIELYLDSKLVENNMIYIDKIN
FT                   YTLYTNVAYKNESLLNIMLITQKGYKAYFNKRLDLGG"
FT   gene            170635..171051
FT                   /locus_tag="BRE_157"
FT   CDS_pept        170635..171051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_157"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_157"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94413"
FT                   /db_xref="GOA:B5RQX9"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQX9"
FT                   /protein_id="ACH94413.1"
FT                   /translation="MLQIYFISVLLNILGGIILAFPTLRDKLKCLIIFDEFVNAINNNK
FT                   AARSIFGTIFITVSILEIIIPYDLPIIGNLFPAISLFLIGFILFLNQKMPITLQNNKEY
FT                   GKFQSLVENNKKLIGILALIIGIIHFFAPRIPFL"
FT   gene            171145..172257
FT                   /gene="alr"
FT                   /locus_tag="BRE_158"
FT   CDS_pept        171145..172257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BRE_158"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_158"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94414"
FT                   /db_xref="GOA:B5RQY0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY0"
FT                   /protein_id="ACH94414.1"
FT                   /translation="MYKMTKHKEIIINFKNLEHNLITIKSHVHKKELVATLKADAYGHG
FT                   LIQTFKFFKEKNINYFGLFSIYDALKLRKIDKKSNILLYINNINKNAIKNLVNFEITPF
FT                   VADSQYLSLIEEECKRQNKKIKVHLKVDVGMNRYGIKTENALNLATKIQDSKLVEFEGI
FT                   CTHLPTTENTKITQTQSKKFDYLINELKNKNINPKFIHISNSGHITNYKISENFNMIRP
FT                   GLILYGYHPNPNNQNNNLKLKPVLNLYSKVIFVKNIKKGDQISYSGLFKAKEDMQIGLI
FT                   PVGYFDGIPQNTSKNFYCIIKDKKCFIRGKICMNISIIEIPQDLKINIGDKVEIVSERL
FT                   SLDILSKESGRSTYELLCSIGKNEKKKYLY"
FT   gene            complement(172249..173934)
FT                   /locus_tag="BRE_159"
FT   CDS_pept        complement(172249..173934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_159"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_159"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94415"
FT                   /db_xref="GOA:B5RQY1"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY1"
FT                   /protein_id="ACH94415.1"
FT                   /translation="MEIFAILTPHCIRLLYNKSIKIRLIYQGMVMFLIMFFLAYTLFSE
FT                   EIYYKFVDYDIDYKIIGKYEINKEDAEEEYGYRFTYNDGKLIVVDYIGKLSILMPSFFG
FT                   TNQIKIEHFKDIERRLFLNRGFAAKNLKDVYVEQIEYLSNGKPKSIFNYNKSNEIIRDK
FT                   YGVAYYHFVYNDDGSFYVYRFSEVGFQIKDLNDVYYTKIIYENSNRTKTVLYYDGNNYN
FT                   IKAKNGIYGFKLTYDSAHNIVKEEYIDEDFSLSSNPFSVAVKTYRYDSSGNLIEVVNYD
FT                   VKNNLTPDENNVAIYRYDYNLKEKDYCCREYNYDANNNLTVSQNGYAMRKTIFYIQNNE
FT                   KRIINYSNKINKNYDSAVPVSYEEKYEIMDNFKGIAVYSYKYDNKFYLIERLFFDKNFN
FT                   LVSDSNGVMIYKYAYNEDGLLESQEHYGDFDNPISDIVGVFRYKFLYDINGNVILKSNY
FT                   SKNGALVADENAVFEYTYEYDKQNRLISQKNFGNLGQLQDDIYGVSMYKYEYNKFGKIS
FT                   KKTNHGPDLRLRDNIGGISIYKWIYDSKGDLIDFQKFDSLGNLI"
FT   gene            173918..174085
FT                   /locus_tag="BRE_160"
FT   CDS_pept        173918..174085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_160"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_160"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94416"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY2"
FT                   /protein_id="ACH94416.1"
FT                   /translation="MAKISKNAQRSGSKELLSRWGGKIIMKSKFENGKIKHYAECQNSK
FT                   NTARRPKDLF"
FT   gene            complement(174090..175847)
FT                   /locus_tag="BRE_161"
FT   CDS_pept        complement(174090..175847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_161"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_161"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY3"
FT                   /protein_id="ACH94417.1"
FT                   /translation="MKKFPEIFYLNDKEVDILISQIGISSDTQKMILRVILECKNNVIG
FT                   YSKFVEDYSVKIRSLKGELDFLFRKLYEVKRGIIVNQITSNGELLPDKIIITDENSSDF
FT                   YYYAIEDLFLKHYVGIEFFSTLLTIKNIDRNLLAFEREFVVLKNEDINFKYFQESASLK
FT                   KILILDSLIIPSRQTLYFVEFMKRILFRTASNRVVKDVFIRARNLKISEYDRILYEGVN
FT                   GVGVAYNLLLGILENKEEILNKKGVNISKHYFTFLEVLNIYITNEKKLEEIKNLENIKI
FT                   DETLKSIEKAIEFKPGFINIEEFKSILQEHADELSDAEHFFNIANGYFFESNIKGSLPR
FT                   IFSIRSDIYLYKPCAYSIFLKEFDQIVIDVKDKLRNEFTKMLNNGKNSSVIFTEEGLEK
FT                   MLSEFVANYDLNDYCLKNKVAFLDFIVSHYRRVSKIQNIQTQIKDIIKNEAAKYFKNSN
FT                   TFLPLYKIYKIDLSSILDFAYKDLSLLRKIVLFLTGKYQSYKESLSRLNSKVIVNNHVG
FT                   GLFDPNERVKRQLDKRRKQREEIKEQIRNSYSKKGKGTSNKGQTAGRVYSKSEQDEAWL
FT                   KFEDKLNKK"
FT   gene            complement(175923..176900)
FT                   /locus_tag="BRE_162"
FT   CDS_pept        complement(175923..176900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_162"
FT                   /product="Na+/Ca+ exchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_162"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94418"
FT                   /db_xref="GOA:B5RQY4"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY4"
FT                   /protein_id="ACH94418.1"
FT                   /translation="MVYIYFFCLMLGIFLLYLGGNYLLKSSVNIATYFKVPNLLIGVII
FT                   VSLSTSAPELFTSLIASFKQKNEIIVSNIIGSNIINILLALSLTGCFLKIKTDFKRLKF
FT                   SFMMLFLLMFLLLLLSFDFSSLSFFKVPYHKTSSLIILFVFVSYLFLFYREEKKYNVVE
FT                   RDLDNLNCDYGFKFLFLNIMFLFLSVYFLYLGSKLLIDNSIYIAHNIFHISEKVIGIIF
FT                   VAFGTSIPELVVSLFAIIKKESDIALGNIIGSNIFNIGFILSSSSFISPVLMSDIYFVD
FT                   FGIMFVISLILLLVVKVKGVFDRGPSIIFLFLYILYNVYLFGVY"
FT   gene            complement(176925..178790)
FT                   /locus_tag="BRE_163"
FT   CDS_pept        complement(176925..178790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_163"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_163"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94419"
FT                   /db_xref="GOA:B5RQY5"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY5"
FT                   /protein_id="ACH94419.1"
FT                   /translation="MDVVYMRLNTCLMFFYVIFLLFSYFFLCFRLHSLNGNRYFKNGNF
FT                   FFVHKGALYKKRNNGIFKIETKGIETRWIYPFENPVSKRITSIYEDFYSLNSLLTTSDA
FT                   VYVSHNYFKNFIKLVDTEKFNKNSYITSSALSRGEYKHVAVGTSNSGLYISINNNLDFK
FT                   SLNSLISKTYLGAGYYDIISSLEFSKNSESELYCSYGIYGDIILINIVSGVIKKLDFPF
FT                   KKQIVRIIDLSDEKLEKLLVGTYDNHFYLYVDGKWIFDSQFSIYESNYFQKSKRLNLAS
FT                   NRGSIYLTAYTLRNKTAVDERFEFIKKLGMNSVIIDFKNDSGILTYASQLELPNKMNAV
FT                   KKLIDVPYILKKAKELGIYVIARVVVFKDSKFYLYNNCEYALWNKKTNRPWSNVVKVMN
FT                   GNSFKLIQKEHWVDLFSKNTWDYNLDIAKEIQLLGVDEIQFDYIRFPTDGPVSLIASRF
FT                   NKYEMRAIDALESFLILAREKISIPISIDIYGNNGWFVTNSIGQNISMISDYVDVISPM
FT                   FYPSHYTNDFLKNDLYYTTRAYKIYKEGSNRAFVFSSGKVIIRPYVQAFLLGSERIVSE
FT                   EVYLQYFFNQLQGVKESLGNGFSLWNASNIYYMVKTNLNKFLGFS"
FT   gene            complement(178852..180335)
FT                   /pseudo
FT                   /locus_tag="BRE_164"
FT                   /note="4-alpha-glucanotransferase, malQ"
FT   gene            180493..181650
FT                   /gene="tpn50"
FT                   /locus_tag="BRE_165"
FT   CDS_pept        180493..181650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn50"
FT                   /locus_tag="BRE_165"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_165"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94420"
FT                   /db_xref="GOA:B5RQY6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY6"
FT                   /protein_id="ACH94420.1"
FT                   /translation="MHIKTITLLFLIKTITFSSEILEFKYTKGTKFRIETTDQQKIYLN
FT                   GIFNSETKTNIQVSSEIKDIKNNFANIKSYFRVLERNDESDVYLLKEELEGNFSINKQG
FT                   EYKINHNQKRPSVRGIPQFPKTPIRVNETWTYPAEEYIQASEIVKGIKDFITKFNVSYT
FT                   YKGKEKIDGKYYDIIYSNYESKYNVKNILFSQKVNQKIYFDSKLGNIYKYHDTYEFQMK
FT                   NGNNNIKMIGTSSGKIISIELPNDNTIENEIKEYIKREQIDSIEIEKNKNGIKLSLDIE
FT                   FYPDSFQIIRKEHNKLKHIANLLEKFQDNNILIEGHTAKFGTEQEMQELSEKRAHTIGN
FT                   YLLKMKVKNKNQIFFKGWGAKKPKYVSSSPLASKNRRVEITILNN"
FT   gene            complement(181654..182037)
FT                   /locus_tag="BRE_166"
FT   CDS_pept        complement(181654..182037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_166"
FT                   /product="DnaK suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_166"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94421"
FT                   /db_xref="GOA:B5RQY7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY7"
FT                   /protein_id="ACH94421.1"
FT                   /translation="MQKSNFEHEFVEKMQTLLLELKKEILNSIRSVEDSKREIINNDMH
FT                   LKDIVDIAFDNMDGNNLEALSSVEKKKLNLINQALYRISHNIYGHCLACDKDIAQERLE
FT                   AIPYAFLCISCQTKKEKKSRRSI"
FT   gene            182206..182427
FT                   /gene="infA"
FT                   /locus_tag="BRE_167"
FT   CDS_pept        182206..182427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BRE_167"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_167"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94422"
FT                   /db_xref="GOA:B5RQY8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY8"
FT                   /protein_id="ACH94422.1"
FT                   /translation="MNTKEEAIETEGIVKESLPNTMFRVELKNGHLVLAHLSGKMRKHF
FT                   IKIVPGDKVKVELSPYDLTKGRIVYREK"
FT   gene            complement(182472..184514)
FT                   /locus_tag="BRE_168"
FT   CDS_pept        complement(182472..184514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_168"
FT                   /product="uncharacterized conserved protein"
FT                   /note="2 amidation motifs and one RGD (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_168"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94423"
FT                   /db_xref="GOA:B5RQY9"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQY9"
FT                   /protein_id="ACH94423.1"
FT                   /translation="MGNAGRRANCFFARRLVIFLILFLVHLKIYSLSGTDYLISSKIVK
FT                   GSKIIHIIRLNLSQDIDKKLLKFDINKDINENAKIALISRVIDGNNFIIEIKIEYVFDK
FT                   LGFVKIPPLKVIYNDDVYLTSEFEVVILREDEFRSLGLPVGLYWDFNKKEIYEYQSVGF
FT                   VLRSNWLLNNNVKSVASFFNAVKDAMIDRTPIFENINYRTFHSKEILDVPLYNFILTPL
FT                   RGSKVVVIPSVSFNISEDIMRMSPEISLKIKSIPEEVKSLAVGVFKIDYDFPNATSITQ
FT                   DAFTILIKITGQGNLPHIRFPEIETYNSRIIYNKKNYNFEPSKDGYKGSISNVYTIKPD
FT                   NKGNLFVNIGDFVYLDPDDDKVYRLNGKRLKYEYYGEFKKNNSNQELLLDFNLLSYYDI
FT                   LKYKNKTFLFFVPIYYLILIPGILFSLAMFIKHKKFFIASGCGLIVLILTLAVSLNAIN
FT                   DGFLSEDNINDLINDYRSSNYSDALNKIDNIIKRNSSYSGLWLNRALILSKMDRSFDAI
FT                   YSAYKAFFTSPNNDIFYKIIDFIETKNGINENIRNNSFVFSNIFFIISLILITILIVVV
FT                   SYRFYAKNLKRIILFLLLSMTCFTLFQTYYFYLEQQSEIGIIRGDLVSLYKVPDNFSRS
FT                   WKFLKGNISVYLLDKKDDFVLIQTSHGLKGWIHKNFIVSVKDDLI"
FT   gene            complement(184463..185050)
FT                   /locus_tag="BRE_169"
FT   CDS_pept        complement(184463..185050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_169"
FT                   /product="uncharacterized conserved protein"
FT                   /note="RGD motif (Prosite); Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_169"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94424"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ0"
FT                   /protein_id="ACH94424.1"
FT                   /translation="MGRYFLIYLLISFICAFCLSCSNVKAMSLMAIGNYRYIRGDYQSA
FT                   ISTYYNLVDDNKSAAWGYYNLGIVYYSLGEYESSLRMFSYARRDDDFFLNFNISYNEGI
FT                   IYYNQGLYRKAEVAFKEALKINPASYNAKYNLELAIIKKRTMPGNLNNLSISKSQNFIE
FT                   NNENFLRYIENLERVLWVMRADEQIVSLQEDW"
FT   gene            complement(185032..186021)
FT                   /locus_tag="BRE_170"
FT   CDS_pept        complement(185032..186021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_170"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_170"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94425"
FT                   /db_xref="GOA:B5RQZ1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ1"
FT                   /protein_id="ACH94425.1"
FT                   /translation="MSIGNYYAFYLFIVLFIVLFVYVYDFRKALPFFKALSLMHVNSAY
FT                   VKNYYIKKILMIFFFVLSFGFLILSILDVSWGQKATEDERVNLRISFVVDISRSMLTFD
FT                   EGKSINRLESAKNLISLILNSFENVEYSLTIFKGKSLLVLPFSKDKSSLYKMLNYIEPN
FT                   LISSPGSFLGDGVLSAIQGIKDSSYYNFLVVLTDGDEWGENNYYTFSKLIDVRNIVSFV
FT                   IGIGSNRPLPLVDNHVNVKDKNDSVMTFMLNEDNLYLLTFSIKGSYYNLYLKGTNYVIN
FT                   EIRNDIIKKSSSNILLIGILRYKLFLAVSFLFMMLYIFVKVIKWDDTF"
FT   gene            complement(186018..187043)
FT                   /locus_tag="BRE_171"
FT   CDS_pept        complement(186018..187043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_171"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94426"
FT                   /db_xref="GOA:B5RQZ2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ2"
FT                   /protein_id="ACH94426.1"
FT                   /translation="MKNLIEVIMLTFNEPLYLFLLLGLPLIIYFSHFFNRRGGKVRFPI
FT                   SIYGNFGSIKLRDYVLNLLYFVTYTFFYLAIIVMILTLAGPSISRKKMTYLSSGADIVI
FT                   VLDISPSMGAIEFSSKNRLDFAKELIEYFVYQRENDNIGLVAFAKEASLIVPLTIDRDF
FT                   FSKKLDDIYIMDLGNGSALGLGISIALSHLKHSEAPKKSVIVLTDGVVNSDEVYKDQVI
FT                   NLAQGLNVKIYSVGIGSDEELNVGFKLRSGKFYQGVLKEVYDPSMLFEISNKTGGLFYS
FT                   VGDDFSFKLAIQDFSKKENVERKVKISVDNNDVYNEFLLVIFFLLILYFVFSRIILKEV
FT                   L"
FT   gene            complement(187006..187914)
FT                   /locus_tag="BRE_172"
FT   CDS_pept        complement(187006..187914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_172"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_172"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94427"
FT                   /db_xref="GOA:B5RQZ3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ3"
FT                   /protein_id="ACH94427.1"
FT                   /translation="MKNMIFLATFFLLFLYFNLFSYEIQNEMFIPTRYYVGDTVEFKFS
FT                   LILDDDEKFIPIAFESIKNEFVEIDKILYRPESGEIIIYFVSFYIGSNTLPHIYVGDII
FT                   RSDKTFKLILNNIKINTSTLVADDDSLKIQDIEGVLFLPGTSTYFVIFILAFILIPYLF
FT                   IKFLKLIKQLLVFLIIKHNLRRPYRVFQKQLSILDNYIKSEEKQNVFYNLLNSSLRVYL
FT                   SKKTGFNFNAITTTEISEILQSLNVPHEIRSTFVNMLRLSDFSKFSGINLSGDNLSLVL
FT                   NDLKKAAFNFEEFNRGDNVNI"
FT   gene            complement(187911..188798)
FT                   /locus_tag="BRE_173"
FT   CDS_pept        complement(187911..188798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_173"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_173"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94428"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ4"
FT                   /protein_id="ACH94428.1"
FT                   /translation="MDMQYSSESSASTKTKIKALKFFSRKMLLELNFGGYRSIFKGLGL
FT                   EFHEFRPYEETDDARLIDWNVSSKTDNIFSKVFREDKGINLHLLVDNSLSMSLGSITSK
FT                   KEIQDLLVSIFAHMAFFNNDKIGMTFFSSKTDKFISSRKGYSHLGLILNETINRQLKRG
FT                   SNLTYVFKNTAEYYKKRSLIIIISDFKASDYFKSLTVLSKRHNIIAIRLTDFFDENLPQ
FT                   YGVLTYEDIETREDFLVSGFSKKILNSYKNYWTLDKIKWRKECIKRNINFIEIDTRDDV
FT                   FKKLKVLLKKENGI"
FT   gene            complement(188806..189798)
FT                   /gene="moxR"
FT                   /locus_tag="BRE_174"
FT   CDS_pept        complement(188806..189798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR"
FT                   /locus_tag="BRE_174"
FT                   /product="methanol dehydrogenase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_174"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94429"
FT                   /db_xref="GOA:B5RQZ5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ5"
FT                   /protein_id="ACH94429.1"
FT                   /translation="MKNSFQIDSEVENALSLINKFRREVASRILGQREMVDAILMGILT
FT                   EGHVLLEGVPGLAKTLTIQTVSDVLDLEFKRVQFTPDLLPSDLTGNMIYKSTTGTFKVR
FT                   KGPIFSNIVLADEINRAPAKVQSALLEAMSERQVTLGDETHKLPDPFFVLATQNPIEQE
FT                   GTYNLPEAQLDRFLLKVNVKYPSIQDEIKLLKIFSVDGGLENIKVAKIMNAYSLADLRR
FT                   IIGKVKVDDKIMLYIVTLIAASRENDKKTYPFTKYIEFGASPRASLSLLKCARVNALYE
FT                   GRLFVLPEDVKAVAYNVLRHRITPSYEAEVEEMNTDDIIKILLSAVALP"
FT   gene            complement(189868..190500)
FT                   /gene="gidB"
FT                   /locus_tag="BRE_175"
FT   CDS_pept        complement(189868..190500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BRE_175"
FT                   /product="glucose inhibited division protein B"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_175"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94430"
FT                   /db_xref="GOA:B5RQZ6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQZ6"
FT                   /protein_id="ACH94430.1"
FT                   /translation="MMTNFKFALKNLKVNFTSENIDKLRFYIEKVLLFSDRFNLVSNNV
FT                   RNFDAMLLHALDSVSGLPIVKDKNLRQVLDVGSGAGFPGIVLALFDRCRKYVLLERSNK
FT                   KAIFLKMISLELGLENVEVLEHNVEEEQNKYEFITIRAFGDIRKYANILGSILKSGGLI
FT                   MAYKGKFDKVEFEMSYVKNLFDKVEIKSSEVISDKERYFLLLYDYKC"
FT   gene            complement(190497..192377)
FT                   /gene="gidA"
FT                   /locus_tag="BRE_176"
FT   CDS_pept        complement(190497..192377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BRE_176"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_176"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94431"
FT                   /db_xref="GOA:B5RQZ7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ7"
FT                   /protein_id="ACH94431.1"
FT                   /translation="MFRKIGMDFDAIVIGGGHAGIEASLALARLNFKTILITQNLDTVG
FT                   KLSCNPAIGGLAKGNMVREIDALGGEMGCLVDFSMIQFRILNKSKGPAVQAPRAQADKL
FT                   VYQIKAKETLEMQNNLELFQDTVSDFLLNPMKNKIEGVVTERGNKFTSRVVVLTTGTFL
FT                   RGKIFIGEYKAYMGRISEPAAFGLEKILLELGFEMGRLKTGTPARVHRRSINFAKTEIQ
FT                   FGDSDIIPFSFSNTKIDKTQLSCYVTYTNKKTHEIISENMHLSPLYSGEIVGNGPRYCP
FT                   SIEDKIVKFKDKDKHQIFIEPEGINTQEMYLNGLSSSLPEDVQKRLINSIDGLEDAVIT
FT                   RSGYAVEYDYINPIELYASLETKRVEGLFVAGQTNGSSGYEEAAAQGLMAGINAALKLQ
FT                   KKEPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKWGYEV
FT                   GLVSEEKYSRYFFKEKQIEEIKELLRHRRLKEKEASSFELKRHINKDFYHIVKDPYINL
FT                   KDLVNIDPKLNASKVILEQVELDIKYEGYINRQKDLIRKMNNLELIKLPLDFNYEIDGL
FT                   SREAREKFVKIQPANLAQASRVSGVRNTDIQVLLIYFSNPKNKVVLNLDL"
FT   gene            complement(192362..193756)
FT                   /gene="thdF"
FT                   /locus_tag="BRE_177"
FT   CDS_pept        complement(192362..193756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="BRE_177"
FT                   /product="thiophene and furan oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_177"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94432"
FT                   /db_xref="GOA:B5RQZ8"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQZ8"
FT                   /protein_id="ACH94432.1"
FT                   /translation="MSRLFQKEDDIVALATPFFSSALCVIRSSGVSAIEKFSTMFSDPS
FT                   KLLEASGHTIHYGYILDNETKEKLDEVVVCLYRAPKSFTGQDSIEVMAHGSLIGIRRII
FT                   DFFLKVGFRMAEPGEFTLRSFLAGKLDLTKAEAINELISAKTRQVHALAVNKLSGSLFD
FT                   KIDLIKKDILNFLSAISVYLDYETDDNEVVIPVDIILKSKSELERLIDSYDTARKLENG
FT                   VTLVLAGSVNVGKSSLFNLLLKEDRAIVSSYAGTTRDYIQASFEFDGILFNVFDTAGLR
FT                   ETSDFVEQLGIVRSNSLIKEASLIFYVVDLSGKLTDDDLKFIDAYKEDSRVLFVLNKVD
FT                   LEQNNQTVEFFNSNDIVSLNTVKISTKTLFGINSLYDRIRSFIAVDYMKTSDYDIVISS
FT                   TRQAALLKRAYALIIELLSKIEQNISYDMLAFDVYEVVNVLGEITGEVTSDDVLNNMFK
FT                   NFCLGK"
FT   gene            193895..194389
FT                   /locus_tag="BRE_178"
FT   CDS_pept        193895..194389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_178"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_178"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94433"
FT                   /db_xref="GOA:B5RQZ9"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQZ9"
FT                   /protein_id="ACH94433.1"
FT                   /translation="MEIKLETELKNTLEEETFLIEKIYSMYLNIKKYLDEKNAMMLKES
FT                   IDKTNIYLQEFKDVEQKRDKIWKEFTQNEQFESTYMAIEKLCSTYKKEIHNYFHRLKIG
FT                   TLNIQNLNHLISSYVETSLDMLDSIFQDAQETVDNITYKNPYGPKNGTPNEASVLINKK
FT                   L"
FT   gene            194408..196291
FT                   /gene="flgK"
FT                   /locus_tag="BRE_179"
FT   CDS_pept        194408..196291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="BRE_179"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_179"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94434"
FT                   /db_xref="GOA:B5RR00"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR00"
FT                   /protein_id="ACH94434.1"
FT                   /translation="MDSTFSGIEIGKKSLFAHKDAMNTVGHNLTNATKPGYSRQRIIMK
FT                   TEMPIYAPQLNRANKAGQLGQGIMVQSIERIRDELLDIKIAEESHHLGYWNLKDRFISL
FT                   LENVYNEPEEQSMRKRLNDFWASWQDLSKQPQGLAERNIILERGQAFVEVITSRFHSLE
FT                   RIYTMANDEIKITTEEINNYLRNISDLNKQIAKAIAMKGHPNDLMDERDLIIDKLSNLI
FT                   SISIENKRDPNEFLIHIEGKHLIQGTIANELILEAANGPTKTKWNILWNNRETANINTG
FT                   KLGALINIRDNEIKNEINELDNIAINIAELVNEVHISGYGLDKQNGRIFFEQEYKLTDD
FT                   RGRYDSNGDGQFDSVHIFKVNSTNEISPKEKLGFAGILRFQAINKNDFIEIPYNATDTV
FT                   KDVIDKINNSDAQVTARINENKKFEIKAVKEEDKDSTIFRIKHIEDSGLFLTNYTGILN
FT                   ASGIEGAYNYQNINTTDQLTNTTRYSISPLKNPSAWIRISKVIAEDPSKIASGIQTPTN
FT                   NTPIGDNKAALRIASFVNSQIMIEKNSTLNDYFVNTASNIAIKGQIAEITKNSQEQILK
FT                   NLTDLRLSISGVNKDEELANMIEFQQSFIAASKFINISAELIDTIINKMGV"
FT   gene            196295..197569
FT                   /gene="flgL"
FT                   /locus_tag="BRE_180"
FT   CDS_pept        196295..197569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="BRE_180"
FT                   /product="flagellar hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_180"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94435"
FT                   /db_xref="GOA:B5RR01"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR01"
FT                   /protein_id="ACH94435.1"
FT                   /translation="MINRVSHPLTYDNLKSSSTNKEVKITKLLESLYQGGKRITNLRND
FT                   PTGVTHSIRLDSNIFKLNTYSHNINNARGKLRYVEGYLQSLSNILTRAKEIAIKGANGT
FT                   YGTDDKKIIAKEINAILEDVLAIANAKGADGYSMFAGTKVDAEAFKATRAKKINKLTQD
FT                   RAETQIIKIDYNGNQSEQTTEICNGIYISTNYPGSELFFSQNQYITSSKNVDNFVVQEN
FT                   TKIYIDNVEIVLTAGDTAADIIAKINESSAPVEASLDNILNSIIINTTTPHQMWITEEE
FT                   GSTVLTDLGILNQNNDSKEPPYNIANNAEIRNRTIFDSLIDLRDNLEENREGLIGSRNL
FT                   AEIDESLSKILSTLADLGTKENRLEVSYARLSKEIMDMKDDMVQYTDLDVTKAITDLNM
FT                   TSLAYQVSLGVSARIMQTTLLDFLK"
FT   gene            197571..197963
FT                   /locus_tag="BRE_181"
FT   CDS_pept        197571..197963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_181"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_181"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94436"
FT                   /db_xref="GOA:B5RR02"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR02"
FT                   /protein_id="ACH94436.1"
FT                   /translation="MKNKFSIKVKFPEGILGFEDIKEFIIKDSAHKPFSIMQSINGEIN
FT                   FLVTSPFNFLEKYLPNIENKDWLDIQAENENEKVILCIINMHVKNYKEITANLKAPIIL
FT                   NKKKLIGKQAISTNEEHYLRYRVFKE"
FT   gene            197966..198202
FT                   /gene="csrA"
FT                   /locus_tag="BRE_182"
FT   CDS_pept        197966..198202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="BRE_182"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_182"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94437"
FT                   /db_xref="GOA:B5RR03"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR03"
FT                   /protein_id="ACH94437.1"
FT                   /translation="MLVLSRKANESIKIDSNIEISILEIKKDSVKIAIKAPENIKILRS
FT                   EIYDIIKEENKKSILQDKNNIHKIKKLFDYFSK"
FT   gene            complement(198187..198876)
FT                   /locus_tag="BRE_183"
FT   CDS_pept        complement(198187..198876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_183"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_183"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94438"
FT                   /db_xref="GOA:B5RR04"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR04"
FT                   /protein_id="ACH94438.1"
FT                   /translation="MIVGFWNLIMNTLAIEYSYKNLLIYFQINEEILFFIMKKNEVNNV
FT                   FNVPKLFNDFILDKNIDLGNLDLLINSSGPGSFTGLRISLSFIKGLSLGLSIPFVNIPT
FT                   FDVCVRLFHTESDILVLSFTAGRYFLGHYRDFKLCGNIVCFSEIDLLKYLNELDCKFVI
FT                   VGNDIDFIYEKFKSRFRVIDDMCAFGAVLTDLGKAKYLNSRQGDDILSGPCYVRPSDAE
FT                   INFYLLK"
FT   gene            complement(198830..199258)
FT                   /locus_tag="BRE_184"
FT   CDS_pept        complement(198830..199258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_184"
FT                   /product="uncharacterized conserved protein"
FT                   /note="ATP_GTP_A motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_184"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94439"
FT                   /db_xref="GOA:B5RR05"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR05"
FT                   /protein_id="ACH94439.1"
FT                   /translation="MILSFKREDEMITFSKSFFNPLPIGKILALYGEIGVGKTTFLKGL
FT                   ALNLGISSFVSPTYNIINVYEFANFRFYHIDLYRLHLLDEFELIGGMELLLDMSSIIAI
FT                   EWPDMVVDILPKDRLRFLKFKIKDDSRILEFDNEYSCN"
FT   gene            complement(199255..199554)
FT                   /locus_tag="BRE_185"
FT   CDS_pept        complement(199255..199554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_185"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_185"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94440"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR06"
FT                   /protein_id="ACH94440.1"
FT                   /translation="MLASWDLFKRAGIVKFISLANIKKECSHIYYRSVYFADAFYEYNG
FT                   LKEVKHVKFIIEVTPLNEKHVTIEFLEPLNYPVLSLMVAIKRHVIELNTKGELP"
FT   gene            complement(199720..200067)
FT                   /gene="rplT"
FT                   /locus_tag="BRE_186"
FT   CDS_pept        complement(199720..200067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BRE_186"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_186"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94441"
FT                   /db_xref="GOA:B5RR07"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR07"
FT                   /protein_id="ACH94441.1"
FT                   /translation="MARVKNGIVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMY
FT                   ATRDRKTRKRDLRSLWIVRISAALTGMGINYSRFFEGLRKLNIKLNRKILSNLAIEDIE
FT                   SFKKIVYEIKN"
FT   gene            complement(200088..200285)
FT                   /gene="rpmI"
FT                   /locus_tag="BRE_187"
FT   CDS_pept        complement(200088..200285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BRE_187"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_187"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94442"
FT                   /db_xref="GOA:B5RR08"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR08"
FT                   /protein_id="ACH94442.1"
FT                   /translation="MPKMKTCKSARKRYAFTSKGKVKYKKQNLRHILTKKSAKRKRNLG
FT                   KSGLVSNVEVKRIKTLLPYV"
FT   gene            complement(200308..200868)
FT                   /gene="infC"
FT                   /locus_tag="BRE_188"
FT   CDS_pept        complement(200308..200868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="BRE_188"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_188"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94443"
FT                   /db_xref="GOA:B5RR09"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR09"
FT                   /protein_id="ACH94443.1"
FT                   /translation="MINRNSGKDRDRSRSGDKELRINHRIKAREVRVIFNDGTQSVLPI
FT                   EDAIKCARDVELDLVEISPNALPPVCKIIDYGKYKFHQEKRQKEQRKNQKIIKLKEVRM
FT                   QPKIDTHDLDFKYKNILGFLKEGNKVKVTIRFRGRELAHTHLGYGILESILERVGDSNY
FT                   VLESPAKMEGKTMFLIIAPKSRK"
FT   gene            201046..201708
FT                   /locus_tag="BRE_189"
FT   CDS_pept        201046..201708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_189"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94444"
FT                   /db_xref="GOA:B5RR10"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR10"
FT                   /protein_id="ACH94444.1"
FT                   /translation="MNVFLIVSLPLVLKIYMQIKHPQLKLIKQTYTYAMSILLAATIFS
FT                   SLYLIEEFILYKNLLINYQTKFDLIYSIFIKEQIYYYIFPLFIFTFFFTLNPNSLLRNN
FT                   PIFLIYFAFGLVFSKNISLLITNSKVFGTYEYIKIPLIHMLELIFTAIICEKGIRLHLT
FT                   QNINGYQAIFIPILTLEIIITLLKVFILINQQIYSLAISLILLGITILNKKAIGSIK"
FT   gene            201708..202454
FT                   /locus_tag="BRE_190"
FT   CDS_pept        201708..202454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_190"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Possible lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_190"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94445"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR11"
FT                   /protein_id="ACH94445.1"
FT                   /translation="MLHKINILLITIILISYLSCTKDKITDKDFSYVIIFSNATEYFFK
FT                   IKNTPFIQENILFINEKDIENIKEKLNNIEKILLTHKLNNEILNTEQIKNKTFYLSEIK
FT                   FSLKKAINSIFNDPSIDLTTSLIIRDHTINQEDSKYLEKIAQDHNINITTIDDKNISHI
FT                   KNLITPKITKAIIFSMRNNHIFLKKLSESSLFKQIEFILIGNIKQDIKEVNVKYIISIN
FT                   IPNLIEIIKNINKNFQYEFNIYKTTK"
FT   gene            complement(202547..203344)
FT                   /locus_tag="BRE_191"
FT   CDS_pept        complement(202547..203344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_191"
FT                   /product="Tatd, Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_191"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94446"
FT                   /db_xref="GOA:B5RR12"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR12"
FT                   /protein_id="ACH94446.1"
FT                   /translation="MKVDFNRAIFLEKLIDTHVHFNEMKKHSVDIHYVISECFKSGFSY
FT                   FIDIGLHPSDFYERKQFLDTYSNIALTVGIHPLNKASNSDFELIEKILMTENVIAIGEV
FT                   GLDYLKANNKNEQIEVLGIQLDLASKYQKPVILHVREAYDDIYNIVKSSNFMHRGILHC
FT                   YSGTYDYAKKFIDLGFKVSFAGNLTFKNSDLLRMVLKKLNIEDILIETDSPFLAPVPLR
FT                   GKINTPLFLGYTCIEIAKIKNCDIEKIVSTFYNNFKDLFKDLI"
FT   gene            complement(203341..204483)
FT                   /locus_tag="BRE_192"
FT   CDS_pept        complement(203341..204483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_192"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_192"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94447"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR13"
FT                   /protein_id="ACH94447.1"
FT                   /translation="MLDNKLLDDFEDISQNSDKELLDVTEKSKRGYQLIKEERLFEAES
FT                   LFNDILQKDDDNNYALVGLGDIERKKRNFDKAIIYYQKCLAKHSNNNYALFGLGDCYRS
FT                   LGDYKKATDVWEEYLKYDSKNITVLTRVASSYRKLKNFQKSRQSYLRVLELVPDNDYAL
FT                   VGIGHLYYDFKEYKEALKYWLKMYEINQVKIDVRLLTSIGNCYRKLKEFSKGIYFFKRA
FT                   LEISPNNFYAIFGLADCYRGSKEYAEALKYWLTIIDRDPKNNLVLTRVGDTYRYLKDYE
FT                   NAQIYYKKALDVDFDMFAILGLALLQKEQGQYEEALIAIKNLIKTNPKNSILYVNVAEC
FT                   YEALGQIEDAIGILSSFLQLGMKNVTIIDYITNLKKKMDA"
FT   gene            204782..205861
FT                   /gene="prfA"
FT                   /locus_tag="BRE_193"
FT   CDS_pept        204782..205861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BRE_193"
FT                   /product="peptide chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_193"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94448"
FT                   /db_xref="GOA:B5RR14"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR14"
FT                   /protein_id="ACH94448.1"
FT                   /translation="MKMFLEKLNPIEKKIKILEEKLQDVNLIKNQKEYSKIIKEYNYLE
FT                   KIKEKKDEYQHILNQINENQKILSEEDNLEMKDLIKQEIAHLYSKKDEIENTIKILLLH
FT                   QDENDDKNIIIEIRAGTGGEEAALFAHNLYEMYTKYSEKKKWKTELINFNKTELGGFKE
FT                   VSFEIKGKDVFKKLKHESGVHRVQRIPITESNGKLQTSAATVAVLPEVEDTDIEINDKD
FT                   LRTDVYRSSGAGGQHVNTTDSAVRITHLPTGIVAQCQNERSQHKNKEQAMKILRARLYE
FT                   LENLKKQEQRSNDRKQQVGSGDRSERIRTYNFPQNRVTDHRANISLYKLEEIMQGELDS
FT                   LLNTLALKFQEQSLKNSQL"
FT   gene            205872..206705
FT                   /locus_tag="BRE_194"
FT   CDS_pept        205872..206705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_194"
FT                   /product="HemK family methylase"
FT                   /note="AMIDATION and N6_MTASE motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_194"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94449"
FT                   /db_xref="GOA:B5RR15"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR15"
FT                   /protein_id="ACH94449.1"
FT                   /translation="MTIQEVIKNAKKYNLSTIEILLLLEKILNINKELIFANTNKNLTQ
FT                   QEEYKLFSQIKNIKSGIPIHYILGTKEFMGIKFYINKHVLIPRDDTECLVEEALIQIKK
FT                   NNLSKILDLCCGSGCIGLTIAYYLKQKVTLADISAQALKVSLKNTQRLNLTNHIEIKRS
FT                   NLLKYIGKKFELIITNPPYLTKDELRIKEKLAKEPRIALLGFGQDGLKIAKKIIKQAKY
FT                   KLTKNGLLILEMAPWQKKSLEKFAIQEGFTYLKTIYDIENRERALLLRIKHDTSL"
FT   gene            206689..208692
FT                   /gene="spoT"
FT                   /locus_tag="BRE_195"
FT   CDS_pept        206689..208692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="BRE_195"
FT                   /product="guanosine-3,5-bis(diphosphate)
FT                   3-pyrophosphohydrolase"
FT                   /EC_number="3.1.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_195"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94450"
FT                   /db_xref="GOA:B5RR16"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR16"
FT                   /protein_id="ACH94450.1"
FT                   /translation="MIQVYEIAYLLKINDIDKLKNIFKKTVDNTYQDDIQKKLIFKSLE
FT                   ISEQLHYGQYRESKEPYVIHPIMVALFLIKFQLDFKTIIAGLLHDVLEDTSVQKEEIIK
FT                   EFDQEVFSLIDGVTKIHDLHNKTRAIKEANTISKMFFAMTHDIRIIIIKLADKLHNMAT
FT                   LSHLPKNRRERIARDCLATYVPIAERLGISSLKIYLEDLSLKYLYPKEYKEIKNFLSAT
FT                   KIEREKKLYKGKLIIEKELKKIGIDVTITVRSKHFYSIFRKMKTRNNNISQIFDTLGIR
FT                   IICKKQKECYEILEIVHKVWKPIPGRLKDYIAIPKENKYQSLHTTVRIPEDNQLIEIQI
FT                   RTEEMDKIAKYGVAAHWLYKEKVELKADDISFINRIKKWQQESANKNQYSMHDIHKELL
FT                   NTFIYVYTPEGEIVELPFGSNSIDFAYTIHTDIGDQALYAKINGKISSLTKPLKNEQIV
FT                   EIFTSEEAKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLIGENKEQKRLF
FT                   SLFKSLTKSKLKSITTASDCNPLTGEDIIGLIQKDTIVVHKENCKEITYQKKNHLVEVE
FT                   WEATPTRKVYHIIIFLKNLKDLFNYLDNLFTTFDVRLISEKIEDCGNEHGIINIIILSN
FT                   HKNVSMIFNSLKENPNVLQIMQVEEDIKNYDN"
FT   gene            208682..210925
FT                   /locus_tag="BRE_196"
FT   CDS_pept        208682..210925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_196"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_196"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94451"
FT                   /db_xref="GOA:B5RR17"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR17"
FT                   /protein_id="ACH94451.1"
FT                   /translation="MTIKILFLILINISILHKTINADERKQYNEQIITHITKINMLNKS
FT                   LDKIERIKNTYNYIKKYFIENQIQYKEHSLQEIGFIGYSHKAIHTKIKGKEKTIYNIII
FT                   PIETQYKLKNNLAIAIAITLINNFKNKEIKNSINIYFIEDDSHKQISTINSRLLLNSNT
FT                   FEKDINTIYLMLNEDKRNNLIEFKNQSNIINSKTNLSFLKNSIKTFENNKVNFSVSKIT
FT                   NKNINEIYNLYLKEKIPILIISNNREHSLLKYIKENNPYDIYKAIEETIKTENNIQNED
FT                   TLHYVIINTIFKKWIINEITLIIAIYATYNFIILIMIIRFKKTSIILRKTKENYHKIIK
FT                   LFSILFLSSYLSILFTNKMLFAYENIIDYDIINPVYLVNFFLTLFNFNLMFYFAYNYKI
FT                   HLNLKELKYLAISTSIVEFIIVLYIKIEFILITILKNILILMIPNKIKILKKLIIIFIW
FT                   VINLILITSIQTTLMISRPIELSYFIAISLFSAILANIVEHLKHKTTTIKQEFQKSEKI
FT                   EFIILLLIIAIIIISYDIEKIATIKISQTISFPEHKNEINVKYLQDNKNTIQLSIKDLN
FT                   LKLDKNQTQIKKETKIQEKLIDVSFQKIDAAERSIYTIKITTTKIAEQIHLYLENASEL
FT                   IVYQSNTPYKIVSNNIIFTANNIKSNITNITFTIKCKEDIKYNAFAYFDTNKNEVKIYD
FT                   QKTKKEIKNINIDYSYTIKHSGILPKSSKQDLDPFFKLQNDKEIEKLQNLNLN"
FT   gene            complement(210922..212016)
FT                   /gene="ddlA"
FT                   /locus_tag="BRE_197"
FT   CDS_pept        complement(210922..212016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="BRE_197"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_197"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94452"
FT                   /db_xref="GOA:B5RR18"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR18"
FT                   /protein_id="ACH94452.1"
FT                   /translation="MKKNLMLIFGGVSFEHEISLRSAYGIYSSLLKLDKYNVFSIFVDK
FT                   VTGIWYLLDSVPSSAELIKRHTTSIVNFIPGCGIFVNNKSLEIDVIFPIIHGRTGEDGA
FT                   IQGFVKMMDIPCVGAGILGSAISINKYFCKVLLKSFNIPVVSFIGFKKDDYILNKEGIK
FT                   EDINNKLNYPVIVKPSVLGSSIGINVAYNVSQIEKYIEEAFEYDLTVVVEKFIKAREIE
FT                   CAVIGNDQIKIFTPGEIVVQDFIFYDYDAKYSTVPGDSIVFNIPAHLDMKHLLDIKEYA
FT                   FLTYKYLELRGMARIDFLISKDTNLLYVNEVNTIPGFTDISMFAKMCEHDGLSYESLVD
FT                   KLITLAFESYKKRKDKIDFTRLES"
FT   gene            complement(212021..213547)
FT                   /gene="murE"
FT                   /locus_tag="BRE_198"
FT   CDS_pept        complement(212021..213547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="BRE_198"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_198"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94453"
FT                   /db_xref="GOA:B5RR19"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR19"
FT                   /protein_id="ACH94453.1"
FT                   /translation="MNMNRKVLNDVLFRLNQNLIQKIIGSCEVEILGLAYDSRCVSFNF
FT                   VFFALPGLYFNGQKFIESAIQRGSNVIVHTNDIDFYDSNVTYIKVDPCNIKRFMSNFAH
FT                   VFYDEPSKKLKIIGVTGTDGKSSVCFYIYTLLKSMGAKVGFISTVFLEDGSGALVKNPY
FT                   RQSTPESTEIHLVLSKMVANNVEYAIIESTSHGLDDRTSRLLDIEYSVAVLTNISHEHL
FT                   EFHGTMQNYLRAKLNLFYSANSHGGFGIINMDDNHFSVFMNSINRTYTYSLKNEKADFF
FT                   ISKINEQMGFTEFEFYHNKTKYAARVNLTGSFNVENVMAALIVVSQIMNVDISKLICKL
FT                   INIESLYGRMQDINFGQDFSLIVDYAHTPGAFLKMFPIFKRLAKKRLISVFGSAGERDI
FT                   LKRRLQGEIADEYSDVIILCDEDPRGEDSMQIIRDIAEGIVTKTLNRDLFFIPDRKCAI
FT                   EKAINIACSDDLVVTLGKGHESSIIYKDKSIFWDEQAVIKDIILSLGNRG"
FT   gene            213692..213764
FT                   /locus_tag="BRE_199"
FT   tRNA            213692..213764
FT                   /locus_tag="BRE_199"
FT                   /product="tRNA-Cys"
FT   gene            213853..215094
FT                   /locus_tag="BRE_200"
FT   CDS_pept        213853..215094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_200"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_200"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94454"
FT                   /db_xref="GOA:B5RR20"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR20"
FT                   /protein_id="ACH94454.1"
FT                   /translation="MLELIIILILIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTVV
FT                   YNLSQNPSKLVTTILIGNNIANITASTLTTKFVLDKYGNNSLAFSTGIITIIVLICSEI
FT                   FPKQIAILNNESIVLYTSIFIKTLTIIFTPAIYIINGIVKILLNLCKITTNQKITKDSI
FT                   KNMLSLAEKLGILENDDRIFMQKMLNIGEVRASEIMTHRTEVFSLSSTSKLKDKIKLIK
FT                   KEGYSRIPIYKGQNREQIIGILITKDLIEISKKKLEKNIIKFIKPAVFVQQNKRIKDIL
FT                   DIMRQKQKIMAIVIDEYGGFSGILTVEDIMEKIFGAIFDEYDFEEKKQLITKKDDNIYL
FT                   ISGETTFDEIEETVGIKIQHKDYINTMGGYIMDLLDKIPTKGEQVNTEHGEYLIEEIQN
FT                   HKIKKITFKKIQKE"
FT   gene            215219..216151
FT                   /gene="hflK"
FT                   /locus_tag="BRE_201"
FT   CDS_pept        215219..216151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="BRE_201"
FT                   /product="Lambda CII stability-governing protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_201"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94455"
FT                   /db_xref="GOA:B5RR21"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR21"
FT                   /protein_id="ACH94455.1"
FT                   /translation="MLNNILNFFNKTYEYTIILIVLVIILIITISNVFIVGPSDEAVIL
FT                   RLGKLNRILEPGIHIKIPLIEEKLIVPIKIIQEVKFGFNANNNMVINPDEDEEIIITGD
FT                   LNIIKVEWLVQYKISDPYSFMFKVEDPEKTITDIAKASMNRLIGDNTIFEIINDNRVGV
FT                   TEGVRDSMNEIIKTYNLGIDIIQVQIRNAMPPKGKVYEAFEDVNIAIQDKNKFINEGKK
FT                   EFNQIIPKIRGEALKLIEEAKGYKENRINSALAETAIFNAILDAYIKDPEITRERIYNE
FT                   TMKEILKNKDNIEIIDKNLKNFLPFKEVK"
FT   gene            216152..217123
FT                   /gene="hflC"
FT                   /locus_tag="BRE_202"
FT   CDS_pept        216152..217123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="BRE_202"
FT                   /product="Lambda CII stability-governing protein"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_202"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94456"
FT                   /db_xref="GOA:B5RR22"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR22"
FT                   /protein_id="ACH94456.1"
FT                   /translation="MKYILKFLLYFAKILAFTLIFGLILLAITQPIYILKENEISITTR
FT                   LGKIERTENTAGLKYKIPFIENVHIFPKYILRWDGEPQRIPTGGEEKQLIWIDTTARWK
FT                   IVDINKFYTAIKTMFRASIIINAAIEPAVRSVIAKYPLLEIIRSSNDPIQRLSDGILTP
FT                   QDITNNTTYKITKGRKIIENEIIEVSNQNTKDIGIEIVDVLIRKIGYDPSLIDSVYNRM
FT                   ISERQQVAEEQRSIGIAEKTEILGSIEKEKLKLLSEARAEAAKIKAEGDSKAAQIYANA
FT                   YGQNTEFYKLWQSLESYKITLKDKRKIFSTDMDFFKYLHHTK"
FT   gene            217548..217620
FT                   /locus_tag="BRE_203"
FT   tRNA            217548..217620
FT                   /locus_tag="BRE_203"
FT                   /product="tRNA-Phe"
FT   gene            217821..219359
FT                   /locus_tag="BRE_204"
FT   CDS_pept        217821..219359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_204"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_204"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94457"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR23"
FT                   /protein_id="ACH94457.1"
FT                   /translation="MILKEIKKIEDLTEKDIIFLNIGNLTKLSTKINEKIITFLKKGNV
FT                   SHIPVISNYENISHETLVNTINKELLNNKLNFLKEELIEASKDIYKPFSEKDKIFTISG
FT                   KKTTINLNTLMEREPDSIYSKEIIEGSFKILPRHKIISIQKILSTIYDYFGFQKIIDQD
FT                   NLHHQTIKKLNLQSIRRDYEFFREQVQTEGDSILIHAIDTTIYFLFTIAQLNKERAAKN
FT                   APRSTSKFFIDKSHYTEFTEFFYDNDIIIQAAFGVLLHPIGLMHTTILQKIRNKISIKQ
FT                   NDTEKQLFSKIEFLEKSINISKNLFRMRDDISAITKMIINGQKNYLNKKNHTETTKKFT
FT                   HELIRIFCIIDTYDEMINPIIIKEPVNPLEAIEFLTQNSAKYYWDKDKPDEYLRNKKFD
FT                   IKMLKNFLKILAPFDYGTIINVHTKNCNEPIFKAVVFKYTMDILPILSIIKQKDKSYKI
FT                   GDILLNLESREIIIKGQDGEIKKSPFKNTDKFELRHNIQELKSEQFPLLDSIQN"
FT   gene            complement(219364..219960)
FT                   /locus_tag="BRE_205"
FT   CDS_pept        complement(219364..219960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_205"
FT                   /product="N6-adenine-specific methylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_205"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94458"
FT                   /db_xref="GOA:B5RR24"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR24"
FT                   /protein_id="ACH94458.1"
FT                   /translation="MVYIYLIFLQNDLKCILMRVSSGKYKGWKVACPRVGYVRPVMAII
FT                   REAFFSILFNQISGINFLDVFTGTGIMSLEALSRGASLVHLVDYNKFSKNVLIKNFDIV
FT                   NEPYKFFFTKAEFFLAKRDLFYDLIYLDPPFNYPLKKNLLEIISKNKSLNKNAKIIIHY
FT                   PARENLDNNILRLSKYDFRKYGGSRLDFFEVNLDI"
FT   gene            219995..220825
FT                   /gene="gtaB"
FT                   /locus_tag="BRE_206"
FT   CDS_pept        219995..220825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gtaB"
FT                   /locus_tag="BRE_206"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_206"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94459"
FT                   /db_xref="GOA:B5RR25"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR25"
FT                   /protein_id="ACH94459.1"
FT                   /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFINSG
FT                   IKEILIITSRRKKVLDNYFDREVELEHTFIKECRKDFLEQIKLKDINICFIRQNTMMGT
FT                   GHALLHAKPWIGNESVIVAYPDDLHIGSPPLTAQLIELYKKTGKNILSIIENPKNINRY
FT                   GVIELNQDNIHVKDIVEKPAIGHEPSNKASIGRFLYTNEFFKFLEEGFKFHQKGEYHHI
FT                   YALKKLMIENKVLYKKIEGERLDIGDIEGYLETIIKIAKQDDKLLQIINNSLRN"
FT   gene            220826..222541
FT                   /locus_tag="BRE_207"
FT   CDS_pept        220826..222541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_207"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_207"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94460"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR26"
FT                   /protein_id="ACH94460.1"
FT                   /translation="MTITTKYQKFYDNLKILKKYINTNVEEKILKYSILSKLYKLNEKE
FT                   VINLITISKNYELKKNILNITLEEYYYEKAQDNNLKNWILEIIKEKNLLQIKKETNLIS
FT                   KRPGITYKLNSSNFLKIIEIYNNKQYTEEKKELYKQLILNFSNNLKIENLEPTIDILIA
FT                   VKYRNKEKIKQILKDNLSFQRLFKSSLSQKQNRVTKLKKLLILTYWPVGCLSKSLFNKI
FT                   LTKNYKYIIDEVLTLKYDEILKYLKTIKTFSLNEIFYKGSNKNSNFNYFFSEFTRYTPK
FT                   DFQNTFKTYLFSLEKTAIKQYLKWFFKDKVPHEWKDFIFTIEYIDTHKLLNLNTNIEDM
FT                   ITAKFQAEEFFISFEKMNFNPYKSSKIFQNKNLRRIFLINVINYIKKHITKIDTYGWIS
FT                   FYIYADKNDRIQTEKDIKQFFKNKNFEIQNQIFVYFLSFYPNIDKKHFEFISEIMLYLD
FT                   SNKITIPQEIIQMQKTSPHKFNYCKSYIFVKSLTLRTRVFKILNKNIKLELLFQPEEFH
FT                   KKISLLPAIYYIVCYYKPDTLKEEQKISPKQKEEIINFITFLTQEQNKFGFKTL"
FT   gene            222591..224867
FT                   /locus_tag="BRE_208"
FT   CDS_pept        222591..224867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_208"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94461"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR27"
FT                   /protein_id="ACH94461.1"
FT                   /translation="MKKCLLLLKNLIVLLILLLNSSLAYSQRLIKLGQEEIKNKNYSQA
FT                   IKILSEAIQKHPKEQDGYYFLAIAYRENNQLTEAEGALLDGIAIGGNIDYKLYFELGNI
FT                   MFKRGKGYYNLAIRYYSSSIKNMPNYDKALLNRANSYVEQGKINFKEKDYKNAWDSYTM
FT                   AIHDYSQFITLKYESSKKNAILHMIDLLRNKKADLEKLDKTLQNRSEEHIAKGKPKEQK
FT                   NTQKYENKQEFGTEKQSSNSQQHQNSQNLNQSNNQQHKKEITPTQKPQQHQNSQNLNQS
FT                   NNQQHKKEITPTQKPQQHQNSQNLNQSNNQQHKKEITPTQKPQQHQNSQNLNQHNNQQH
FT                   KKEITPTQKPQQHQNSQNLNQSNNQQHKKEITPTQKTQQHQNSQNLNQSNNQQHKKEIT
FT                   PTQKPQQHQNSQNLNQSNNQQHKKEITPTQKPQQHQNSQNLNQHNNQQHKKEITPTQKP
FT                   QQHQNSQNLNQSNNQQHKKEITPTQKPQQHQNSQNLNQHNNQQHKKEITPTQKPQQHQN
FT                   SQNLNQHNNQQHKKEITPTQKPQQHQNSQNLNQSNNQQHKKEITPTQKPQQHQNSQNLN
FT                   QSNNQQHKKEITPTQKPQQHQNSQNLNQNNNQQHKKEITPTQKPQQHQNSQNLNQNNNQ
FT                   QHKKEITPTQKLQQHQNSQNLNQNNNQQHKKEITPTQKPQQHQNSQNLNQHNNQQHKKE
FT                   ITPTQKPQQHQNSQNLNQNNNQQHKKEHQNKKTMLKEKFADNVKTNSLIELDKINWQEE
FT                   LNIDE"
FT   gene            224860..227205
FT                   /gene="lmp1"
FT                   /locus_tag="BRE_209"
FT   CDS_pept        224860..227205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmp1"
FT                   /locus_tag="BRE_209"
FT                   /product="surface-located membrane protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_209"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94462"
FT                   /db_xref="GOA:B5RR28"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR28"
FT                   /protein_id="ACH94462.1"
FT                   /translation="MNKRKNLPILIILIILLITSFGGLGYYIYKERLNKNNQEIMLNEV
FT                   KNSIMDRNYKKAHSITKILKDKYPQNTDIAMIENTLSELANDSPFESKNLQRDTANQIL
FT                   DKIQGKEQSIPLDNENSEIAFNNKYIKDTTKIENYADRQDNTGIANENILEFNQNTIPQ
FT                   NLNDNTNTIKEQQKSNIENKNDTDDKKNLFNLQKLKASLNKELDQTNTDQTNTKPKKII
FT                   KTDHKNKDKATTDNLIQDNTKQTTAKKENFTISKPKTKIENIKDTPKNQIIDKIEIPYN
FT                   YSTKKILYEILDNINTGNSLLAKERINELVKKGLNEQFSKINDLIDKQKNQEAAQLLIK
FT                   LIKQDVKPNQTSKRQAPLEKELLKQKLPIEEIPPIKEQPIDTQIQTEKDPNIEPNQSMQ
FT                   NSQKLQTLKTLASKNEKQKNFKKAETIYEEIANTTNNEEDHYKLGIIKFKLKKYEESLQ
FT                   AFDKAISLNPQHKKAYTNKGTSLIALNKPQQAIKEFEKAIAIDQNYDNAYYKKGIAEEQ
FT                   DNDKQNAFISFKKAYEITKNPHYALKAGIIANHLGDFKNSEKYLKQSNTSLNAKNDIMF
FT                   YNLSMANFKNNHLNESLININKALNINPTQTEYLYLKASIYLTKENYNEAVPLYNTVIS
FT                   KNPDNITAHINLAKAYEKLKNIPKAISILEKISNKNHAIALNNLGILYKNQKNYQKAIE
FT                   VFQKAEAQSNIDAKYNLATTFFAIKDNKKAMEKLKEYIKINPNNPEALHALGIIEYTEY
FT                   GNDKILKEVIKKFPNYTQNKTITEIIGK"
FT   gene            227202..229037
FT                   /gene="mutL"
FT                   /locus_tag="BRE_210"
FT   CDS_pept        227202..229037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BRE_210"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_210"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94463"
FT                   /db_xref="GOA:B5RR29"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR29"
FT                   /protein_id="ACH94463.1"
FT                   /translation="MNKIKFLDKTLVQKIAAGEAIDRPCSILRELLDNAIDSGADKIEV
FT                   FIEEGGIRRILITDNGSGISKEDLKICYLPHTTSKINEEKDLERIQTLGFRGEALSSIA
FT                   ICSNLMITSSITGENSYQIEIENGIEKYFKKQSAINGTMVDVTNLFHNFPARKRFLKKD
FT                   SIETKMCLKVFEEKAVTHPGIDFKLSVNKELKKVYFKESLADRVQSVYGEIIENNKFGK
FT                   IEAEYDHVKMKIFFTPPNFSRKDRRNIKIFVNRRPIEEKSLSESIINGHSRILTYKNFP
FT                   VCYLFLEIDTTHVDFNIHPQKKEVRFFNLPFLPKQISNNINEFFDREKQEILQDYHNVI
FT                   IKRQLTNDAHLLHPENDLTNSNFKTYEITQDEDLILDKPKNNKVTNIIEDKVKFEGQIS
FT                   QKYKPSFKQHIQKIFIKTSKMPNNFQKSTQTNEFKYMGQLFSEFLIVENANEIYFIDQH
FT                   ALHEKIIYQTLINSEKTIQKLLVPIEFQVECEDTDKILTSELEEYKKIDIIVKKIQNQT
FT                   YRLESIPNICNKYENIIIQFFKTRKSKIIDSLETELYATLACRQAIKCNDTISLEFSQF
FT                   LINEFFNLKLKHCPHGRKIYHKITKFELEKSVNRQ"
FT   gene            229058..230098
FT                   /locus_tag="BRE_211"
FT   CDS_pept        229058..230098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_211"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_211"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94464"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR30"
FT                   /protein_id="ACH94464.1"
FT                   /translation="MRKDLKYKIQKLIQQKDKALIELGKELKNSNIIELKKLESYTSLK
FT                   LIEKEISQLKANLNKSEEVTHKLNELYKKNKDYTAREKHILKAYEIKLKKIIEIIINKY
FT                   PNNLSMILEHNLDFIKSTLAKDKYKTTEIINCKEKINFFKKLIINIKQMLKDKRNKTNI
FT                   KKMSKEFENKILKQYLESENLEETVNEFIENKDLSTEIIEEYKLITEMKTEILKINNEI
FT                   KHANTTNNMHNKNKIKRTINIVQFKKESILKKIAEEFVELSQTEKGLNKTGTINSSLET
FT                   IKNLSKQISKLNKELIKEIKKSEIIKIQTKMQELIKHKESIEIKLNELNSKIETIQDEI
FT                   HELDNQ"
FT   gene            230154..230227
FT                   /locus_tag="BRE_212"
FT   tRNA            230154..230227
FT                   /locus_tag="BRE_212"
FT                   /product="tRNA-Met"
FT   gene            complement(230230..230883)
FT                   /locus_tag="BRE_213"
FT   CDS_pept        complement(230230..230883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_213"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_213"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR31"
FT                   /protein_id="ACH94465.1"
FT                   /translation="MLRELKFNIVLFFLIIFCSCEMNYPEIREVDYVINYYFNKDKFDY
FT                   FMTFDFAVKVLNAGTLNKFIIENMDSREFIEVVKDKYSSSFVNSILGQDVLYCKDLRFN
FT                   FADKTFDSFVAKVHLIDSGMRVYSKDVIISLNLSNEELASIYDHVYKSKDVEKLNEISS
FT                   NNLFLIKTSKDEINFLYSIIKINDLMNIQMDNNLDTYIGFYHMGKYSNLFFKLN"
FT   gene            complement(230861..231439)
FT                   /gene="efp"
FT                   /locus_tag="BRE_214"
FT   CDS_pept        complement(230861..231439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="BRE_214"
FT                   /product="elongation factor EF-P"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_214"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94466"
FT                   /db_xref="GOA:B5RR32"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR32"
FT                   /protein_id="ACH94466.1"
FT                   /translation="MSTIKSGDIDKGSFLLFKGMPHIVLEREFSKMGRGGSIVRLKLKN
FT                   LKNKSVIKETLKGSDTVEEIEVLEVNSQYLYKDNESLIFMDLETYDQFSVNLRDVVNLE
FT                   DKVLFLQEAEVYSLIKWGNEVIDLKLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLHTDL
FT                   VVKAPLFINIGDKILVNSETKEYAERVKV"
FT   gene            231505..232407
FT                   /gene="pstS"
FT                   /locus_tag="BRE_215"
FT   CDS_pept        231505..232407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BRE_215"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_215"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94467"
FT                   /db_xref="GOA:B5RR33"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR33"
FT                   /protein_id="ACH94467.1"
FT                   /translation="MTYLRLMILYIVVKGVNLMQVIKILFTILLAFLFSNCTKNKENVI
FT                   AIGGSTSTTAIMDEMILKYQKINDQIKVTYDAQGSSVGIKGLFNGIYKMAISSRDATEE
FT                   EIAQVAKVTIIAYDALIFITSPDVKITNITEEDLVKILNGNISNWKQVGGPDAKINFIN
FT                   RDSSSGSYSSIKELVLEKILKNLEEAQFRKDSIIVKSNGEVIEKISLTPNSIGYISFGY
FT                   ARGAIEKGLHTLSINSIYPTKETIIKDKYDIKRKIIAITNNISEDQNTLDFINFILSPS
FT                   GQDIIEEQGFIKVNTTENN"
FT   gene            232495..233403
FT                   /gene="pstC"
FT                   /locus_tag="BRE_216"
FT   CDS_pept        232495..233403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="BRE_216"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_216"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94468"
FT                   /db_xref="GOA:B5RR34"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR34"
FT                   /protein_id="ACH94468.1"
FT                   /translation="MQLTLKTKRNIVRLAFKCFIVASATISTLIILLLILFIIKNGITP
FT                   FLNNKINILNFLFNTDWNPTSKIQKSYGILSFIINSALTTFFSVAIALPIGLGFAIYLS
FT                   EKTKGIYQKTLQTIIELLAGIPSVVYGFFGSTFISSLIKNTFIREDNLGYNLITSIIVL
FT                   SIMILPTIISVSYTSLKTVPKSYKLASLALAATDWQTIYKVMIPSASKGILAGVILAIG
FT                   RAIGETIAVLMVGGGSPLFIRNIFSPIRTLTVNIAIDMAYASGTHKEALFATALVLLSL
FT                   VIITNSIKHLILSSSKRLKIK"
FT   gene            233400..234938
FT                   /gene="pstA"
FT                   /locus_tag="BRE_217"
FT   CDS_pept        233400..234938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="BRE_217"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_217"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94469"
FT                   /db_xref="GOA:B5RR35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR35"
FT                   /protein_id="ACH94469.1"
FT                   /translation="MKKIQMNKLFNQIAFCIIKFIAYFLITLLLFIISYIVYNSIFFTS
FT                   KKESLFLDETTHFLPFKSNNNTVKIAFIINKSIKINEITTQDIYNIYNNKISHWGSISD
FT                   QNLDIVPIASSQPNMSNEVILQTLIKNNKFNNRYIKLVESSEDMIEAINQTNGAIGYLT
FT                   KDDLEKLDFKKYPKIKSLRIKSISILVGKKTLQKSENEIIDIINLQQIKKLLIGKANWN
FT                   DLISKDIKLNIIKYSDYDPNAIKMVEKNEGTIAIVPWHYFYKSDAPFLKLYDIKKNMPL
FT                   NLNFILSTPRNSGKYGGISYLILNTFYVILLTAIISILIGIGTGIMLAEYTSNKVFYKT
FT                   VSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIVKTTEESLKSIP
FT                   KSYKYASFALGANKTETIIKILLPAANPGILTGIVLAIGRALGETAVLLFTMGTNLGLA
FT                   STLNEPSRSLTVHLLLLFQEGYLDKGFATASILIIIILLINLISKFLINKLYRI"
FT   gene            234942..235706
FT                   /gene="pstB"
FT                   /locus_tag="BRE_218"
FT   CDS_pept        234942..235706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BRE_218"
FT                   /product="phosphate transport system ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_218"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94470"
FT                   /db_xref="GOA:B5RR36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR36"
FT                   /protein_id="ACH94470.1"
FT                   /translation="MNQDKAIIQTENLNLFYTDFKALSNINISILRNSITALIGPSGCG
FT                   KSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNNFDVLELRRKIGMVFQTPNPFLMSV
FT                   YDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLCIAR
FT                   TLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFF
FT                   LNGYIEEESKTDELFFNPKNIKTEEYITGKFG"
FT   gene            complement(235708..236529)
FT                   /gene="gufA"
FT                   /locus_tag="BRE_219"
FT   CDS_pept        complement(235708..236529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gufA"
FT                   /locus_tag="BRE_219"
FT                   /product="GufA protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_219"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94471"
FT                   /db_xref="GOA:B5RR37"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR37"
FT                   /protein_id="ACH94471.1"
FT                   /translation="MFKHLCDYLLTLHPIFLGFLGSVFTWFTTAFGAAAVFCFRRVNNK
FT                   IMDAMLGFSAGIMIAASFFSLIKPAIEMAEELGYVTWIPAVCGFLCGAFFIYIVDVFVP
FT                   DLEKLTFIDEDLTRHGKKDFLLFTAVTLHNFPEGLAVGVAFGALASSPDLHTLVGAMIL
FT                   TLGIGIQNMPEGAAISLPLRRGHVPLWKCFNYGQMSGLVEIIGGFLGSYAVYTFTRILP
FT                   FALSFSAGAMIYVSIEQLIPEAKRKDIDNKIPTIFGVIGFSLMMFLDVSLG"
FT   gene            complement(236557..238335)
FT                   /gene="alaS"
FT                   /locus_tag="BRE_220"
FT   CDS_pept        complement(236557..238335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="BRE_220"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_220"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94472"
FT                   /db_xref="GOA:B5RR38"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR38"
FT                   /protein_id="ACH94472.1"
FT                   /translation="MKLDELRAKYIDFFKSKGHCEIVGKSLIPDNDSTVLFNTAGMQPL
FT                   VPYLLGEIHPSGDMLVDVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKELSVEYS
FT                   FEFLTSPHYLNISKDKLYVSVFEGDKDIPRDVKTADIWEKLGISKDRIFYLSREHNFWG
FT                   PVGNVGPCGPDTEIFVDTGIDKCSNTCDITCSCGKYFEIWNNVFMQYNKDNDGNYEELK
FT                   RKCVDTGMGIERTITFLQGKSSVYDTDAFRPIIKQIEKISGKVYGDNLEDDRAIRIIAD
FT                   HIKASCFILADNFSVLPSNVGQGYVLRRLIRRSIRYAKKLGMESHCLADLVDSVEDIYK
FT                   SFYKEITEKKDFIKNELNIEEEKFFKTLRYGEQEFVKLIHQLSSKLIPGDISFKLYDTY
FT                   GFPYEITEELAIEYGFSMDREGFEEHFKKHQEVSKKGSDKVFKGGLADCSYETTKLHTA
FT                   THLLHKALQLVLGDHVRQKGSNITSQRLRFDFSHPCKMTDDEIKKVEDIVNLQIKNKLS
FT                   VKKSIMSLEDALVKGAIALFGEKYEDIVSVYEIDGFSIEVCGGPHVNNTSELGTFKIQK
FT                   EQASSSGIRRIRAILI"
FT   gene            complement(238335..239582)
FT                   /gene="fliG-1"
FT                   /locus_tag="BRE_221"
FT   CDS_pept        complement(238335..239582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG-1"
FT                   /locus_tag="BRE_221"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_221"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94473"
FT                   /db_xref="GOA:B5RR39"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR39"
FT                   /protein_id="ACH94473.1"
FT                   /translation="MRGSMQDPRLSKYQDVKNLGVKTFQNIWNNKGIKSKELYDDLGDS
FT                   EIQGSILKSWVNLVKKRKKDSQSKLNASNKGVERPGFIRRESKVSKIAKYFLAIGLEKS
FT                   AEIMAELDDADIIAITREITNIKYITPDDKKRIIKEFEELIRSEKKYLKVDDKFAYELL
FT                   NKSLTKTQAKEIYKKVTGLDPFLPFDYLSGIENEQLWALIRNENVQTLLVIYGYLTKEQ
FT                   KKYVFSMLEMDVKKKFIKTLAKPRQLNVDVIEVISNRLKDRLKIQGKLKTEKLDGSKIL
FT                   VDILSYMDFEDEKNLLSNIDMKVFNPVKDIEIKEKIFDINVILRITDNDMHNILREFKN
FT                   HDIAMIIKDKSDEIRNKILFNISRRRKELVLEEESLLKRARKKDIKAMTMSFVNYIKEL
FT                   TLKGELIIYRKNEEFV"
FT   gene            complement(239557..240261)
FT                   /gene="pgl"
FT                   /locus_tag="BRE_222"
FT   CDS_pept        complement(239557..240261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="BRE_222"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_222"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94474"
FT                   /db_xref="GOA:B5RR40"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR40"
FT                   /protein_id="ACH94474.1"
FT                   /translation="MMEFLYSNKESDLKNKFFEFFLNNVSQSDFTSIGICGGRNIISFL
FT                   NVFDEQNYSLKKSHFFLTDERCVDLNSSYSNFKLLSENFFSKMVEKNLVCGSNLHPFIY
FT                   NEFDETSSIYNYNIEFNSRFTRLDLSILSVGEDGHIASIFPSKKLLFSEMEGYQYEYDS
FT                   PKFPNKRISLTPKSLLSSKASVLFFIGDEKRGALENFLSSDISLRECPARIFKDHSHLL
FT                   VFTNIERVYAGS"
FT   gene            complement(240278..240970)
FT                   /locus_tag="BRE_223"
FT   CDS_pept        complement(240278..240970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_223"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_223"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94475"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR41"
FT                   /protein_id="ACH94475.1"
FT                   /translation="MFLEKMLISLSFILLLLASFIISSGIKGIGVKNANYITVKGLSER
FT                   EVLSTFSSWSLNYELGGNSVEEINKLNNANLLRIKDFFVSYGFHEDEIDMLNMSLNIAN
FT                   YRDTLYKYNAYVSLGVRTSDVDKMEKASKNITELYNKGVLLNSNLGPRYYFDKINDVKP
FT                   DMLADSIKNAYSAALEFAHHSGVALGKVKTANQGYFEFIPIDRSDEDHARYSKKILRVV
FT                   TTVSYYLD"
FT   gene            241040..242047
FT                   /locus_tag="BRE_224"
FT   CDS_pept        241040..242047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_224"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_224"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94476"
FT                   /db_xref="GOA:B5RR42"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR42"
FT                   /protein_id="ACH94476.1"
FT                   /translation="MLINRKISIAPMVEITDEHFRYIIRLLSKKITLYTPMISAKSIII
FT                   GELNTIVKQNPNDSPIAIQIATNCENDAAKAIEILEKNFNFDEYNLNVGCPSSRIQKAN
FT                   YGACLMQNPIQVGKILKAMQKNTNKPISIKHRIGIRHNKKEYQEETYTELKQFVDKIIE
FT                   YGIKNFIVHARIAILNGYSPKDNHNIPKLKYDFVYQLKKEYKNTFIEINGGIINSNHIE
FT                   THLSYVDSVMIGRAAAQNPYFVAKISREFLGEKEQIPTRKEILFQMVEYIKEYNEHPTI
FT                   NTILRHIMRVIHSQKNACKFRQALTAPFNQNLKNHEILLNAIEHLKEDTLSSNS"
FT   gene            complement(242037..243311)
FT                   /gene="serS"
FT                   /locus_tag="BRE_225"
FT   CDS_pept        complement(242037..243311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BRE_225"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_225"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94477"
FT                   /db_xref="GOA:B5RR43"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR43"
FT                   /protein_id="ACH94477.1"
FT                   /translation="MLDLKFIRDNLELVRENIKNRGLKLELDLLISFDDERRKLITKIG
FT                   ELNALRNENANAMKDNIGDSSRHYLIEKGKALKAEIMDLEERLGYLTSRLLVEHKRIPN
FT                   ISAPDVPVGVSEDENVVLKVSGNIPKFDFKPKDHLEIGIHLDLFDFEKAREVSGNKFYY
FT                   LKNEAVFLELAMINFAFSKLKAKGFDLFITPDVAREFIVDGIGFNPRGAESNIYKIEDT
FT                   DKYLVGTAEITLGGYYYNTILDLKSPLKMAGLSHCFRKEAGAAGQFSKGLYRVHQFSKV
FT                   EMFCFCRSEDSDRIHNEFLELEEEIFIELEIPYRVLNVCSSDLGAPAYKKYDIEAWMPG
FT                   RGENGDYGEVTSTSNCTDYQSRRLKIRYKEDGQNKFVHMINGTAIASTRTLIAILENFQ
FT                   DAKGGVRIPKSLVKYTGFDYISPKN"
FT   gene            243439..244173
FT                   /locus_tag="BRE_226"
FT   CDS_pept        243439..244173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_226"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_226"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94478"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR44"
FT                   /protein_id="ACH94478.1"
FT                   /translation="MEKNIFMIKSPTTQKVLIFISLLISLLGCTKKSKKISFNDIDTLY
FT                   NEKNEIIIQSISAEKESELLKYKIRIPKIITQTTESNKAKSLNDEIESYANEIVSNLES
FT                   ATQNTSQNPQKPSLNIDYEIYYGYGIHTIIINTSQEINNTYITNHRSYYINSNGDYIYN
FT                   IDEIINIEEAFPYFTHKIKEKITTTYQNKLLFDLQQAVIYFKDKKIIIKFPLYVFNLEA
FT                   TDHTENIFEFSEEESKKYIKQG"
FT   gene            244186..247104
FT                   /locus_tag="BRE_227"
FT   CDS_pept        244186..247104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_227"
FT                   /product="Zn-dependent peptidase, insulinase-like protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_227"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94479"
FT                   /db_xref="GOA:B5RR45"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR45"
FT                   /protein_id="ACH94479.1"
FT                   /translation="MKKKKLFNLISKTYLEEYDAEGSYFKHESGLEIFELKNSTFKENA
FT                   FGIAFKTIPFNNTGVAHILEHAIFCGSNKYKIKDPFLYLMKGSLNTFLNAMTFPDKTLY
FT                   PAASTIQKDYFNLFKIYSDAIFNPLLKKEAFMQEGYNINPNNFKPSGIVLNEMKGNYSS
FT                   KNSLINEISTNSLFSKGPYQYDSGGNPINIIDLTYEEFIEFYKKYYTLENCKIFLFGNI
FT                   DTNKNLNFIEKYIIRPCTNKKSNVNYNIDKATRWNQHKTLSFNIPKETENTLGVYVINW
FT                   LCSDIENIKENIGLEILSEILLDSSCQFTINMLKSEIGDVIADVSGINTDIKECIFSFG
FT                   LQNVLPGKIEEFKDKVFQELKNLVKVKIPQELIQGILFGYEFSLKEEKGQGWPINLMIK
FT                   SFKGWIHGLHPTETLKINYQLNEIKNKLERGEPYFENLIEKYLLNNNHYTLIHFNPSDK
FT                   MLKEMEEQIEKKLMDREINIKKNPEKFSKFTKDYNKFKKYQNKKDLKSDIAKIPILKIE
FT                   DLPKEVDKSLILNYVPELKAHTFELKKNNNIFNVYLFFTLDFLQKEDFLYLSLLKRAIQ
FT                   DLSTKNYSYITLNNKIQNTLGQLNIYESYKEDIHRNMINLFNINFKSFNNKIQESFTLI
FT                   KEILINIDFHDYNRLKEIVLSLKNDFKSILIPQGHILATTRSESKLSQSKYLQELQFGI
FT                   TGRQYWHKIKTDIESLKEIAHNLENLRNKIILKNNLSSLLIGNTKDVIKKLETELFILK
FT                   ENLNEKIYSNNLITIQPSSNVLKEIMIIPSKISFNAMSFASYRITDKEYPTINFLTHIL
FT                   KSGILWEKIRVAGGAYGAFASITNGIFSFASYRDPNFITTYQAFEASLEELANNEIKCD
FT                   EIYTYLIGVIGLNTNVKTKSTEILQSYKRKMLNISDHLRQNIRNNYFKITNTDIKNISE
FT                   KVLYQLKEKNSITSLVSNTIYENDKTKIEKFIGKKYRVKKIY"
FT   gene            complement(247132..247377)
FT                   /gene="rpmE"
FT                   /locus_tag="BRE_228"
FT   CDS_pept        complement(247132..247377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BRE_228"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_228"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94480"
FT                   /db_xref="GOA:B5RR46"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR46"
FT                   /protein_id="ACH94480.1"
FT                   /translation="MKKDIHPVSNLVVFKDGANGAMFLTRSTLTSKEVIKYSDNKEYPL
FT                   ITVEISSKSHPFYTGQQKFVDAAGRIDKFNKKYKKA"
FT   gene            complement(247435..248979)
FT                   /gene="rho"
FT                   /locus_tag="BRE_229"
FT   CDS_pept        complement(247435..248979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BRE_229"
FT                   /product="transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_229"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94481"
FT                   /db_xref="GOA:B5RR47"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR47"
FT                   /protein_id="ACH94481.1"
FT                   /translation="MDRKCEEFDLEDEMKRLNSSKELKIEDNNKKKVVKVVTKKESVSS
FT                   ASRNSNIDKLRESNELSSDFDYDISDPDLESSIKTLEQSNIINFLGGKDSIVIDTLYDK
FT                   PITEIRKVVEGLGTNHTIAVTMKKTELIFLLVKILTEHNINVLFTGVLDVLSDGYGFLR
FT                   TASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPREGERFFAMIKIKSINDQDPT
FT                   FAQNRIPFDNLTPLYPSSKLDLEYENCNISTRLINLFAPIGKGQRALIVSPPKAGKTTL
FT                   LQKIANAITTNYPDIVLMILLIDERPEEVTDMIRGVKGEVIASNFDEQASRHVQVAEMV
FT                   IEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPKRFFGSAR
FT                   NIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFPAINIKKSG
FT                   TRKEELLLSEEERSKILLIRKILSGVDDYEGVEALVEKMKKSKNNEIFLKTMSNGD"
FT   gene            complement(249066..249473)
FT                   /locus_tag="BRE_230"
FT   CDS_pept        complement(249066..249473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_230"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_230"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94482"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR48"
FT                   /protein_id="ACH94482.1"
FT                   /translation="MPVNVKNSYKWDCKLDSSLIFRGKLKFEGALYLDSSFEGEIFSEK
FT                   GILFIGKNSKVITDVVICDTLIIEGILKGNVNASNKVYLNSGCKIYGDVKTKKIFINDD
FT                   IVFDGKCEMIKSNESIDLFSFTVSQLKDTLQ"
FT   gene            complement(249477..249803)
FT                   /locus_tag="BRE_231"
FT   CDS_pept        complement(249477..249803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_231"
FT                   /product="HbbU protein"
FT                   /note="HISTONE_LIKE motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_231"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94483"
FT                   /db_xref="GOA:B5RR49"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR49"
FT                   /protein_id="ACH94483.1"
FT                   /translation="MSCSKRSKVTKSDIVDQIFLNIKNNNEKLEKKYIRLVVDAFFEEL
FT                   KNSLCVNNVIEFRSFGTFELRKRKGRQNARNPQTGEYVNVDDHHVAYFRPGKDLKERVW
FT                   SIKG"
FT   gene            complement(249815..250141)
FT                   /gene="rpsT"
FT                   /locus_tag="BRE_232"
FT   CDS_pept        complement(249815..250141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="BRE_232"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_232"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94484"
FT                   /db_xref="GOA:B5RR50"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR50"
FT                   /protein_id="ACH94484.1"
FT                   /translation="MIDYIIISWYIIYYHVCCIKEFNLGNNPSALKRARQNLKRNLRNV
FT                   SVKSELKTLEKHCIKLIKDGKKDEALEFFKFVSKKLDTAARKRIIHINKAARKKSNLSI
FT                   LLLQ"
FT   gene            complement(250145..250966)
FT                   /locus_tag="BRE_233"
FT   CDS_pept        complement(250145..250966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_233"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_233"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94485"
FT                   /db_xref="GOA:B5RR51"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR51"
FT                   /protein_id="ACH94485.1"
FT                   /translation="MQELFFYKIRLLFIFCLNISFSIYYMLLYRSSFSIFILFLMFINF
FT                   FVMVSYLRYFYEIDFKGNKIFYKKFCFKVNFDFHDIIWIEKRLLDNMLILGLNNGTKIK
FT                   MCFLRKEYLSSFFKKLKLIRSDLFITKMQELPIRYYVSGTYILMYLFRVLINIFVYYIS
FT                   FGSIIVFSLVLILGIKVLIRDILGLKNLVIFYEFRQNSVYERKLFSGKEYYYEFFNKIF
FT                   VYNSELTGDGYLSFVYPYKSIFKKVYINDEGMSYSMKKVFAYIDKYCNKCS"
FT   gene            complement(250977..252083)
FT                   /locus_tag="BRE_234"
FT   CDS_pept        complement(250977..252083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_234"
FT                   /product="conserved hypothetical GTP-binding protein"
FT                   /note="ATP_GTP_A motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_234"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94486"
FT                   /db_xref="GOA:B5RR52"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR52"
FT                   /protein_id="ACH94486.1"
FT                   /translation="MALNVGIVGLPNVGKSTLFSSLTASKSEIANYPFCTIDPNVGIVE
FT                   VPDERLLKIANLVSSKKIIPAVIEFVDIAGLVREAFKGEGLGNKFLANIREVSIIVHVV
FT                   RCFNDREVIHIDGDIDPQRDISTINTELCLADLETVQKSILKNEKNAKSIDKNISENSK
FT                   IIVSLLRDLEKHLIDVRPASEFKFDEFGYNFVKSLNLLTMKNVIYVCNVDEDSLSGNKY
FT                   TDVVKNIALSEGNNYLILCAKIEAELAEIQDLSERREMLESMGIKESGLSNLIRTSYYT
FT                   LGLRTYFTAGEQEVRAWTFIDGMKAPEAAGIIHSDFQRGFIKAEVYSFDDLIEFQGVHG
FT                   LKEKGRLRLEGKDYLVRDGDIILFKFNV"
FT   gene            complement(252108..254171)
FT                   /locus_tag="BRE_235"
FT   CDS_pept        complement(252108..254171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_235"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_235"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94487"
FT                   /db_xref="GOA:B5RR53"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR53"
FT                   /protein_id="ACH94487.1"
FT                   /translation="MFRVKILNLYSTCFSIKKIALMFNISIFLINAFVLNAQGIVTNKD
FT                   AQEEFKWALNSYNNGLYDDALLSFKRVLSFDPSNLDYHFWIGNVYYRLGHVEEALMEWR
FT                   NLQSQGYKSAYLRQLISIIEQRRGISLNNEFKNIEKFVQVALLDNSIYKRPNGYQITSL
FT                   KADQYGGYYAANFVGNEILHFDANNNIHVLVKDGITSIKSPYDVIELDKLLYVTLYSND
FT                   EIGIYDKTFGIKKGSIGKKGTEDGELLAPQYITVDERDYIYVSEWGNKRISKFDAKGSF
FT                   VLNFGMKTVGYAGLLGPTGVTYLNGNIYVADAPRNSIEVFDTSGNHLYSISTSFEGIEG
FT                   LSSDFASNSIIISSKYGVYKYSVSSKTFVKLLKADKIDSKILSSIIDVNNQMVVSDFDN
FT                   AHIAIYKSDVSVYDSLNVDVRRVIRAGGSKIYVELNISNRNGLPIVGLKSENFAVANER
FT                   YYIVNPKIAYDINTSNDMNIAIVFDKSFSMKNYESEQIMSVNTLIKSRKNKKFSFINAT
FT                   NLPLVDNIDSLLSMIHKTNSLGVYDLNDVKTDVSLKLAGSELMSKSARRAVIYFSDGSL
FT                   SHSAFSRYSVDTILSYYKNNDIRFYLILFGNSPIESKLQYLVNETGGAIIPFSSYEGVS
FT                   KVYDLMMKQKTGTYLLEYDYPGPQEPNGYYNLSVEVNFNQQIGRGEFAYLIN"
FT   gene            254271..255824
FT                   /locus_tag="BRE_236"
FT   CDS_pept        254271..255824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_236"
FT                   /product="apolipoprotein N-acyltransferase, putative"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_236"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94488"
FT                   /db_xref="GOA:B5RR54"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR54"
FT                   /protein_id="ACH94488.1"
FT                   /translation="MKTKYFSLAAFSGLLTSLAIPNEINNMGYSHIGLIAYIPLFIALT
FT                   KTKNKKFLITLTTFYFLIANSLQSFWLAFFYSFGIITFLGAILGYIPYALVLGYLLYYS
FT                   LKTFNNKTLTLAILFTLYDYSKSIGFPAYPWGFSAFMVHNFNDLIQVADTFGVFFVCFV
FT                   VYFFNAGIANFLINQNKTNILSMLFSILLISTSFAYGNIKKIELNPILNKEIDTLNIAA
FT                   IQINIDSWLPGNRKEGIKKSITITKQALREHPNTELVLWSEGVLTYPFNTYKDYAYYDQ
FT                   ELLELYNSVNELIINNKAYFAIGSPSKTDKRLLTHQNSVYAINPNLEITNIYSKIFLVP
FT                   FSEKIPFYEYKFIRQFFYKNFGLFGQTNGNRLEILKLKKFNLGFLICYDDAFPDLARSY
FT                   KKQNANLLLNFSNDSWSHTNSSEWQHFVVAKFRSIENGIKTIRATNSGITAIINEYGEN
FT                   VKSLETFKEGYLVSKIKLPPRFTTIYEYIGDLFIYALAIAIVIMTLRYHLTEKSNHLLS
FT                   "
FT   gene            complement(255788..256564)
FT                   /locus_tag="BRE_237"
FT   CDS_pept        complement(255788..256564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_237"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_237"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR55"
FT                   /protein_id="ACH94489.1"
FT                   /translation="MEVNMKKLVLLFFSCIFINLFASNDSLIDERQKELAIFYYEVGQR
FT                   YIDVGKVTKGKIFQKKALEMYPKLKGEVDLKSAVEDIDSKMKLESEATFLSFDDVKLDD
FT                   IPGIIHDKIEISEVTNAPRIEYVASRERENHKEQAVKFQFNKFVRAFLLQDLNLLDSVI
FT                   ADDVKVLGKIAPKSDFIANLEFASSDFNRDDLGYLSVDDFYDLKSLSITKTTDTSYTVK
FT                   VKAKKNDITQNIPFWRDVQTLCFVNQDNKWLLFSVK"
FT   gene            complement(256624..257244)
FT                   /gene="dck"
FT                   /locus_tag="BRE_238"
FT   CDS_pept        complement(256624..257244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BRE_238"
FT                   /product="deoxyguanosine/deoxyadenosine kinase(I) subunit
FT                   2"
FT                   /EC_number="2.7.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_238"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94490"
FT                   /db_xref="GOA:B5RR56"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR56"
FT                   /protein_id="ACH94490.1"
FT                   /translation="MDAGLVIVIEGLIGVSKTTLGHILSLDLEIPFYRELNNEFTLSML
FT                   NEFYKDKFRWAFPMQISFLNERFKLIKSVFKSKGKGILDISIYSDCVFASFLNDNGYIS
FT                   DNEYKIYLDLLDNMLEHSKKPELMIYLDCSIAEAENRIKKRNRSCETDISKDYLEKLNK
FT                   KYLTWYDSYNLSPKLMFNYDKINVFDDREKSNLITFIKDKLVI"
FT   gene            257950..258711
FT                   /gene="glpF"
FT                   /locus_tag="BRE_239"
FT   CDS_pept        257950..258711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="BRE_239"
FT                   /product="glycerol uptake facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_239"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94491"
FT                   /db_xref="GOA:B5RR57"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR57"
FT                   /protein_id="ACH94491.1"
FT                   /translation="MVYTKTQEFISEFLGTFILLSIGTGSVAMTTLFPSNPTIAGEIIN
FT                   GGYTNIVFGWGLGVTFGVYTAAKISGAHLNPAISLGLATIGKFPKSKLCYYIPAQILGA
FT                   FSGTLMTLIVFYPKWIEIDPKFEITQGIMSTFPAIPGFWPGFIDQIFGTFLLMFLVLVV
FT                   GKFIKEDIQNPFFPFIIGAIVIAIGISFGGMNGYAINPARDLGPRILLLIAGFKNHGFN
FT                   DINVLIIPILGPIIGANIGAMVYKLTLKDKK"
FT   gene            258775..260262
FT                   /pseudo
FT                   /locus_tag="BRE_240"
FT                   /note="glycerol kinase glpK"
FT   gene            260390..261745
FT                   /gene="glpT"
FT                   /locus_tag="BRE_241"
FT   CDS_pept        260390..261745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BRE_241"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_241"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94492"
FT                   /db_xref="GOA:B5RR58"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR58"
FT                   /protein_id="ACH94492.1"
FT                   /translation="MKKIFNFLKPAPHIQRVDKELEESLYKKLRLQIFLSIIIGYAGFY
FT                   LTRKIFSFVMPELEKEGLNKSQLGIILSGVSIAYGFSKFIMGNVSDRSNPRYFLSLGLS
FT                   LTAAISITFGLLPWSSIDTSIAIVLMFILMFANGWIQGMGWPACGRTIVHWWSKKERGI
FT                   IVATWNVSHNIGAGIAGIISAQALFYFNEWQAVLYVPAFIVIIIAIFVLMTLKDTPQSV
FT                   GLPPIEEYKNDYPDNHTEDAEKELNAKEIFIKHVLNNKLLWYIAIANAFVYFIRYGILD
FT                   WAPTYLAQVRNFSIKNSGWAYSLYEFSAIPGTLLAGWMSDKVFNGRRSETGIIFMTATL
FT                   IAIIIYWQLPENTPTLTTVLLAIIGFLIYGPVMLIGLHALDLAPKKAAGTAVGFTGLFG
FT                   YIGGSVTASAITGFVLQYFSWDVYFYLLMISCIFAITFIALTLKKEKNNKNK"
FT   gene            261831..262832
FT                   /gene="glpQ"
FT                   /locus_tag="BRE_242"
FT   CDS_pept        261831..262832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="BRE_242"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   periplasmic precursor (glycerophosphodiester
FT                   phosphodiesterase); lipoprotein"
FT                   /EC_number="3.1.4.46"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_242"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94493"
FT                   /db_xref="GOA:B5RR59"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR59"
FT                   /protein_id="ACH94493.1"
FT                   /translation="MKFKLIMFAISTVLIISCAKENAKINKKSALIIAHRGASGYLPEH
FT                   TLEAKAYAHALGADYIEQDIVLTKDDIPIVMHDPELDTTTNVAKLFPGRARENGKYYSV
FT                   DFTLAEIKSLSLSERFDPETQQPIYPNRFPATEYDFKIPTLEEEIKFIQGLNKSTGKNI
FT                   GIYPEIKKPLWHKQQGKDISKIVIDILNKYGYKSKEDKIYLQTFDFDEIKRIREELGYQ
FT                   GKLIMLVGENDWEEAPTDYEYIKSEEGMAEVAKYADGIGPWIPQIIINGQITGLISLAH
FT                   KYNMQVYPYTFRIDALPSYVKDPNELLELLFIKAKVDGLFTDFVDISIKFMQ"
FT   gene            262865..264427
FT                   /pseudo
FT                   /locus_tag="BRE_243"
FT                   /note="glycerol-3-phosphate dehydrogenase glpA"
FT   gene            complement(264527..265021)
FT                   /locus_tag="BRE_244"
FT   CDS_pept        complement(264527..265021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_244"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_244"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94494"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR60"
FT                   /protein_id="ACH94494.1"
FT                   /translation="MKIDNLVSGAFNLDLKDYKASKKKINSSKTNIFSAIFKSELVKED
FT                   KHLIVFENGEFNLELIKDMLAEINDIGEKLLSEPSRQNVIFYKKTIGEFLSVVLSNSIS
FT                   LKEQKGGRNGEFKRPKYRIIKIINEKLDKFAYSVLQNQISQFKLLSSLEEIQGLLVNLF
FT                   R"
FT   gene            complement(265011..265562)
FT                   /locus_tag="BRE_245"
FT   CDS_pept        complement(265011..265562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_245"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_245"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94495"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR61"
FT                   /protein_id="ACH94495.1"
FT                   /translation="MLNLLVIKRDRKVGSSLLSDEVKTIVGKGDFFKGELVSSNFIRVD
FT                   GDFLGTINSTKRVVIGDTGRVKSNINANEVVVSGIVFGNVHANNKIKVFQSGCIIGNIS
FT                   CKSIEVEEGAIIDGYMNVGIGSLNFSERDVLIYTGSYKVDENILIEVNKGMKWENRNKE
FT                   TCVRENDKYLFNDVRKMDED"
FT   gene            complement(265563..266588)
FT                   /locus_tag="BRE_246"
FT   CDS_pept        complement(265563..266588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_246"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_246"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94496"
FT                   /db_xref="GOA:B5RR62"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR62"
FT                   /protein_id="ACH94496.1"
FT                   /translation="MKDKRGFRILSFLKKLDRIFFTIFSSFFKFLSHVCSFFKQNISFM
FT                   IIPHVRGNVKNIKISFFTLFLFCVFFFVIFIGFIFLAVNYVTLKSIVNSTEKNYALAES
FT                   EIEDFRNTVVEINSVSNNFSKVLDELSSSLRIKENNVGLNRSKLDGDLADFIDLQMLEA
FT                   NSFKELNDLKNVKNTIEGSISPLKNIVRLLHSQNKLLNDIPSLWPIIKGNGIVSLHFGP
FT                   AIEPFTRQWYIHKGIDIAGVRIGTAIVAAADGEVVRASYQVTGYGNFVQIKHKYGLSTL
FT                   YAHMSRLNISKGSYVRKGQVIGFLGQTGYSTGPHLHYEVRIGSQVVNPDMYLNLATGAS
FT                   K"
FT   gene            266793..267392
FT                   /locus_tag="BRE_247"
FT   CDS_pept        266793..267392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_247"
FT                   /product="rdgB/HAM1 protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_247"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94497"
FT                   /db_xref="GOA:B5RR63"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR63"
FT                   /protein_id="ACH94497.1"
FT                   /translation="MKTLFFATSNINKINEVKQILDIPKIKIEIPQNFDIKETGKTFKE
FT                   NSLLKAKALFKILNNKQPVFSEDSGLCIEALNMEPGIYSKRYDQYKLGKKLDNNEKNHL
FT                   IIDLMREQNNRTAYFICVISYIDVDGTINNFEGMLKGTIALNIDYYQKNGFGYNPIFLT
FT                   TNNKRLSELNLEEKNKISHRGIAFDKFKKFLMQFLD"
FT   gene            267518..269287
FT                   /gene="pepF"
FT                   /locus_tag="BRE_248"
FT   CDS_pept        267518..269287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="BRE_248"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_248"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94498"
FT                   /db_xref="GOA:B5RR64"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR64"
FT                   /protein_id="ACH94498.1"
FT                   /translation="MIERNEINENDKWDLSSLFKDNEEYKNTVKQIRSKLQNFKKYETL
FT                   EFDLNTFKEAINYYYEIEEEIERTIYYTHIQLETDVSNQTSNELRAMNINLETEASNIT
FT                   SFFIPKILKIETTKIKEWLQDKELKDKKIAIEKILREKQHILSENEEKILANYTSLYSS
FT                   YSDIFSALTNADMEFGEINGQLLSNSTYTLFLQNENQEIRKQAFLKFYQEYKKHENTLA
FT                   NLLIADINKNKFLAKTRNFQDTISMKLFQNNIDKTVYTNLIETVNENLSVLHEYYEFRK
FT                   TILNQEYLNHYDVYVPLTKNIKFKHSFQEACDKILKSLEILGSEYIDVLRKGLLEERWV
FT                   DKYENKGKRAGAFSAGSYNGKPYILMNYKDESIRDMFTLAHEAGHSMHSYFSIKNNPFP
FT                   HYQYSIFEAEIASTVNEQILAEYLLENENDIEKIKYIKLNQIDDLLATFFRQTMFAEFE
FT                   YTIHEMINKNEPVVKETIKSIYLNLLTKYFGKSLKFDQKSSLECLRIPHFYSPFYVYQY
FT                   ATGITAALLIYKNIKNNKKDATKNYIDFLKTGGSKYPLDSLKVTGVDLNLKSTIQNTIN
FT                   IFKEHLDNVKKLF"
FT   gene            269302..270006
FT                   /locus_tag="BRE_249"
FT   CDS_pept        269302..270006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_249"
FT                   /product="Phosphatidylserine synthase"
FT                   /EC_number="2.7.8.24"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_249"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94499"
FT                   /db_xref="GOA:B5RR65"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR65"
FT                   /protein_id="ACH94499.1"
FT                   /translation="MIKINLILAWLVHILTASGLIVGFYSIIAIINTDYNLLIKLTILG
FT                   LLIDGIDGTLARKLKIKEVIPTINGELLDNIVDYINYTFIPTIFFYYSNFIQEKYKIII
FT                   CIGILLASAYQFSQLDAKTSDDYFRGFPSLWNFLIIFNVIFEINKNTNIIIILSCIAFS
FT                   FVPIKFIYPSKTKELKYITLPITIITSLLIILIIFIKLPDIYLTIGKTLIIIYCLYLIL
FT                   ASIYLTCKTKQK"
FT   gene            270017..270631
FT                   /gene="dedA"
FT                   /locus_tag="BRE_250"
FT   CDS_pept        270017..270631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="BRE_250"
FT                   /product="DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_250"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94500"
FT                   /db_xref="GOA:B5RR66"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR66"
FT                   /protein_id="ACH94500.1"
FT                   /translation="MYIILEFIDLNIAYAPIVFFVLLILAGLNIPISEDAIVIMGGILA
FT                   SRKNEYTILIFLGIFWGAYIGDIISFYIGRFLANKFLKQKTKTNNLLDKINYYYKHYGS
FT                   LTLLFGRFIPFGFRNAIFISAGMGNMHSSNFFIIDLFAAMISITTYFTLSFKIGESFNT
FT                   IFPKIRFILLIIFIIIIIIILILLRYILKKKKPKKVDKLFE"
FT   gene            270650..270733
FT                   /locus_tag="BRE_251"
FT   tRNA            270650..270733
FT                   /locus_tag="BRE_251"
FT                   /product="tRNA-Leu"
FT   gene            270831..273359
FT                   /gene="leuS"
FT                   /locus_tag="BRE_252"
FT   CDS_pept        270831..273359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BRE_252"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_252"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94501"
FT                   /db_xref="GOA:B5RR67"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR67"
FT                   /protein_id="ACH94501.1"
FT                   /translation="MSKYDFKKIEKKWQNYWDKHKTYKVNEDPNVPKEKRIYILDMFPY
FT                   PSANGLHVGHPEGYTATDILTRYKLLNGFNVLHPMGFDSFGLPAENYAIQTGKHPKKIT
FT                   EKNIEKFKEQIKALGFAYDWDREIKTHDVNYYKWTQWIFLQLYKKGLAYTKEIPVWYCP
FT                   DLGTVLANEEVIQTPDGPRSERGFHKVERKPLRQWLLKITKYAERLIRDLEEVDWPDSV
FT                   KEMQKNWIGKSTGVEIEFLIKESKEKIKVFTTRPDTIFGVTYLVLAPEHPMVDKITKDE
FT                   LKPIISKYKDKEILKSDLERTSLEKDKTGIFTGAYAINPITKEEIPIWIGSYILGTYGT
FT                   GAVMSVPAHDERDFEFAKKYNLPIKQVVSQTGTNEVLIKPFTENGISINTPTEFNNLKT
FT                   IEVKTKVIKWLIENKMGQEKVNYKLRDWIFSRQRYWGEPIPILFDDNLNEIPLNDDELP
FT                   LTLPDIENYKPSGTGESPLSKIKDWVNVKRNGKIYKRETNTMPQWAGSCWYYIRYLDPH
FT                   NEKEFANKEKINYWMPVDLYIGGAEHSVLHLLYARFWHKVLYDLGYVNIKEPFRKLINQ
FT                   GMITSFAYQDENGILIPNDEVEKKDNKFFSKKNNKELKQIIAKMSKSLKNIINPDDIIK
FT                   EYGADSMRIYEMFMGPLTDSKPWNTQGLIGIFRFLNKIWLIKNKELTNETPPKEIISEL
FT                   HKTIKKVTEDIETLNFNTAISTLMIFINELLKHEKNYLKIFRPISIILSPFAPHLGEEL
FT                   WEFMGEQSSIFKNAKWPKYDLNSIIDDTREIVLQVNGKTKDKIMIKKDTDEKTLKKIAF
FT                   NNQKIIQNINNKQIIKIITVKDKLVNIVAK"
FT   gene            273370..275637
FT                   /locus_tag="BRE_253"
FT   CDS_pept        273370..275637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_253"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="MICROBODIES_CTER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_253"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94502"
FT                   /db_xref="GOA:B5RR68"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR68"
FT                   /protein_id="ACH94502.1"
FT                   /translation="MDLATLGIKHKVFILTTFTLITIILGFFLKDIKFDSNILKLIPKN
FT                   AQIEQTLDIDKSSSLLSTIVMFKDKKNIFNKETFRKINEVANDIVNILKVTPNSVTSIF
FT                   TYFPQLKKDVYTDEDIINIKNKINATPFIKKLFLNDDETLIYFIIISTTDTKTNFSQSL
FT                   KNELEAMEDTIKRHETDTLKLYLTGDLVVREKILNYMADDFKLLGPFAAIVVIVSLYLI
FT                   VKNILGAIIPVLIAICALIWTFGIKSLFMSPITVPETTMIVLLISIGCANAVHIINGVL
FT                   KQINKNKPLTEIAIITTIKTLKTPIILTSLTTAFGFLSLITSSIQAYRTMGIFMSLGVI
FT                   IAMFMSLLVLPGILVKTPFKHNNKKNTHTFLEKLSLINQIITKWILNNKYISFIITVII
FT                   LLSSIIGLFKIEINFDEKDYFKENTSVKQTLNLMQKEIGGTSVIKIEINGTPGEFKNEQ
FT                   KMKNLDLITDNIDKFSYKTQSNSINGIIRLMNFKFKKENPKEYRLPENQAVLNKLILLI
FT                   SRSNSIKNMTNMYINNDWSQISIIIRTDQNSTEEIKQFADYASNVIDKYMPGHEYHFSG
FT                   AYDKIPISQTMVREQITNIITTLSAIAILLIIFFKSIKTGIIIAIPVAWSVFLNFAVMK
FT                   LFGITLNPATATIASVSMGIGVDYSIHFFNAFILNYQVTKDYKNALLESIPNVFNGIFA
FT                   NSISVGIGFLTLIFSTYKIIATLGAIIAFTMLTTSIASLTLLPLLIYIFKPTVKTISTI
FT                   KV"
FT   gene            complement(275700..278150)
FT                   /gene="lon-1"
FT                   /locus_tag="BRE_254"
FT   CDS_pept        complement(275700..278150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon-1"
FT                   /locus_tag="BRE_254"
FT                   /product="ATP-dependent protease LA"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_254"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94503"
FT                   /db_xref="GOA:B5RR69"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR69"
FT                   /protein_id="ACH94503.1"
FT                   /translation="MKSREIEYFMEEIKDTVSKEKKRSKNSGGILPHFDKPVRVPLIAV
FT                   PSHPVFPSMFIPIVIVSDIDMKAVDYVIKGNGIISLFVLRDKFLEKSGNNKDGKLTINY
FT                   QKDIYSVGVTAKIVKKINLPDGGYNIFVSTIDRVKFVKVVLNEDFPIIEVDYLKQIPIK
FT                   KYDVNLKAIYSSILLKTKEIFSHRKMPEFQLNMVNIEDKGRLCDVVAGMIASSKESHQE
FT                   VLETLSVKDRLKKVLELLYEELNLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAIKTEL
FT                   GVGDEKNSEFLKMKSKIDALALKGEALDAVGRELEKFSFLERHSSEYIVVRNYLELITN
FT                   LPWEDTKVDFDKFNLQSAEKILDKTHYGMREVKDRIIEYISVLKLRKSQKGAIMLLVGP
FT                   PGVGKTSIGAAIAEVLNTKFFRFSVGGIRDESEIKGHRRTYVGALPGKIIQGLRITKTN
FT                   SPVFLIDEIDKVSSSHYGDPFSVLLEVLDPEQNVNFRDHYLDLPFDISNVFFILTANSL
FT                   ETIPTPLLNRMEVIQLSGYVDDEKIEIARKYLIPKVLKENGVDKDSLKFQSSSLVQIAR
FT                   EYARDNGLRNFEKYLKQIVRKIARKLVEDKSVKAYQISKENLEEYIGIPVFRKEKFLDK
FT                   AMSPGMVMGLAWTNYGGSTLIIETVKTESKSPGIKLTGRLGDVMKESANIAFTYVNSIS
FT                   NELKVHKSFFEKYMIHLHIPEGATPKDGPSAGITIASAFISLALNKTVRPNLAMTGELS
FT                   LTGNVMAIGGLKAKIIAAKRNGVEHIIIPKANKVDLDDIPINIKNGINFHLVDSMKEVI
FT                   KLLF"
FT   gene            278219..278905
FT                   /locus_tag="BRE_255"
FT   CDS_pept        278219..278905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_255"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94504"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR70"
FT                   /protein_id="ACH94504.1"
FT                   /translation="MLFNKINAIITNLYHKKNYSLLNLFHSKGIIHTIIHDYTIEKFKL
FT                   NINNLVKANFEIVKKNNLCKIIEVNDEEFIVQDLTYEKLTIIKLWIKLINLSFDEGECF
FT                   KLFNEATEMLNNSSLGKTQLIDLQYKIRFLIIKGLLYLSNLCFQCNKQIKENYYYDTHI
FT                   YGFNCIKCSNNKNQYINTESFKYLENTTQTNINTTLNAKLTNRTKELLTFMIKNKLNRE
FT                   FEQILL"
FT   gene            278886..281045
FT                   /gene="recJ1"
FT                   /locus_tag="BRE_256"
FT   CDS_pept        278886..281045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ1"
FT                   /locus_tag="BRE_256"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_256"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94505"
FT                   /db_xref="GOA:B5RR71"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR71"
FT                   /protein_id="ACH94505.1"
FT                   /translation="MSKYYSKESKLEQEMKIWKKKKEIDIAEENIVNIKKKYNISLFEA
FT                   RLLLSREIKEEDFLFFLESSVNLMHNPFFLKNIDKFIYRINEAILEKENVLIFGDKDAD
FT                   GITATIIMYETLKDFGINVTYKIPSNGEFYGLTKEVIDKAFDDKITLIITVDCGISNIE
FT                   EINYARSKNIEVIITDHHLPNKEIDTENIIIDPHLKGDLYPFKEIAGCYVSFKACLALY
FT                   LSTTNFYNKDLIFMFLEKFENNIKLHAIEINNYILKKHITLDNNNDLQININQIEEFSQ
FT                   NKHIIVFNKIEQAQLLNEFFKQKIDIEIIDINENFIKKYPKHANKTLKELMQITKYFKY
FT                   RKINIYEKLYYMFYNIIFETNKNLLQNCLKRLKFVAIGTIADNMPIIDENRIAVKEGLK
FT                   EIALRENISINYLLKEVNILTKPIITSTDIAFKIAPILNSTGRLEKADITIRFLLSQDT
FT                   NKIENKFKEIKNINTLRKYKEDISWNTHNENTIFKNDKFIVCYDKNTPKGISSRMATRL
FT                   SSYYKKVAVFLTKQSDIIKGSIRSNNKVNSKELISMIPKHLIINSGGHKAAAGFTLYEN
FT                   VLNEFIRELENALKKIEYKELQEDSILIDAIIPQDLSKTELIKTIDLFEPYGHDFREFI
FT                   LMMENVCIQDIRTIDKNGTSKHISMKIINNIDYYKAIYFNGTQTIQELGIKDGQNIDII
FT                   FTISEDIYNQNDKILKIIDINKRKN"
FT   gene            281045..282001
FT                   /locus_tag="BRE_257"
FT   CDS_pept        281045..282001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_257"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_257"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94506"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR72"
FT                   /protein_id="ACH94506.1"
FT                   /translation="MHNIKKLLFIFTLAFIFIIGLFKVNAKNNDITKIYYKKETFQGGN
FT                   IYFISNKNFKKLSLLSTNQKPILSASPFKCNISNKDYYIALIGITPMIKEGKRKIQIEF
FT                   ENKQYIKEIEIKKFTFKKTTVKLNKSKSKLIKSQQSPKAKKQALTLWNIIGSIGDTTIY
FT                   HYDTFLHPIKDKYQITSPYGDQRIYMQDNQKISSQKIHNGKDYAPFKKEKTPIFAAGRG
FT                   KVVFARDREITGKTIIIQHLPGVFTIYLHLSKFGVKENTIVNTGEYIGNVGNTGISTGP
FT                   HLHFEIRINGIAVNPDFFLEEMLIDKNQIINNTKKIE"
FT   gene            282020..282229
FT                   /gene="rpsU_1"
FT                   /locus_tag="BRE_258"
FT   CDS_pept        282020..282229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU_1"
FT                   /locus_tag="BRE_258"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_258"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94507"
FT                   /db_xref="GOA:B5RR73"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR73"
FT                   /protein_id="ACH94507.1"
FT                   /translation="MVTVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIR
FT                   VKKEKAFKRKQAKKVRKLKQKIGK"
FT   gene            complement(282279..284630)
FT                   /gene="ftsK1"
FT                   /locus_tag="BRE_259"
FT   CDS_pept        complement(282279..284630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK1"
FT                   /locus_tag="BRE_259"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_259"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94508"
FT                   /db_xref="GOA:B5RR74"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR74"
FT                   /protein_id="ACH94508.1"
FT                   /translation="MKNFYRYFQFLFFFMLAVILFSLLVALTPIGNIFIFFVFNLIGQM
FT                   LLNTFSFLSFYLILYPLVNWYVYCNNMLSKKFIFNWNYTVILFFTLTFWLRINSNFESS
FT                   NFVNWFLSNFGIIVGNLFVCLLFILELIVWVYLNYVFFKDASFILTTFHFITFKLKILF
FT                   ENMFSYLPFLSTLKIKKDIKVYKDCENNVSSDSILNKEDNIINDEEYQALWSFKEFLRN
FT                   SNKSLDVDLDKTIFSKSEVMDDKLPKDESLQEVQCDLNTENNCQYKILRSECEDSRLVV
FT                   SGKIRASDIRHNGIINNIVRDEYENDTLFKVKSDENYSIDISVFAQREPENETEDVEYE
FT                   REIQKQAMLLQETFREFNINAKLIDIIRGPVVTMYAVRPDKGIKLSKITSISDNIALRL
FT                   AAVRVRIIAPIPGKEAVGIEIPNKRQKFILMSEIINSQEFQNDFKVPFALGKEISGNNV
FT                   VFDLVTAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVRLVLIDSKVVELKLFNNIP
FT                   HLLTPVITNVNRALEALRWCLDEMERRYVLLDNFFVRDINSYNKKIVEEGLNEVPLPYL
FT                   IIIIDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGVIKANFPSR
FT                   ISFMVASSMDSRIILGTSGAEKLLGKGDMLYVSPITPFPQRIQGGFLTEKEVYKLVEEV
FT                   KKFGTPNYIDDEIFIDSVVESDTLVINSSDESMFEEALEIVRSTKKASASYLQRRLKIG
FT                   YNRAARIIELMEEMGYIGPVNGSKPRDVFI"
FT   gene            complement(284645..285186)
FT                   /pseudo
FT                   /locus_tag="BRE_260"
FT                   /note="degradating bacA"
FT   gene            285661..287816
FT                   /pseudo
FT                   /locus_tag="BRE_261"
FT                   /note="degradating recJ"
FT   gene            287819..288775
FT                   /locus_tag="BRE_262"
FT   CDS_pept        287819..288775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_262"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_262"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94509"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR75"
FT                   /protein_id="ACH94509.1"
FT                   /translation="MHNIKKLLFIFTLAFIFIIGLFKVNAKNNDITKIYYKKETFQGGN
FT                   IYFISNKNFKKLSLLSTNQKPILSASPFKCNISNKDYYIALIGITPMIKEGKRKIQIEF
FT                   ENKQYIKEIEIKKFTFKKTTVKLNKSKSKLIKSQQSPKAKKQALTLWNIIGSIGDTTIY
FT                   HYDTFVHPIKDKYQITSPYGDQRIYMQDNQKISSQKIHNGKDYAPFKKEKTPIFAAGRG
FT                   KVVFARDREITGKTIIIQHLPGVFTIYLHLSKFGVKENTIVNTGEYIGNVGNTGISTGP
FT                   HLHFEIRINGIAVNPDFFLEEMLIDKNQIINNTKKIE"
FT   gene            288794..289003
FT                   /gene="rpsU_2"
FT                   /locus_tag="BRE_263"
FT   CDS_pept        288794..289003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU_2"
FT                   /locus_tag="BRE_263"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_263"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94510"
FT                   /db_xref="GOA:B5RR73"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR73"
FT                   /protein_id="ACH94510.1"
FT                   /translation="MVTVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIR
FT                   VKKEKAFKRKQAKKVRKLKQKIGK"
FT   gene            complement(289053..291404)
FT                   /gene="ftsK2"
FT                   /locus_tag="BRE_264"
FT   CDS_pept        complement(289053..291404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK2"
FT                   /locus_tag="BRE_264"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_264"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94511"
FT                   /db_xref="GOA:B5RR77"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR77"
FT                   /protein_id="ACH94511.1"
FT                   /translation="MKNFYRYFQFLFFFMLAVILFSLLVALTPIGNIFIFFVFNLIGQM
FT                   LLNTFSFLSFYLILYPLVNWYVYCNNMLSKKFIFNWNYTVILFFTLTFWLRINSDFEGS
FT                   NFVNWFLSNFGIIVGNLFVCLLFILELIVWVYLNYVFFKDASFILTTFHFITFKLKILF
FT                   ENMFSYLPFLSTLKIKKDIKVYKDCENNVSSDSILNKEDNIINDEEYQALWSFKEFLRN
FT                   SNKSLDVDLDKTIFSKSEVMDDKLPKDESLQEVQCDLNTENNCQYKILRSECEDSRLVV
FT                   SGKIRASDIRHNGIINNIVRDEYENDTLFKVKSDENYSIDISVFAQREPENETEDVEYE
FT                   REIQKQAMLLQETFREFNINAKLIDIIRGPVVTMYAVRPDKGIKLSKITSISDNIALRL
FT                   AAVRVRIIAPIPGKEAVGIEIPNKRRKFILISEIINSQEFQNDFKVPFALGKEISGNNV
FT                   VFDLVTAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVRLVLIDPKVVELKLFNNIP
FT                   HLLTPVITNVNRALEALRWCLDEMERRYVLLDNFFVRDINSYNKKIVEEGLNEVPLPYL
FT                   VIIIDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGVIKANFPSR
FT                   ISFMVASSMDSRIILGTSGAEKLLGKGDMLYVSPITPFPQRIQGGFLTEKEVYKLVEEV
FT                   KKFGTPNYIDDEIFIDSVVESDTLVINSSDEPMFEEALEIVRSTKKASASYLQRRLKIG
FT                   YNRAARIIELMEEMGYIGPVNGSKPRDVFI"
FT   gene            complement(291417..292217)
FT                   /gene="bacA"
FT                   /locus_tag="BRE_265"
FT   CDS_pept        complement(291417..292217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="BRE_265"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_265"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94512"
FT                   /db_xref="GOA:B5RR78"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RR78"
FT                   /protein_id="ACH94512.1"
FT                   /translation="MDNILRVIILGFVQGISEFLPISSSGHLLLLKKFMNIDLPIVFDI
FT                   YLHFATVLVVIIYYRRRILELVMVFIKFILRKSKMTELDSSNLNLILLILIITFFTALI
FT                   GIFIEKFKVLFTFKLVLFNFIVTSILLFLIEFRIKIFNFKKNIFFSGLLIGIMQGIGAM
FT                   PGISRSGITIFASILLGFSRTKSLEISFLSLIPIVFGSLFLKYNDLFKSDIIFNIFEIN
FT                   LGAIFAFIFGLFSISLFVKMLKNSKLYYFSIYLVSVVSLVYFLV"
FT   gene            complement(292231..294381)
FT                   /locus_tag="BRE_266"
FT   CDS_pept        complement(292231..294381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_266"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_266"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94513"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR79"
FT                   /protein_id="ACH94513.1"
FT                   /translation="MKKVMFKKIIYLFLLNLLSCSFVKESLSSNILKKSINSFDLNHLN
FT                   WLWNFDYVGQNFDKYFGIDSDSYVYVAYLFKKIGYDEKFREYMHKAINSNNNIASQFAG
FT                   VKLLEYYNSRREYYEAELVGRKLYNKYNDNKFIILGYFKSLYWQKKNNEALLVLNKLEK
FT                   MDFMQAQENENLLFKAVLYFNISDINTSLIYFKKLFENLPAEYLHVRAHDYLVLEGKDN
FT                   LLNSTFLSLVKFKSLVANGDFKGAVNILDDSFKKYYNNFVFLNDVYKTFVGLGYINKAL
FT                   SFFSNLDSVYKDYYLGLINLKLKKDIGFVTILKYLENSSIINEPYRLEMLNEIFRNFIF
FT                   MKNTRNYFSKNIANFYTSKDKGNFAFINVLDEYILEAVQLGDYDNLYLLYYNGQNVIDS
FT                   AVLARLAFLNARLIYHKFIKSQSVGEYRELLHSAIKYDQISYASFMSRYLLDQNINDLF
FT                   ENALDINYDQSDYERFLEGFLKFNLHSYVSVFVANDFKNGYRFSPNFYRNLYDEFVKHE
FT                   YYYESILAINYLVRQDFSALNKDDYKRLYPCLYTALIKSWSGKRELESSLVFSLIKAES
FT                   SFKRDAVSKPGAIGLMQIMPATSADVSREIKYYKYYPYDLKQPKDNVIIGTHYLRKRID
FT                   MLEDVYKALASYNGGIGNVRKWEKDYGHLPKEIFIEAIPFGQTRNYIKKILVYSVLYDA
FT                   LYERKGMDFIIEYIMGKFSKRF"
FT   gene            complement(294362..295567)
FT                   /locus_tag="BRE_267"
FT   CDS_pept        complement(294362..295567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_267"
FT                   /product="uncharacterized conserved protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_267"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94514"
FT                   /db_xref="GOA:B5RR80"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR80"
FT                   /protein_id="ACH94514.1"
FT                   /translation="MELLKGFLGIRLSSNEYFSVLSLDDTSVKKMVLGKLADETNIKLD
FT                   FYVSKYENFSNPIIIGSFFLDNLDKDSLNVNIYFKIDSMMLYVYGECDGITNKTKFDLS
FT                   LMSLSVNTNEVNGDSLNSDKMDDLPIDFQDTNRKESFDSIVEEKQDDSLDFDLSNVNDL
FT                   SNSKDLLLNKENDLDLVVDSLNLTNDMDEHALLSEGSKELDSESNVDLENLDFAPTKDK
FT                   LEDNPIEETEVAHVLDDIDQYSVNQGISTLDKVSIDVNERNDVFDNSENDVKSVKDKDD
FT                   NSSSFNVYVIQNSYSDDLSVEDIIADVSKNLDDVEFDDVSLDLGKDNFTVDVEEPKFDP
FT                   DLKEDRIQTSMLYLSLVSLFLLIFFSLFLIFSKILNPKNFTISYCSFYKEEKITRCEKS
FT                   NV"
FT   gene            295727..297130
FT                   /locus_tag="BRE_268"
FT   CDS_pept        295727..297130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_268"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_268"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94515"
FT                   /db_xref="GOA:B5RR81"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR81"
FT                   /protein_id="ACH94515.1"
FT                   /translation="MILGEVKVLPLFIILSSAAISVLVFILFRIAVLNTKTRTKGKHHK
FT                   TFHKTKKLISKAINILKTNPNEVGALQTLNDYYYTNKDFENGLKYVRKLCQLIEENPTN
FT                   KNIDSFKVFLSYGFYNLERNFNLEALGLLKKAYSLKKDDVDVNYYLGIAFLKNAHYKEA
FT                   LHYLTKIYQFDKSNNDVLKYIGMTLFYTGNYTKAVGIFNNIKKYIQNDVNALLAYAQSL
FT                   SQLNQDQLALDIANKIKSKDGMIYEALLIESEINAKNHNLVELEDNIKEMIKIKPDLPT
FT                   KISLKLFYKLGELYIEHENYKKATEAFTQVERIDPNYQKIAEKLEFSKKLNENLALRIY
FT                   LKSPKEKFDNLASAIILKLYKNKFQVRDKKINEITSQFIDINFQLSNNQWEENILVRFV
FT                   RTDQKNFGELFLKDLISKTKENKIKGLCIAPATFSEKAKQIIEGRLIDLIEGKKLTQIL
FT                   RTLDISKYI"
FT   gene            complement(297132..298400)
FT                   /locus_tag="BRE_269"
FT   CDS_pept        complement(297132..298400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_269"
FT                   /product="uncharacterized conserved protein"
FT                   /note="putative membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_269"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94516"
FT                   /db_xref="GOA:B5RR82"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR82"
FT                   /protein_id="ACH94516.1"
FT                   /translation="MIIPKKDQNVFKRKKNFLFNRAVKGDFELRDFGNIRNFNKKKRKN
FT                   CFCFFNVFTKFFYVFKLLFITLFGQIMDINNYKCRYSSKKVTFKMVNTYDVNLSYSVIY
FT                   NFIFKINVLVFVLILIFYLNIFAYYGSYVFLNKLSFPKDYFIDTFLYYSDQDLSQINNY
FT                   FFGLDASNYNATTIRKPFVLKVVEHKIKPGETLSHIASRYNITSETLISYNDIKDVRNI
FT                   KPNVIINVPNMKGILYTVGKNDSLSSIAKKYKIPKVDILDANNLDNEVLSLGQKLFVPG
FT                   GKMSKDLLRNALGETFLFPTRGIITSGYGYRPDPFTKTISFHNGIDIANVANTPVVATK
FT                   EGIVVTAGFSVGGYGKYIVIAHNNGFQTLYAHLGSFAVKVGDRVSRGQMIGRMGSTGYS
FT                   TGNHLHFTIFKDGKTSNPMKYLR"
FT   gene            298470..298973
FT                   /gene="lepB-3"
FT                   /locus_tag="BRE_270"
FT   CDS_pept        298470..298973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB-3"
FT                   /locus_tag="BRE_270"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_270"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94517"
FT                   /db_xref="GOA:B5RR83"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR83"
FT                   /protein_id="ACH94517.1"
FT                   /translation="MLQIHKQVLIPVTLAFILLITMIKMSLSFHLVKGSSMLPTILDQN
FT                   WIINHKLAYGIRIKNKETYVVLWSKPKKNETVLIKDPITKKISVKKIFAIPGEKFIKLQ
FT                   PNIISIHNLNFNINKEHLQKLKSIYIPKDYYLVVGDNKKVSLDSREYGFININDIIGKI
FT                   IYQL"
FT   gene            complement(299006..300514)
FT                   /gene="dnaK-1"
FT                   /locus_tag="BRE_271"
FT   CDS_pept        complement(299006..300514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK-1"
FT                   /locus_tag="BRE_271"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_271"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94518"
FT                   /db_xref="GOA:B5RR84"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR84"
FT                   /protein_id="ACH94518.1"
FT                   /translation="MMEKWIGIDLGTTNTVVSYFDVNSRVILNDRGERMTPSIVSFTDF
FT                   GVIVGSAAKHQILVNPAKTFYNFKVNMGTDVVYQVGDNIYKAEDIASHLLLNIKINAEK
FT                   FLGTQVSNAVITVPAYFSEIQRRGVVRAADIAGLKCRAILNEPTAAALSYAFEKQVEGL
FT                   FLVYDLGGGTFDVTLLEKQNDTYTVLASKGENRLGGNDFNEVVEKHVLASFKEEYPDIN
FT                   LDDIVLIEQLREKIEDAKKNLSTMDEVNIVLPFTDGNHLNYKLTRDEFNLMIWDFIDRT
FT                   ISLTNECITDSGVDLKHILKIVLSGGSTRIPLVKDRLNEVFPEIEILDSLNQDEVVATG
FT                   AGIHAFSLANNDTLIDFKDVTPYSLGIETCDDGFFTLIKRNTLLPVCERQIFTTTNDYQ
FT                   EEIEIHVLQGEYNKASLNCSISRFFFSNIQNALKGVPKIEILFRLDESGILSIAARDLD
FT                   INVSKSIKIRMTSASFDNNEKECLLISSGNIRAKEILEDKIELL"
FT   gene            complement(300511..301008)
FT                   /locus_tag="BRE_272"
FT   CDS_pept        complement(300511..301008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_272"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_272"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94519"
FT                   /db_xref="GOA:B5RR85"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR85"
FT                   /protein_id="ACH94519.1"
FT                   /translation="MFVVFCFILIIFTFIYFHVYISLKIKSNSILKKFKSEVDKTIIEI
FT                   NQATDRNISIIEIKIESLNRIIKEVDERIEILDQRLLGFNSHSISMVNNNFGIKSDSGS
FT                   YKGNLDYSIPTIEKNIIKEGYNIRRQVISLYEQGMSLEVIAKKLKLDLGEIELIISIHR
FT                   GI"
FT   gene            complement(301029..301340)
FT                   /locus_tag="BRE_273"
FT   CDS_pept        complement(301029..301340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_273"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_273"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94520"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR86"
FT                   /protein_id="ACH94520.1"
FT                   /translation="MDINISSEVTKIITQGAFKASEVSNETLRKKKVRETQHLSLNERE
FT                   DYHYDSEINVIFPIDELKDDNFNSVTISKVKHDDKNSSDLYDINLHDPKLGKNIDIER"
FT   gene            complement(301364..303262)
FT                   /locus_tag="BRE_274"
FT   CDS_pept        complement(301364..303262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_274"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_274"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94521"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR87"
FT                   /protein_id="ACH94521.1"
FT                   /translation="MTDIGDFADLREKIRRYLERENKVRLIEIEADTLEEALNDASLEL
FT                   SVPYKDLDYEILVRGNNGIFGYGEKKWRIVAYKNSYSKFGVLDVLSSQSESDESISLDG
FT                   KFFIRRSAKGVFLKVTPAQGGGSVVTFKDVMDKFASYSNIKNLDKNFVRTVVENASGEY
FT                   ERVSDFDAELAESVTMMVHISEDSMSVTIEFTTPGPNGAEVLEKDIFNILKKYGVVDKA
FT                   LLRNKIKEFVDYPFYGESIEMAKGVNSVKGRDAYVNFVVKSKYSAEYGAMGNEFRNVNK
FT                   GDELAEIVPLSRGIDGYTVFGKVLKAESGRELNLVLGENTLREGNKILAGCDGYIFIEN
FT                   GIIAVHNVYVVDGDVGPATGNIVNNGMVLIKGSILDGYNVMAKSGIEVNGLVGRCNLST
FT                   DGSIVLRSGANGKGGSGIYAKKSIKSKFLENVDVRCEGNIEVVRGIVNSVVSCTKKVLC
FT                   IGKKSKIVGSDIHAREEVRAYSIGSEGNAETAVCVGCDPEIKSLLSRFNEYLVKIEKRL
FT                   EVLTKDISALKKNIQITVDKAEKSLKIDSCNELINERDILILEIKMVKDKQESLQRALE
FT                   SSKTDGKIFVEYIAYSGVKLYIKDAYYELSRDYHNITFVEDDGIIKMVAYVPFESK"
FT   gene            complement(303265..303753)
FT                   /locus_tag="BRE_275"
FT   CDS_pept        complement(303265..303753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_275"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_275"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94522"
FT                   /db_xref="GOA:B5RR88"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR88"
FT                   /protein_id="ACH94522.1"
FT                   /translation="MLFGKKSKYVLLFSSFAFILAMILGIFARVSFLTVLFRAFLQFLI
FT                   FFAIGLLIEFIYNKYLYELFKDNDLSSNKDVINKNDNSQPEPNDIDSSLIKDFSSKNDK
FT                   VDNSNYDFSEDLNKYADVRDRQNNVNFESKLSEQISYVKNSDPKVVADTIKTLINKKE"
FT   gene            complement(303760..304650)
FT                   /gene="ylxH-1"
FT                   /locus_tag="BRE_276"
FT   CDS_pept        complement(303760..304650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylxH-1"
FT                   /locus_tag="BRE_276"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_276"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94523"
FT                   /db_xref="GOA:B5RR89"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR89"
FT                   /protein_id="ACH94523.1"
FT                   /translation="MMEDQAQSLRDIMRLNNKSSFVVDDKIQNNKTRFISVTSGKGGVG
FT                   KSNIAVGLALKYAHLGKKVLVFDADIGMANINILLGVIPKYNIYHMIVQGRCIQDVITK
FT                   TEYNIDLLAGASGTTELLDLSETEMNQFIKELLKVYEYDIVIIDTSAGISRQVISFLFS
FT                   SDDVVIVTTPEPTSITDAYGIIKVLSHKMENLKNLRLVVNRVANVSEGKIVAKKVVDIS
FT                   NQFLNLNVDYLGYVYEDQNIKNSVFKQRPFILLNPNSKASYCLDSIVAALEEITLDNKK
FT                   RRGVIGFISKFFGME"
FT   gene            complement(304660..305841)
FT                   /gene="flhF"
FT                   /locus_tag="BRE_277"
FT   CDS_pept        complement(304660..305841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BRE_277"
FT                   /product="flagellar-associated GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_277"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94524"
FT                   /db_xref="GOA:B5RR90"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR90"
FT                   /protein_id="ACH94524.1"
FT                   /translation="MKSNIMVQYFTERGPTYNEVIETVKRKYGKNARVMTYKTISHGGI
FT                   FGLFSRDWIEVSGYVRYDIGQQQINVEEEKRKILQSIKKEETSSIEDVIKEVKSLKNEL
FT                   AHKKEEINHPTILKIEDILRSNDFSESYIRDINNFIKKEFSLSDLDDYDKVKDSVIIYI
FT                   AKTIKCSGSLIDNLKKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKNLNIKIITIDNY
FT                   RIGAKKQIQTYGDIMGIPVKAIESFKDLKEEITQSKDFDLVLIDTIGKSPKDFMKLAEM
FT                   KELLNACGRDAEFHLAVSSTTKTSDIKEIFHQFSPFSYKTVIFTKLDETTCVGNLISLI
FT                   HEMRKEVSYVTDGQIVPHNISIAEPLTFIKKINGYRISDDVEFIRKLKSKSYY"
FT   gene            complement(305831..307918)
FT                   /gene="flhA"
FT                   /locus_tag="BRE_278"
FT   CDS_pept        complement(305831..307918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BRE_278"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_278"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94525"
FT                   /db_xref="GOA:B5RR91"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR91"
FT                   /protein_id="ACH94525.1"
FT                   /translation="MDLEKNSLLGYFGLNNKADLIVSVGLILIVAGFILPLPAFILDAL
FT                   IAINLMMSLLIILIVLYSKRPLDFSVFPTLLLVMTIFGLVLNISSTRLILIKGINFDGQ
FT                   MIRTFGTFVVGSSGTQGLVVGFIIFLIIIAVQFIVITKGATRVAEVAARFALDALPGKQ
FT                   MAIDSAYSSGNLTEEEATRQKNDLQSEVNFYGAMDGASKFVSGNVKVGFLITLINILGG
FT                   LIVGVTLQGLNFNDAINNYVSLTVGDGLVSQLPALLISTATGLIVTRSISKNSFGGEIF
FT                   EQFTSYAGIYWIVSGFLLFLAFLPGFPTLILILLSLLIGFFAYSLSNLSRDRELYEKQK
FT                   AEEQILSYADKEITPVVPLDPLALEIGYNLVPIVDDSKTSELLDRIVKIRREIALEFGI
FT                   VVPKIRIVDNMRLEPNEYSFKLRGVEIGHGEIKLGKFLVINVGLDSGLEGDLTKDPSFG
FT                   LPSIWVNDDVREIAEKLGYTVVDPPSIIATHMTELIKRHSYEILTRQDVQNILDVFKKD
FT                   YGAIVEEVLKDFSVGEIQRVLQGLLREQVSIRNLVTIFETIADFTNVTKDTFFLIEKCR
FT                   QAIGRQIVNVYLDSNLELNVITINPEFEQKIIDSRFEANNDLVSSLDPNLKSKFLYELF
FT                   VLVNEVQSQGYYPIILSSESARPVIRVLTSRELSDVVVISVLEVPKNVKVNVLKTVEVE
FT                   E"
FT   gene            complement(307931..309052)
FT                   /gene="flhB"
FT                   /locus_tag="BRE_279"
FT   CDS_pept        complement(307931..309052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BRE_279"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_279"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94526"
FT                   /db_xref="GOA:B5RR92"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR92"
FT                   /protein_id="ACH94526.1"
FT                   /translation="MNTRDEFLNKSWYIPLNFFASEDEGRTEVPTEQRKQKARREGQVL
FT                   KSIEINSSISLFILFAVFFFMLSYFAQELMDIFKWQASKLPEVMSISIYSLSFAYIRPL
FT                   FRYVSIFFIVSFIVGFLVNIMQVGFVMTLKPIMPKWDRINPNFSKWMKNSFGSVDAFFN
FT                   LFKSLLKIAIISFIYYIMLKSNIGKISKMPEYSLEGGISVILSLAYRICFFSVMVLMGL
FT                   SVLDYLFQRARYIENLKMTKEEIKQERKEMEGDPLLRSRMRERMREISNVNLRVAVPQA
FT                   DVVITNPEHFAVAIKWDSNTMLAPKVLAKGQDEIVFVIKQIARENNVSIVENKPLARDL
FT                   YANVDINEEIPREYWEIVSKILVKVYSIAKKFN"
FT   gene            complement(309049..309837)
FT                   /gene="fliR"
FT                   /locus_tag="BRE_280"
FT   CDS_pept        complement(309049..309837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="BRE_280"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_280"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94527"
FT                   /db_xref="GOA:B5RR93"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR93"
FT                   /protein_id="ACH94527.1"
FT                   /translation="MNMDFLILKSFVVLPIFIRIFIFLRFSPFFSTIKMGYLNFFFSLI
FT                   LSIIVVDKVNVVYPLNNLTAFVLILLGEAILGLIQAFFVSIIFNVFHLLGFFFSNQMGL
FT                   AYANIFDVFAEEDNLVISQIFTYLFLIVFLLNDFLFRFLVIGVYDSVLNVRVENMVNIK
FT                   NYEFIKLVFYSFAILFEKSLIMSLSILGVLLLLYLILGIISKTSPQINLLMISFAISLG
FT                   LGLIVLYITFPSFVISVKRVIELSLESMRNALNLFSETLR"
FT   gene            complement(309854..310117)
FT                   /gene="fliQ"
FT                   /locus_tag="BRE_281"
FT   CDS_pept        complement(309854..310117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="BRE_281"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_281"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94528"
FT                   /db_xref="GOA:B5RR94"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR94"
FT                   /protein_id="ACH94528.1"
FT                   /translation="MTTGQIIYLIKISIENIIILSAPILITALIVGLLVSIFQAVTSIQ
FT                   DQTLSFIPKIIIILLVLVIFGPWILKKIMQFTFLVFNQIQNM"
FT   gene            complement(310126..310890)
FT                   /gene="fliP"
FT                   /locus_tag="BRE_282"
FT   CDS_pept        complement(310126..310890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="BRE_282"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_282"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94529"
FT                   /db_xref="GOA:B5RR95"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR95"
FT                   /protein_id="ACH94529.1"
FT                   /translation="MNKKLSFLLLFGVVNFAFAQTKSLQPTTGLNFPFVDFLNSFGGGI
FT                   VFPLQLLLILSIITLSPAFLVLMTSFLRIAIVLDFIRRALSLQQSPPNQVIMGLALFLT
FT                   LFTMWPTFNIIYKDAYLPLRDSKINFNEFYDRGIAPLRNFMYKQMSNSRHEEIRLFMSI
FT                   SDYAKPKNFSEVPTHVLIASFILHELKVAFKMGILIFLPFIIIDIIVAAVLMAMGMIML
FT                   PPVIISLPFKLILFVMVDGWTLITSGLIKSFM"
FT   gene            complement(310900..311532)
FT                   /gene="fliZ"
FT                   /locus_tag="BRE_283"
FT   CDS_pept        complement(310900..311532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliZ"
FT                   /locus_tag="BRE_283"
FT                   /product="flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_283"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94530"
FT                   /db_xref="GOA:B5RR96"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR96"
FT                   /protein_id="ACH94530.1"
FT                   /translation="MNRLILFFTFIVFFAENLFAQDNESDLNVTSKLENEVNLPIFDDN
FT                   KVVLDNQDIQSISLFNVTDLFTLVLFFLFFVIFIFLFKKMILSYKKNKNNDMSSLIREL
FT                   AFYEIDNKNSIRIVNVLGNVYVFLVSNSSSIVLKEITTSEELENLEFQLNKIKSRGNIN
FT                   SFKSIFNKILRNNKKDKSFINDHDEYAELENDIETSLKSKQDRLKKF"
FT   gene            complement(311525..311869)
FT                   /gene="fliN"
FT                   /locus_tag="BRE_284"
FT   CDS_pept        complement(311525..311869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="BRE_284"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_284"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94531"
FT                   /db_xref="GOA:B5RR97"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR97"
FT                   /protein_id="ACH94531.1"
FT                   /translation="MDVDDKNDFSEEKPEIKGVKLPDLIDSLPEGVDPSNFGLLMDVSM
FT                   QVTVELGRTERKIKDILAMSEGTIITLDKLAGEPVDILVNGKIVAKGEVVVIDENFGVR
FT                   ITEIIKIKNE"
FT   gene            complement(311916..312974)
FT                   /gene="fliM"
FT                   /locus_tag="BRE_285"
FT   CDS_pept        complement(311916..312974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="BRE_285"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_285"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94532"
FT                   /db_xref="GOA:B5RR98"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR98"
FT                   /protein_id="ACH94532.1"
FT                   /translation="MAGNPGALSQDDIDSLLESINSSDNLSSDDSLSNIISSPMGKKQK
FT                   VKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFI
FT                   RSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIEQSV
FT                   MESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMVILVTLEVKIGKVEG
FT                   LMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDVLREKLEYTNMPLVAEIGEVKL
FT                   KVREILSLEKGDVINLENSSIDQDLILKVGTKEKFKCRMGLVGNKISVQITRKVGEVED
FT                   FDLLKELTEEVE"
FT   gene            complement(312994..313530)
FT                   /gene="fliL"
FT                   /locus_tag="BRE_286"
FT   CDS_pept        complement(312994..313530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="BRE_286"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_286"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94533"
FT                   /db_xref="GOA:B5RR99"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B5RR99"
FT                   /protein_id="ACH94533.1"
FT                   /translation="MPEKDDDSMDVVGGSDSKKIGLLPDVIIRILQILAIGLFTVVIMI
FT                   IVSYFVSKMVVSQSGAPNNFPIFSNEYLEKLPMLIWYESIDEIRGTTQDTPPKTFVIKL
FT                   ALGYAENNVNILSELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILRNG
FT                   EIKEIALTQIDIFDM"
FT   gene            complement(313574..314362)
FT                   /gene="motB"
FT                   /locus_tag="BRE_287"
FT   CDS_pept        complement(313574..314362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BRE_287"
FT                   /product="flagellar motor rotation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_287"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94534"
FT                   /db_xref="GOA:B5RRA0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA0"
FT                   /protein_id="ACH94534.1"
FT                   /translation="MIFKTKKKRSKCEDGGAPEYMVTYGDMVTLLLVFFVTMFSLNDVI
FT                   MKENVLKIMSASFTGSGFFKGGKTLDIDKLSYLSNSFMSLPSTAKNKQASQASKNKSII
FT                   EFVEKIQSNKVIVRRHERGVVVSLLADAFFDSASAEVKLDDNRDVIQKIASFIGFLDNQ
FT                   GYNFKIEGHTDNVDVNINGIWKSNWELSSARAVNMLEQILNYTDHSKIESIESKFEVSG
FT                   FAGSRPVATDDTPEGRAYNRRIDILITSDASLSFAKGIKQ"
FT   gene            complement(314362..315147)
FT                   /gene="motA"
FT                   /locus_tag="BRE_288"
FT   CDS_pept        complement(314362..315147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BRE_288"
FT                   /product="flagellar motor rotation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_288"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94535"
FT                   /db_xref="GOA:B5RRA1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA1"
FT                   /protein_id="ACH94535.1"
FT                   /translation="MNLASIIGWGVGFGAILISMAFTPTGLGVFWDLSSVFITIVGSFS
FT                   ALVASSEITIVKRIPTYLGFFFKRSSFSKIPIIKTLVELSEKARKEGLLSLDDELDQID
FT                   DIFFKSGMRLVVDGTDPEIIRTMLFLELEQMQERHKVGADLFGTWAKLAPAFGMIGTLI
FT                   GLIALLGNLEDRSALGSSMAVALVTTLYGTIMSNLMLTPIQLKLESIDLEEASVRAMIV
FT                   EGILSIQAGDNPRILEQKLVTFLTPKDRNQLGSGVLGGE"
FT   gene            complement(315144..315365)
FT                   /gene="flbD"
FT                   /locus_tag="BRE_289"
FT   CDS_pept        complement(315144..315365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbD"
FT                   /locus_tag="BRE_289"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_289"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94536"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA2"
FT                   /protein_id="ACH94536.1"
FT                   /translation="MIYVTKLNGDSYYLNPSHIESIEANPDTTILLMNSKKLVVKESVA
FT                   DVVNKIKMYRREIALLDRITQENKGVEL"
FT   gene            complement(315382..316707)
FT                   /gene="flgE"
FT                   /locus_tag="BRE_290"
FT   CDS_pept        complement(315382..316707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="BRE_290"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_290"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94537"
FT                   /db_xref="GOA:B5RRA3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA3"
FT                   /protein_id="ACH94537.1"
FT                   /translation="MMRSLYSGVSGLQNHQTRMDVVGNNISNVNTVGFKKGRVNFQDMI
FT                   SQSISGASRPTDGRGGVNPKQIGLGMTVATVDTIHTQGSFQSTQKASDLGISGNGFFIL
FT                   RDGDNSFYTRAGAFDVDSNRHLVNPANGMRIQGWMAESVGGEQVFNTSSDIRDLIIPIR
FT                   DKEGAKATEYITFACNLDKRLPIVQQGANEVDIARGTWVVNKTIYDSFGNTNVVELRVL
FT                   KDATAPNTWNATVLVNGEENSNFTMGFDNEGALLSLNGQAGQPGDLLEFPITFGVIDAN
FT                   AGEGGEQTVNLRLGTVGSYADSITQFADASTTKAIVQNGYGMGYMENYEIDQNGVITGV
FT                   YSNGIRRTIGKIALASFVNPGGLAKAGDTNFTETSNSGQARIGETGFAGLGTIRSGVLE
FT                   MANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKS"
FT   gene            complement(316712..317152)
FT                   /gene="flgD"
FT                   /locus_tag="BRE_291"
FT   CDS_pept        complement(316712..317152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="BRE_291"
FT                   /product="flagellar hook assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_291"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94538"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA4"
FT                   /protein_id="ACH94538.1"
FT                   /translation="MNTISNIDNLVNIGQSKKIVNAGLKRDRDIKESNLGRDDFLKLLL
FT                   TQLKYQDPTEPMKDKEFISQMAQFSALEQMTNMNKSFENLSSILGVNKDLNLLGKIVEF
FT                   ENVEGKIIKGKVTSVKAGVNPQIMIDGKYYVYSNVLSVGLEE"
FT   gene            complement(317165..318334)
FT                   /gene="flbC"
FT                   /locus_tag="BRE_292"
FT   CDS_pept        complement(317165..318334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbC"
FT                   /locus_tag="BRE_292"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_292"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94539"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA5"
FT                   /protein_id="ACH94539.1"
FT                   /translation="MSNLSKIIDVNLSKLNKNFNFINASLLSQDKKGGFADFISSEIQS
FT                   MSKLRISLLEFLKSNGLINKSSKNLSLNHSFVLEKFKDKDFMSDFKSLLKETGSLFDFE
FT                   SLKNLRENLSFDSEFVDRREMLSNVEKVLSELATLIGDLNFVFNADCFNIGTDFECGDL
FT                   GIIKKNTEKEKNLINIDVKNFKKNSGVKEFLNTNSRFRLVDNDNSVGKYALKETFDSSS
FT                   EFMDNLSGSSVKNIKEFFLSQIDDNLMSEWNLKVNRNIVNKAKIVLKSNDTGEIRLILK
FT                   PKKLGSIRINLNLDSNNNLLGKIIVDNHNVRTLFEQNMYSLNKMLSDNGFNSSLNLSLA
FT                   GSDLGFSSGSNFKDDFEGHRHSLKESQVFRIEDYVEFFSDLEENVNLIV"
FT   gene            complement(318338..318952)
FT                   /gene="flbB"
FT                   /locus_tag="BRE_293"
FT   CDS_pept        complement(318338..318952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbB"
FT                   /locus_tag="BRE_293"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_293"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94540"
FT                   /db_xref="GOA:B5RRA6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA6"
FT                   /protein_id="ACH94540.1"
FT                   /translation="MNNYLLFLFRFFLWLFLVIFFLGLSFFLTDLFGIYHTRDYLPKYI
FT                   RTLFFKDDEQLLDYTHISLDEIRMIKEKEAIYIKSQQVEKLREELKKREDNLNKLEAEL
FT                   NQKQKDLDLKQKLIDDIVNKYRDEDANFAQAALYLINMPPEDAVKRIEELNDEIAISYM
FT                   RKVEDIAKKEGRASIVPYWLSLMDSKKAAVLIRKMSVSALE"
FT   gene            complement(318945..319376)
FT                   /gene="flbA"
FT                   /locus_tag="BRE_294"
FT   CDS_pept        complement(318945..319376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbA"
FT                   /locus_tag="BRE_294"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_294"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94541"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA7"
FT                   /protein_id="ACH94541.1"
FT                   /translation="MNDLILKKKNFEKILTIRTYNRKFSENDLMNVNNKIVKIEEFLEG
FT                   IIKGLCKLNSADLFLKGNYLDYISLKQKEEIKKLEEFKREYNKYYDIYLKKYAEEKKVD
FT                   ILIKTLNNTIIKGKIRSEILSLDEYVNYKICKKLGKNNE"
FT   gene            complement(319373..320683)
FT                   /gene="fliI"
FT                   /locus_tag="BRE_295"
FT   CDS_pept        complement(319373..320683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="BRE_295"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_295"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94542"
FT                   /db_xref="GOA:B5RRA8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA8"
FT                   /protein_id="ACH94542.1"
FT                   /translation="MMDNFFEGYSNILDDIHTISFIGRVKKIKGLLLESLGPKCGIGDL
FT                   CLIEQSCGKKIYAEVLGFNGSCVSLMAYEGFDGIKVGDKVYSLNKKPQINLSDELLGRV
FT                   IDSLGRPIDNKGPFFGNNYKELSFSSINPLDRGVFTEQIVTGVRVLDGFLPVARGQRVG
FT                   IFSGAGVGKSTLLGMIAKNSKADVNVIAFIGERGRELNEFIKYELGNGCFNRSVLIVST
FT                   SDESPISRYKGAYTATLVAEHFRDCGMDVMLLFDSITRFANAKREISLSMGEPPATKGY
FT                   PPSVFVEIPILLERSGLNAKGSITGFYTVLVEGDDFSEPISDNMKAVLDGHIILDRDLS
FT                   DKGIYPSVNILNSTSRSLHRIVNFEKQKLISKIRNLLSIYKSYEDLIKTGIYVKGSNKE
FT                   VDLAIAKYPKIIDFLSQGMQEECDFENLDNEMREILA"
FT   gene            complement(320697..321623)
FT                   /gene="fliH"
FT                   /locus_tag="BRE_296"
FT   CDS_pept        complement(320697..321623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="BRE_296"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_296"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94543"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRA9"
FT                   /protein_id="ACH94543.1"
FT                   /translation="MYLPKVLYKSKEIVNAVKLEFVEIANPLFKSLEVKRKENEIFDVE
FT                   SRSVKLRNELETLMSQKAKLQEELEHEHELIKAEIDAECSKIFEKAREQANEIVSLANE
FT                   KAESLQKEAEDKKGAIERESNLEIQRIIKEHEEKLKRELEIETEKGRNEGYDDGFQKGR
FT                   EDFDKILGKLNGIISSLIAKRKEILESSGEHIMNLVMQIAVKVVKKIIDSQKGVVIENV
FT                   NEALKKIKSKTSIIIRVNLDDIDVVSHQKHEFISKFDFIENLEIVEDVNIGKGGCIIET
FT                   DFGEIDARISSQLDRIEERFKNFSSIF"
FT   gene            complement(321632..322666)
FT                   /gene="fliG-2"
FT                   /locus_tag="BRE_297"
FT   CDS_pept        complement(321632..322666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG-2"
FT                   /locus_tag="BRE_297"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_297"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94544"
FT                   /db_xref="GOA:B5RRB0"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB0"
FT                   /protein_id="ACH94544.1"
FT                   /translation="MEDQKEKEIFGVSTLTGKQKAAILLVSVGSDISSKIFKYLSQEEI
FT                   ESLTFEIARLDVVTSELKDSVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQKAVDI
FT                   INNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSLPTEI
FT                   QTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMADRKTE
FT                   KFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDRSIQRILREIDGQELAKALKSVDIPV
FT                   QEKIFKNMSKRAAGMLKEDMEFLGPTRRKDVEEAQQKIVSLIRKLEEQGEIVISRGGEE
FT                   DVLI"
FT   gene            complement(322682..324388)
FT                   /gene="fliF"
FT                   /locus_tag="BRE_298"
FT   CDS_pept        complement(322682..324388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="BRE_298"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_298"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94545"
FT                   /db_xref="GOA:B5RRB1"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB1"
FT                   /protein_id="ACH94545.1"
FT                   /translation="MNNFITKFFASISKKIKKATMVQKVAFGVIALFIILSLVFLVSFS
FT                   TRKQGIALFGISIKDQYLLDKIVQRLDRENAKYTITADGRIYLSDENMSKRIRAILVRE
FT                   ELIPMHMDPWSLFDIDRWTITDFERNINLRRSITRAVEQHIVALDDVDAVSINLVMPEK
FT                   ALFKESQESVRASVRITPKPGSDIATNRQKVEGLVKLIQYAVEGLEADNIVIVDNKGTI
FT                   LNDFSNLDGVDRIDLAEKERKLKLKYESMLRDEIDFALSKVLSSDRFMIARVNVTLDTS
FT                   KQTTESKEYAPIELEPQNPKVSYNTRKVSDSTLISSQVHKREYEGQGYSPWGPPGQEGN
FT                   TPPEYGDMSDIIGKSNEFKEIKNVALNEKKSLSEKEPARVSGISLGIFIDGIWDFVYDE
FT                   SGNFVMENGMRKREYKPISDETLKSITDVLQSSFEYKPERGDSITVRNIIFDRASEFRK
FT                   IDEDYFAGEKFKFLIFVVSIIIALLILIFTVFFIISRELERRRRLREEEFARQAHLRRQ
FT                   QALMDGDNIGIDNVVGGFREEDELQSNAEILAREKPEDVAKLIRTWIVKNV"
FT   gene            complement(324402..324731)
FT                   /gene="fliE"
FT                   /locus_tag="BRE_299"
FT   CDS_pept        complement(324402..324731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="BRE_299"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_299"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94546"
FT                   /db_xref="GOA:B5RRB2"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB2"
FT                   /protein_id="ACH94546.1"
FT                   /translation="MKVDSFFTDSNVYLIRKNPLHFDKSFSDFSVKSEKQAGTFRELFL
FT                   NLISNVNNSQLDMYKVSQQAILHPDSVDVHDVVISMAKANMNLSITKAVVEKSIKAYQD
FT                   VINIR"
FT   gene            complement(324747..325211)
FT                   /gene="flgC"
FT                   /locus_tag="BRE_300"
FT   CDS_pept        complement(324747..325211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="BRE_300"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_300"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94547"
FT                   /db_xref="GOA:B5RRB3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB3"
FT                   /protein_id="ACH94547.1"
FT                   /translation="MYMGLFSSINTASTGLTAQRLRLDVIANNIANVETTRTADGGAYR
FT                   RERIIFAPRVVSPYWKGPFVPDYLDNGVGQGVRVSGIEKDKSPLKLQYDPTHPDAIKSG
FT                   ELKGYVEFPNVNVVEEMVDMISASRAYEANSSVINSSKSMFRSALSILQN"
FT   gene            complement(325234..325641)
FT                   /gene="flgB"
FT                   /locus_tag="BRE_301"
FT   CDS_pept        complement(325234..325641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="BRE_301"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_301"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94548"
FT                   /db_xref="GOA:B5RRB4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB4"
FT                   /protein_id="ACH94548.1"
FT                   /translation="MDIFQRSVDLTHRYLDVLGLRQSVVADNIANVDTPNFKRSKVTFE
FT                   AELERAILNEKTNNLSLIRGNNKHLDGFKELGYLDVKPQRMLDHLSTLNNNGNNVDIDS
FT                   EMKSLVQNQMMYRLFTNIQAHHFKSVNIVIK"
FT   gene            complement(325674..327029)
FT                   /gene="hslU"
FT                   /locus_tag="BRE_302"
FT   CDS_pept        complement(325674..327029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="BRE_302"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_302"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94549"
FT                   /db_xref="GOA:B5RRB5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB5"
FT                   /protein_id="ACH94549.1"
FT                   /translation="MMNKIEDQSIVPREIVAELDKYIIGQSEAKKLVSIALVNRYIRSK
FT                   LPKEIRDDVMPKNIIMVGSTGVGKTEIARRLSKFIKAPFIKVEATKYTEVGYVGRDVES
FT                   MIRDLMSIAVNMVREEMYDSVKEEASKRAEDRIIDKLLKNSENSENDNITDEEKRVRDK
FT                   LRDKFRKQLRKGELDENLIDVYVSGKMPVSTIEIFSGGNLEEIDMSIGGLINNIFDRKK
FT                   RRELKIKKAREIIISEELEKLVDYENIVDIAKSRVENMGIVFIDEIDKIVTKNRTGNDV
FT                   SREGVQRDILPIVEGSKVNTRYGIVDTSHILFIAAGAFNLSKPSDLIPELQGRFPIKVE
FT                   LTSLSIDDFKNILKCTKNSLIKQYIAMFKVYNLTLTFTEEAIDRIAELTFNMNFEGENL
FT                   GARRLHGVMEKILADLFFEAPGSKLKKIEINLDYVDEKIKINEQKDLNYYII"
FT   gene            complement(327026..327568)
FT                   /gene="hslV"
FT                   /locus_tag="BRE_303"
FT   CDS_pept        complement(327026..327568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="BRE_303"
FT                   /product="heat shock protein"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_303"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94550"
FT                   /db_xref="GOA:B5RRB6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRB6"
FT                   /protein_id="ACH94550.1"
FT                   /translation="MNFKGTTVIAIRRAGKTVVAADGQVTFGYTVLKSNAVKIRKLVNG
FT                   KILAGFAGSTSDAITLFEKFEEKVKSREDGIIDIKRAAVDLAKDWRADKILHKLEAMML
FT                   VADSDNILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAADIAFKALKIA
FT                   ARVCIYTNSNIVLEEIG"
FT   gene            complement(327583..328525)
FT                   /pseudo
FT                   /locus_tag="BRE_304"
FT                   /note="pseudogene corresponding to smf protein in B.
FT                   duttonii"
FT   gene            complement(328531..329220)
FT                   /locus_tag="BRE_305"
FT   CDS_pept        complement(328531..329220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_305"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_305"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94551"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB7"
FT                   /protein_id="ACH94551.1"
FT                   /translation="MKRCVSVFLLLWVSCGDGAKEKSNLGLRIREVELSGGGSLEKVEV
FT                   YKEFIDREEKNVLKIINSIAKKARFFILIGLELIKLGQYLPAIEYLNKNLEYGPDNHLS
FT                   HFYIGVSSYNLAKGMQTQDKIEEYFTLAENSFLKSISLKDDFKEAIFALSTMYVYDLDK
FT                   QLEAKGYLSKLEFMGENYFEFLMLRGANYYSLGDFNNALLFYNKAKSKASTQEQIEGVS
FT                   KIINDFK"
FT   gene            complement(329221..330417)
FT                   /gene="ftsZ"
FT                   /locus_tag="BRE_306"
FT   CDS_pept        complement(329221..330417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="BRE_306"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_306"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94552"
FT                   /db_xref="GOA:B5RRB8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB8"
FT                   /protein_id="ACH94552.1"
FT                   /translation="MKDYNIIDSHSKRFDSATNPTVLKVIGAGGGGSNAVNRMIEYGVR
FT                   DVEFIVANTDLQALQTSIAPIKIALGAKVTAGLGAGGRPEIGQAAAEEDIDVIKNHLAG
FT                   ADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPFKFEGPKKMRLAEQGINNL
FT                   RKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGVQGIAGLIIEHGEVNIDFAD
FT                   VKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEEVRIEGSKGLLVNITGGEDFS
FT                   LLELEEIMGIITASVDDEATVIYGHAINSNLDDEIYVTVVATGFSAKKQKDLSGVVENN
FT                   TLSSKEFDSLMSGSQDASGVTYGANDNFIAKSKNVNYFEDDIDIPTFLRNLNKKNGDN"
FT   gene            complement(330438..331679)
FT                   /gene="ftsA"
FT                   /locus_tag="BRE_307"
FT   CDS_pept        complement(330438..331679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="BRE_307"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_307"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94553"
FT                   /db_xref="GOA:B5RRB9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRB9"
FT                   /protein_id="ACH94553.1"
FT                   /translation="MSRDLIVGLDVGTSKICTVVAEVNLNNQLEIVGIGTSISRGVRKG
FT                   VLINIEAALDSISNSIEAAELISGCDIATLSVSMSGSSIEGTNSRGVVAINSKTREIGD
FT                   EDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIITGSS
FT                   SSSQNLVRCVNRAGFSVDEVVLGSLASSYATLSKEEREMGVLFIDMGKGTTDIILYVDG
FT                   SPYYTGVIPIGANRVTLDIAQVWKVPEDVAENIKITAGVAHISALETQMESVIIPNLGT
FT                   RPPQEKSRKELAIIISSRLSEIFEMIKAEIVKRGLYNRINGGIVLTGGGVLFPGISNLT
FT                   EEIFKYSSRIGFPMNINGVGEEYIDPKFSSALGLVLYKHEQQKFNKLKKGNNKSKRQGK
FT                   ISSKLKGWFLKEWF"
FT   gene            complement(331679..332422)
FT                   /gene="divIB"
FT                   /locus_tag="BRE_308"
FT   CDS_pept        complement(331679..332422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="BRE_308"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_308"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94554"
FT                   /db_xref="GOA:B5RRC0"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC0"
FT                   /protein_id="ACH94554.1"
FT                   /translation="MGIYRKILIIYIYVIISFILLEIIFIIFISPYFLIRYISFNDDIH
FT                   ISKEDILSISGIKPNTYYYNADISIYEKNIMKDLRVKNVKIKLKFPNMISINIERRVPV
FT                   ATAYENINGSFVYYFIASDGVILEKSKDLIYDLPIISGLNLTGIEVGDFLEDGMLTIIK
FT                   NLNYVKINQNTLYNLISEINFLKLNFYDYKIILYIKNIYNKILIRMDMDLISVMHKVFM
FT                   ISNLLKKGFDIVDLRSGDIILLGEN"
FT   gene            complement(332454..333557)
FT                   /gene="ftsW"
FT                   /locus_tag="BRE_309"
FT   CDS_pept        complement(332454..333557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="BRE_309"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_309"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94555"
FT                   /db_xref="GOA:B5RRC1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC1"
FT                   /protein_id="ACH94555.1"
FT                   /translation="MGVMFVEKTSLRKCYFLVLFSLISYGLIVFYTSSFFLSLELTGDP
FT                   NFLFLMRLKYLVLSLIVFFIFDKISLDFLKKIVFVILFITFALVLATFFSPSVSGAQRW
FT                   IFFKGISIQPSEIFKVSFTIYLANYLSKFKLKANNYISYWLKPMLIFGIFWLLIILQND
FT                   YSTAIYFAILFFIVLFIAGMSLGYIFAILFTFIPIAMLFLLFEPYRVARIFAFLNPYDD
FT                   PLGKGYQIISSLNALKSGGLLGKGLGMGEMKLGRLPEANSDFIFSVLGEELGFFGIFFA
FT                   IVLFFLFFYFGYFVAIHAKTKFKFFLAFISSLAIFLQSIMNILIAIGLLPPTGINLPFF
FT                   SSGGSSIVVTMALSGLISNVSRDIEGT"
FT   gene            complement(333568..334623)
FT                   /gene="mraY"
FT                   /locus_tag="BRE_310"
FT   CDS_pept        complement(333568..334623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="BRE_310"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_310"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94556"
FT                   /db_xref="GOA:B5RRC2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRC2"
FT                   /protein_id="ACH94556.1"
FT                   /translation="MFCFLGLRLLKYITFRTAYATIFAFLLALIFGPFIISRLKKLKLD
FT                   QILRKDGPKHHLSEKMGIPTMGGVLIFFCVLVSLFFWIHFFNIYFLIVLFVMVSFACLG
FT                   FTDDLLKIKRKNSDGLNPKFKIYGQILFSFISVVMLYYFGGEHVSILYFPFFKSLKLDL
FT                   GILYIPFGMFVLISASNSFNLTDGLDGLAIGLSIVVIGALIIIAYLTSRVDFALYLNIP
FT                   NVKGCEELVIFLGALLGGSFGFLWFNAYPAKIMMGDTGSLSIGAVLGMVALILKSEILF
FT                   AILAGVFVVETLSVIIQVVVYKKTKKRVFKMAPLHHHFEELGWSEMQVVIRFWIIGLIF
FT                   AILALSTIKIR"
FT   gene            complement(334647..336044)
FT                   /gene="murF"
FT                   /locus_tag="BRE_311"
FT   CDS_pept        complement(334647..336044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BRE_311"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate-D-alanyl-D-alanine ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_311"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94557"
FT                   /db_xref="GOA:B5RRC3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC3"
FT                   /protein_id="ACH94557.1"
FT                   /translation="MMHIKIKDILDSLKDVKFIGDVSNVQKIVSFYSLDSREINVENSE
FT                   VSLYFAYKGDRVDGFFFVKYLIDIGVKCFVCSKDRELLCIEYLKKDKDLIFLLTTNVVT
FT                   CLQNLAAHFIKKTRFKRIAITGSNGKTTTKEMLYSILSERYKTCKTWGNLNSDIGLPLS
FT                   ILRTKGDEEYAVFEVGISYVGEMNIIAEILNPEIVIVTNVSYAHMQAFEDLKIVAYEKS
FT                   KIITKDTKMLILNESCPQYVYLEEIAKSVNPNINIFYFEFHNLQIRSFSFINDKFSYDF
FT                   TYKGCDYSILLPGKHNICNAISCINLALFLGLSENEIRNGLLHADFQKGRAELVRIKDY
FT                   LVLNDSYNGNLSSFMALKEMILDLEIKDKKIIVLGSFKELGKFAYEVHKTAIEEVVLMN
FT                   FDKIFLIGEEFQAVKRVDSLSSNSCLFYFNNFESFIDCFVNALESGCFIAIKGSRTNRL
FT                   ERVLDYL"
FT   gene            complement(336060..336341)
FT                   /locus_tag="BRE_312"
FT   CDS_pept        complement(336060..336341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_312"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_312"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94558"
FT                   /db_xref="GOA:B5RRC4"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC4"
FT                   /protein_id="ACH94558.1"
FT                   /translation="MSKIKRFEIGFYCLLILLLTIIVCLNIYFNFRYVVKLREFDELNN
FT                   EQNDIIDENLRLLTIIYELQSIDRIEDLSQNYLDLEKKDNKDINIIKR"
FT   gene            complement(336334..337227)
FT                   /locus_tag="BRE_313"
FT   CDS_pept        complement(336334..337227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_313"
FT                   /product="S-adenosyl-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_313"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94559"
FT                   /db_xref="GOA:B5RRC5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRC5"
FT                   /protein_id="ACH94559.1"
FT                   /translation="MGDIFHIPVLLEDVINLVETIYLDDGFVFVDCTLGEGGHSKAVLS
FT                   KYQNINVIGIERDDVVLNRAKESLVEFSKRISYSNTWFDDFFCKYSLHRRFNFILADLG
FT                   ISMFHYKVAGRGFSFLEDEKLDMRLFPSDGGISAYDIVNTFDKEMLENLIYELGGEYYS
FT                   RRIVKAILEYRKINKIQTSRELQRIICKAYPNVKFKINPATKTFQALRIYVNDELDRLK
FT                   RSLPLWIANLSKNGILAIITFHSLEDKIVKEFFKGLTKDKYCILTKKPITSSFKEKQYN
FT                   NASRSAKLRAVKKLYE"
FT   gene            complement(337220..338050)
FT                   /locus_tag="BRE_314"
FT   CDS_pept        complement(337220..338050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_314"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_314"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94560"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC6"
FT                   /protein_id="ACH94560.1"
FT                   /translation="MIIIFLFLFSISNLYSFLEFGKDEKFYLIDDFGEIKNDTLNIGIK
FT                   LRALDTHFSIFSNNYKVLYSKNKINEYDKSVLIIFDKDLNFNLEFFGDFIYKDDKVFLM
FT                   DNKNFDIVVVDQYNRQIINPLFVIKNRNNLNIISSFFVSELFLKSKDNIVFLLKENVDL
FT                   DLELGNYTLVLNFLKRDVAKESRILTGIYYFEVLLNNNSVFRIDFQSIYLNGNSYVVSG
FT                   NKNYNLNVFDLKKNNGSIKIDNLEFTNGSNEIKIKYGDVYNVENSLTYRFTLNG"
FT   gene            complement(338054..339142)
FT                   /locus_tag="BRE_315"
FT   CDS_pept        complement(338054..339142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_315"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_315"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94561"
FT                   /db_xref="GOA:B5RRC7"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC7"
FT                   /protein_id="ACH94561.1"
FT                   /translation="MGEDVINMHLYRESSTKFIKMRFFFLSIFLLIFIILVNSLLRVTI
FT                   DVSTSYKFNHFAKYDNLVEMFSNNNVFMQDQILNLDLNKYYYHVINDRLVSFSEYYYVL
FT                   GESQNNYSIYSKNTNKFLFSLSYKDLVFTKGDAIFALNNLYKTLEVYGEDGSQIFSFKF
FT                   VASILSVDYNDGVLVLGASDGNVYVYKHGNFIYSGDLLDLGLPIICVKLSLDNKYLCLL
FT                   RQNEFYSLEVINLDHGYNQVLSLKDLKIKDFNPFFKIDKFYNLFIKTFDSFLILNIKSG
FT                   KTFRINDENSVLQACYDSLSNTYRIYFYDLNSSIINIRTYSVNSYRLFDNIFFKDKVRS
FT                   YVEFDKGILYFNDKSDLKYLGL"
FT   gene            complement(339153..339911)
FT                   /locus_tag="BRE_316"
FT   CDS_pept        complement(339153..339911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_316"
FT                   /product="uncharacterized conserved protein"
FT                   /note="MULTICOPPER_OXIDASE1 motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_316"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94562"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC8"
FT                   /protein_id="ACH94562.1"
FT                   /translation="MDLVHNENYQKILFIDSLILQTLDEIKNVKKSGKVGVDSNKTVNF
FT                   INLNLNVLSYILSLNYFYTRPRLKVNYDFRTNLFSFISDFSLFVSPSLLISLSELVSNG
FT                   SVIKLNPEERFLIIRKLGYLIDLGMYFSKGDSKSIFLLEDIYLKFIILAKNFIDFKNLA
FT                   KNLVIDSPFYKSQLLHLTKSLELLEEGAFLLRSRYEANGAYGLTEQILNYIQAGKILAT
FT                   VTSQKEMAEKFSKFYEVWSVKFKSDLSKNK"
FT   gene            complement(339943..341529)
FT                   /gene="recN"
FT                   /locus_tag="BRE_317"
FT   CDS_pept        complement(339943..341529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="BRE_317"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_317"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94563"
FT                   /db_xref="GOA:B5RRC9"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRC9"
FT                   /protein_id="ACH94563.1"
FT                   /translation="MCHILIELFIKNLILIKKFYMRLNVGLFAFEDESDNIRGILLLSL
FT                   FYYLFGYKIKDDVISNEGCRDVLVAKFQASDEFRRCLFFRGILVKDLKTIIFDFVNVIL
FT                   GHYYVNDKPISIFVLNSIFNMEFKICFQNWEYLFLKNILDCLNILNDYVNLNIKLETYK
FT                   LEFKSYIRCLNSYYGFILKQKLYGDNIEKYEKTIKNELKSYKSIYNSILNLRNVLNLDD
FT                   NVCCLREIIKVICDAEYFLKVNICYFEFENCFKNFYYELEDIGHDYSGVCLGKACDENE
FT                   LELVDKRLYFFPCLNKKYGPNFKNVIVLVDKYSEIINLLLNIATFKLANEQKLNVLFEN
FT                   LQKLSFSISNIIKTVALKFASGVIEIFHKFNMRDVRFFVSVFEGKMNLATVGDLKFFIS
FT                   NYIALKVQSIMYRVASVGEILKTILTIQSVQSIDDNHIIVNGIDYAIESKFNVTLGKYL
FT                   KSLSQNMHIFIVTYLTNIANFLYFSKEKCIKREFVLKEVSLLFAYESVLGIVRMLYGNI
FT                   SNINFGYVVVF"
FT   gene            complement(341556..342455)
FT                   /locus_tag="BRE_318"
FT   CDS_pept        complement(341556..342455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_318"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_318"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94564"
FT                   /db_xref="GOA:B5RRD0"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD0"
FT                   /protein_id="ACH94564.1"
FT                   /translation="MILNEYLIRVSLKRFHIRRIMSSKVLIYVNYSNLDAEVLACEIQR
FT                   YLEFKYGVLSLFAGMNKSLCDISNKDNLIFAITLGGDGTVLLASSLLLKNDIDIPIISI
FT                   NLGKVGFLADIKPRDFKDVIDKFFNNSLVIHKKYLLCISAYEDGNNLFTKYALNDVIIR
FT                   SSILNKLIYVNLKVNSEDFLSYKSDGIIFATPTGSTGYSFSAGGAILESDLKAFILTPI
FT                   SPHSVYNRSFIFSSKSKLSLAFQKGYTLNSASIFVDGVNIGTFGVNIVFELKLDNKSLR
FT                   FASFCTDTFVRRLKNKLL"
FT   gene            complement(342388..342915)
FT                   /gene="cheW-1"
FT                   /locus_tag="BRE_319"
FT   CDS_pept        complement(342388..342915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-1"
FT                   /locus_tag="BRE_319"
FT                   /product="purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_319"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94565"
FT                   /db_xref="GOA:B5RRD1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD1"
FT                   /protein_id="ACH94565.1"
FT                   /translation="MFIKDKIMEKKSHLQVACFKIGKESYGVSIEHIREVIKVPLEGVY
FT                   AIPNVPDYITGIYNLRGNVIPLINLNIRFNIPSVYATEEDKLLVGYLIVNIQNKLLGIF
FT                   VDKVLKVISFDVSRIQEPPATLQTFDKKYISGVVKIEKEENFESEYLILIDIERIFDKS
FT                   EFEKIPYKENNE"
FT   gene            complement(342956..343537)
FT                   /gene="ftsJ"
FT                   /locus_tag="BRE_320"
FT   CDS_pept        complement(342956..343537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="BRE_320"
FT                   /product="ribosomal RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_320"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94566"
FT                   /db_xref="GOA:B5RRD2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRD2"
FT                   /protein_id="ACH94566.1"
FT                   /translation="MYNVFDEYSQKAKNEGYLARSVYKLIEIDKKFSLFSSGNILDIGA
FT                   SPGSFSQYAYANLKNGVLVAVDLNDVNLNFTSNFYFIKGNIYLDEVYQKIKIFSPYSLI
FT                   VSDAAPSTTGNRLVDTSNSFNLNIRIFELACESLMRGGNLLIKVFQGGEEEQIFYKLKS
FT                   CFRVVKKVRPKAVRKNSFEIYFLAKDFAKL"
FT   gene            343590..344636
FT                   /gene="ispB"
FT                   /locus_tag="BRE_321"
FT   CDS_pept        343590..344636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="BRE_321"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_321"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94567"
FT                   /db_xref="GOA:B5RRD3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD3"
FT                   /protein_id="ACH94567.1"
FT                   /translation="MQNKSFLDKIEKNINNIFSKDYFLNLFTDKNLKLTLNIQESTINA
FT                   IQAPVIEIINRGGKKIRPMLMILLAHALGYNNSDTENLYKLSMLLELPHSGSLIIDDIE
FT                   DGALKRRGKPSIHLIYGLDNSINTANLIYFLPAKLIQTSNLKTSQKLIIYENFFTTLSN
FT                   LHLGQGIDITLHNGTYIPSIEEYISLVEHKTSSLFGMAGFLAGILTNNENKAKNLYNTF
FT                   LNIGTYFQMIDDIKNIKDGVKGKDFGDDLIEGKKSLPIIYFLREKNFDNKIIHELAKIK
FT                   NQPIDKVKEKILQFSNMINSSNAIQNSSILATSYLNKFIEELNSYKLINKYKDMIIKLV
FT                   TKIKEDNQ"
FT   gene            344633..345301
FT                   /locus_tag="BRE_322"
FT   CDS_pept        344633..345301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_322"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_322"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD4"
FT                   /protein_id="ACH94568.1"
FT                   /translation="MKKYTIILIWFNIITTIHATISTKDVSINKIEELYTKSILLKEFK
FT                   KYNQSKALLMQIINQDPKQVDAYLLLSELEYLMNNWLKAIKQTNNYLHIIDFQDTKNYL
FT                   DISWAYFLIGELGNSMDYIMQFIQDNKELLNSNIYVLIDTILKKGFYHLMQDEDLMFNI
FT                   IMNTIFQIETHDDTIFTIFLNNLDVIKQIPFYEFNKTKIEDLELQIKTLKNLKNENNNL
FT                   "
FT   gene            complement(345298..346104)
FT                   /locus_tag="BRE_323"
FT   CDS_pept        complement(345298..346104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_323"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_323"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94569"
FT                   /db_xref="GOA:B5RRD5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD5"
FT                   /protein_id="ACH94569.1"
FT                   /translation="MFSIFLHSIIFAYLALGILYTERVGLLNISIEGISFLSVFLTSLF
FT                   IYWGYGIFISVIMTICISLLFGCFLSFIAINGYNIFITGIGINILCNFLVRILMRANFN
FT                   FIPGFSLNISNNIAIIFFVIFFFTFLSFSIYVINYSKVRVVFEFIRSNDYENVLGEQTS
FT                   NYFKSFAIFVSVISASVAGSLLAINFNVYSYDLGLNNGWLAICILYIAFANPWLILPSS
FT                   FFMVFIEYKFFNLQDYVNSYFALSLPFYMAILINVFAAFFRKTKLF"
FT   gene            complement(346105..347037)
FT                   /locus_tag="BRE_324"
FT   CDS_pept        complement(346105..347037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_324"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_324"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94570"
FT                   /db_xref="GOA:B5RRD6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD6"
FT                   /protein_id="ACH94570.1"
FT                   /translation="MNTFRKEYILFMFSFSALCISYFFDGFFSFSYIKVILWNFMLLLL
FT                   VATGISTCAKSNSLTLGDEGQVYFGAFLSYVFCDFCGLTYFNFILIMFLSSLLVGLLGI
FT                   IPFLLTFFCGVNGMLTGLLMSYGNQRLVDGFISKLLSSNELLSQTKSINKIFARDVALP
FT                   YLLVFSLLIWGCYVFIHKRTILGLKLEILSDRKTLSKFFSINEFKYKFCTVFTSAFLNG
FT                   LVGAIFVIFFKNYLFLSLTSGLGWNGFVVAVVSGFNYIYVLCFSLFFAMLNEFNNYLKI
FT                   NYSFKYEFIGLYQAISVFIALFFINTGKK"
FT   gene            complement(347034..348491)
FT                   /gene="mglA-1"
FT                   /locus_tag="BRE_325"
FT   CDS_pept        complement(347034..348491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglA-1"
FT                   /locus_tag="BRE_325"
FT                   /product="methylgalactoside ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_325"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94571"
FT                   /db_xref="GOA:B5RRD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD7"
FT                   /protein_id="ACH94571.1"
FT                   /translation="MVEFKNIVKYFPDIERPILNSVNLRIEESKILTVIGRNGEGKSTL
FT                   SKIIAGLVRFDSGEVFVNNIKQKNWNVDVAKNNGIYIVSQIPKLDMNLKVWEYLSIYWF
FT                   DSKFFMPMNRSATYRYYKWLKQFYNIIFDLETRIQDLNIKEIYFLLIMSSLKKNAKIII
FT                   FDESVAYFSQKEAKEFIKLLQDLRKIGITSLFITHREISDAIKFSDEFIILQEGKCFRT
FT                   TNKEIILNKLEIPSGKFIAVNSKRGEQNEEFIKFSLFFEDFWKYDINFSLKKRGILGIV
FT                   AEEAAIKTWEKLFLGKIPFVGCIKMNGHRYENVDFNELKAGFLPLGIGNLFPDNITILD
FT                   SFLSKIMSFENEIFIKKSTINKLKKFFKNDMEYCDSKILKTFYSKSVAFSGGTLKKLAL
FT                   FREKYITKSFLICFSPLSNLDYRAYIETSNFIRNFSNEKPVLLITPNLDELLFLSDDIL
FT                   AIKTGEVVLRLKREYVDKSTLKEMLFV"
FT   gene            complement(348495..349568)
FT                   /gene="tpn38b"
FT                   /locus_tag="BRE_326"
FT   CDS_pept        complement(348495..349568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn38b"
FT                   /locus_tag="BRE_326"
FT                   /product="exported protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_326"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94572"
FT                   /db_xref="GOA:B5RRD8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD8"
FT                   /protein_id="ACH94572.1"
FT                   /translation="MYFMRKRCFVFVSKSFFFRIFWIVISLICLFLFVYINFFKARGLK
FT                   FSSNRKIALFIPGSITGSPSYKAMYDCLIEFQNSRSDIDIELFESGFNQHEWIELLEKL
FT                   LNSKNYDFLITTNNVMQGIIDKVSRNYPYTKFLLFDSLVKNTNPQVYSLSYNVAEEAYL
FT                   LGYYVGLFLKDSNLANQNVALIAGQEYPVMNNYIFPYFKNGIKEVLDSEVFFRTLGNWH
FT                   DSNRVKVLTESLILDSKVSVILPIVGAAIKGVLSAVRKHGVFVVLFDGEDYLDNKENII
FT                   GSGITNQRLFLEEVLSKAIKDEIQYGTYRVLGFKDKGVSFNLLNKFYLESIGLDLKEKL
FT                   EEKMREMNDTEIKINLE"
FT   gene            complement(349968..351059)
FT                   /locus_tag="BRE_327"
FT   CDS_pept        complement(349968..351059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_327"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_327"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94573"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRD9"
FT                   /protein_id="ACH94573.1"
FT                   /translation="MVLKLYIIILLFLSSQVILFSQVASIKEMEGQINVIRNAVYVKLN
FT                   LGDEIFEYDFIDVGSNSKLKISLYGINGIESDLTLHSNTYSLICYSSLKDMQDAKIYLF
FT                   KGSLDVTIYKIVQGSSFSVDINNYFFKTDAPAKFYVNCEYFNNYFVSVFDGILNHYNKD
FT                   TYWISTNTSILLWNNNSFLYKTDDAVPQNVIQNLKEMSRKNFISLNNKHSAYVFSKYVE
FT                   DSFRFDFVYDYLVRDPKFNVIYSKWSLEDKNYTLGNRVDMINDVNYLRGRVGILFKNFV
FT                   YLANVFFFIEDIVNHTSDMFDKVIIYGSVLKFFENYKQNRSSLAKKFFKTIHSFKMYLV
FT                   RTNGDLPSNLSVNEFYLLTPREF"
FT   gene            351560..352681
FT                   /locus_tag="BRE_328"
FT   CDS_pept        351560..352681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_328"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_328"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94574"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE0"
FT                   /protein_id="ACH94574.1"
FT                   /translation="MIKKSKLLFLMLFVFAISLISCNSTPEDQQNDNSKISIKETGDIK
FT                   RDIEEMKNGVIRERGNLFYSKEFNEAEKLEKEMNSKFSKGIIQEGNELAIKVLERYRNI
FT                   VRDTIEKKEKINYLKENIEKYLNDAEVNEAYIWIPLEIDEVNNLYFEATRKYKIYDIES
FT                   ALGMYSKAFTKAQQTAKKAKEARALKETEERMYKQLKALEAASNLPIYSNNKLIKPSPW
FT                   NGRSLIQDKGERVNLLNLQDNTYLLGQIDAIVLPYEEKVEEVKNTEANKFKTLQLIEKA
FT                   RQLWEQGLKAKNLNNLRLANELFLDSARYLKAYQSHSSKELYIIKIGNTLWGISKKLYN
FT                   DPYLWPKIWFANRQKIQNPDLILENWKIIIPSK"
FT   gene            352775..353137
FT                   /locus_tag="BRE_329"
FT   CDS_pept        352775..353137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_329"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_329"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94575"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE1"
FT                   /protein_id="ACH94575.1"
FT                   /translation="MNKLILPLTILLVSCYTIAHLDDQLTEKTSHRIYLKEAQKAKNIN
FT                   DYQTALKIYEKMIQNYKENKEIVATGKYEIAFIYYVNNKKETAKKLFEELIQSNIETPK
FT                   WVIPLSQKILQKIKTQ"
FT   gene            complement(353171..354286)
FT                   /locus_tag="BRE_330"
FT   CDS_pept        complement(353171..354286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_330"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_330"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94576"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE2"
FT                   /protein_id="ACH94576.1"
FT                   /translation="MRKACFIIFLFIVFNLFSESHDHLSINIDDVYVEAHDDGFHLFIR
FT                   KKPNIKSVILTESFEIPDKNKDASTYSFRTLEYNNINGDEIRILNGRVIQNRSLLSLTS
FT                   STPVQNKRFGEAFHILIPKKLRYGFPNFSTRSGDIDLEILKRNKEPFWFSIRTFEKKYN
FT                   DYLGQYKDNAYELFFGDTQRENIVENSVLEEGFSRFADDVVTANKGLDIVDKIKDILEK
FT                   SEDPLVDLDLVFVIDVTDSMKNHIEILREHLLDMVEPQLNQFKSYRIGFVFYKDYLEDF
FT                   LTRSFDFNSKKYLHNILESINVGGGGDYPEAVFEGVNAAVTQFDWKSDNRFIIVLGNAP
FT                   PHEYPRGPIVYEDVIRAAKEKDITIYGILLK"
FT   gene            complement(354350..357205)
FT                   /locus_tag="BRE_331"
FT   CDS_pept        complement(354350..357205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_331"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_331"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94577"
FT                   /db_xref="GOA:B5RRE3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE3"
FT                   /protein_id="ACH94577.1"
FT                   /translation="MPDIEKINKFKKEIIDNIADEKARKDSFGIKMDIDPPKDGESILP
FT                   WEEQEEVVDFDEEHDEGPDLDAILGVLDNEEGQKSEASENDINLLKNSENVEIDSEFDN
FT                   LNEDFDVLGSHFEETLDKVLDDNSVSLDDAINLNLDNSGNNVDDDDNVQNSNVENSLNS
FT                   NSSDFENPFENDDSSTQESQDYNNDDFDLEYMISKIKEADDEISSNKFDSSDDSLDPNT
FT                   KEEKDWSNLTGDFQSLKDQENKIFEDSDFKVNYSLFFKHLDSYPRNLRIAIAEALMLEN
FT                   VSKYKIEALVDLVEQNKKGLNFIAKFVGDIIGRSVKLPIMYYKAEEFSKLEKQFSYRLS
FT                   KALTPILKIASFFIVLTFLSFYFLVDIMFFYIASDKKYKEGISYIYENKRELAKATFKD
FT                   AYYMRPNRKWFLTYAKAFESIKDFDSAEEKYEELFTVDPFSEGASKRRRKIFDKDGYIS
FT                   YAFMKMRLGEYSDANSILDEVISYDIYDYEALMAKGENYFQWAQVDPMYYRNSINDYTI
FT                   LLSKYGYHKKEVLFKLFDAYIEAGAEREADNVNAFIKTNQELDIDEVVYTKYVKKLIDK
FT                   YVEFTVYNKRINALSRNLKYLNAQMNLLNKEFSNFKINSGKSVSDILNDVNLNSEIEYI
FT                   LRRILLKNPDYNKALFESGRYFYYMGDLKKSEGYLLTAINGFRQEDSINNASEKIIAYR
FT                   ILSDIYEKGNDTLKASNIVSLALNEYDFYKRNGLIKGSRELALIYEKQGDIFKTLNGFQ
FT                   SAISSYKMAINEGVNSPDVYYKLALLSYKENNYKDALTSLFKVENMSGFANSNKVLNSI
FT                   ASVLYKMGDFEASRSYYLRVLQNLESEKSSIVSLRPKGNDHHKALLLREIEVYNNLGVV
FT                   EIIASLGNKIKSGVIIDHDLFDSGIANLTESSRIFDLLNRDEDMMKNVKRDLASLNLRS
FT                   VFKNDFTGLKILFYDNLADNL"
FT   gene            complement(357220..358113)
FT                   /locus_tag="BRE_332"
FT   CDS_pept        complement(357220..358113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_332"
FT                   /product="glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_332"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94578"
FT                   /db_xref="GOA:B5RRE4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE4"
FT                   /protein_id="ACH94578.1"
FT                   /translation="MFIRNKSFNKYFKGIENEFFSRFKDIENINCLNSSYHEADSVSRK
FT                   LIDTMIERLLKSNSTIVGIQNILKLYEKSKSGKSSIILMEHYSNFDFPCFQFLLEKMNC
FT                   KEISEYVVPIAGVKLFKDNLLIKSLSLGYNVIFIYPPHAFVDVDSKTMRERRVFNANSM
FT                   RYVADKKNSGYIILIFPTATRYRKGKPETKKIISEISNYFKIFDYFIMVGINGNILEVS
FT                   SNDDMSCDIFREDVLVYNITEVLDIVEYKTLILEKLKKEGLEPTKEILGSKIADDLEKR
FT                   FEILHKDGAKIYNDLI"
FT   gene            358312..359896
FT                   /pseudo
FT                   /locus_tag="BRE_333"
FT                   /note="oligopeptide transport system substrate-binding
FT                   protein oppA"
FT   gene            360242..361915
FT                   /gene="oppA-2"
FT                   /locus_tag="BRE_334"
FT   CDS_pept        360242..361915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA-2"
FT                   /locus_tag="BRE_334"
FT                   /product="oligopeptide ABC transporter, periplasmic
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_334"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94579"
FT                   /db_xref="GOA:B5RRE5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE5"
FT                   /protein_id="ACH94579.1"
FT                   /translation="MSKNHLKLLIISAKIELKLIKVIKLNKEIKMQIKKITFIIFFLIT
FT                   ILSCSKESNKENVSFKIAIGGEPKSIDPQLAEDKMGATIILQMFNGIVIGDPKTGGYKP
FT                   GLAESWDISQDGTVYTFNLRKNLVWSDGVPITAEGIRKSYLRILNKETASNYVALVKST
FT                   IKNGEDYFEGKISESELGIKAIDDLTLEISITSPKSYFLDMLVHQSFIPVPVHVIEKHG
FT                   NKWTDPENMVVSGAYKLTERTPNEKISLTKNDYYFNAKNIEVQELIFYTINDASTAYRM
FT                   YKNNEIDAVFAIIPSDLIKEIELRNDYYSSPINGLYYYSFNTHIKPLDNVKIREALTLA
FT                   IDRQTLTSKIIKNGAIPTRNVSPKFNNYSYKKSLELFNPQKAKQLMSEAGYPDGKGFPT
FT                   LKIKYNTNENHKKIAEFIQNQWLKILKINIELTNEEWASFLDNKQKGNYEIARSGWIGD
FT                   YADPSTFLTLFQKGLSNFSSYNYFNEEYENLMKQSNFEQDPIKRQDILREAESIIIEKD
FT                   FPIAPIYIYAGNYLFKNDKWTGWEPNIAERFDFSQLKLIK"
FT   gene            362280..363200
FT                   /gene="oppB-1"
FT                   /locus_tag="BRE_335"
FT   CDS_pept        362280..363200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB-1"
FT                   /locus_tag="BRE_335"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="Possible lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_335"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94580"
FT                   /db_xref="GOA:B5RRE6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE6"
FT                   /protein_id="ACH94580.1"
FT                   /translation="MLRFSIQKLLETLPTLIIIIFLCFLIMRLAPGNPFDSEKPIDPQV
FT                   KEKLMQKYHLDKPFYMQAYYYIKNILKGDFGPSIAKKDLSVNQYIKLGFPKSFTIGIIS
FT                   LIISLTLGIVLGSLAAINKNTHIDYIIRMAAIFGISVPTFITGPILQYILSVKLKLFYT
FT                   SGWISERGGLANLIMPILTMSLPWIAIFTRIIRGSMLEILNSDFVRTAKAKGLSFNVII
FT                   RKHVLIGAILPIVSYIGPAFAGIISGSMVIEQIFRIAGMGIFTIEASLNRDYPLLMGSL
FT                   LVYSAILLISILASDIIYKKLDPRI"
FT   gene            363184..364269
FT                   /gene="oppC-1"
FT                   /locus_tag="BRE_336"
FT   CDS_pept        363184..364269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC-1"
FT                   /locus_tag="BRE_336"
FT                   /product="oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_336"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94581"
FT                   /db_xref="GOA:B5RRE7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE7"
FT                   /protein_id="ACH94581.1"
FT                   /translation="MIQEYRRTNQMSNIKQNTCVNIDTQTANKRAWLRFKENKLAYISI
FT                   FVIGFYMAIAILQPILPIYKYYTQIVEHVDLPPSFRYAGELWYKKELDFIKRLAKKENR
FT                   EINEEEKEKLEEIKRKIETEIQIINGKETKIHKRIYLLGTDNLGRDLLSRIIQGSQISI
FT                   SIGFIGALISMLIGSIIGATAGFFGGIIDRIITKITEVLYSLPNLLVIITLMTIMERNI
FT                   IGLFIAISIISWLTISRIVRGQVKTLSQSEFIEAARTLGATNRRMIFKHLIPNSFGMIV
FT                   IITTMNVPSFIILESFLSFLGLGISAPMTSWGELIKNGIPTFIEYPWKIFIPASIMTIF
FT                   LLFMNFLGDGLRDAFDPKDNL"
FT   gene            364280..365152
FT                   /gene="oppD"
FT                   /locus_tag="BRE_337"
FT   CDS_pept        364280..365152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="BRE_337"
FT                   /product="oligopeptide transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_337"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94582"
FT                   /db_xref="GOA:B5RRE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE8"
FT                   /protein_id="ACH94582.1"
FT                   /translation="MNENYMLEIKNLTIEFQLKHTTIYPVNNINLKMKRGEIRAIVGES
FT                   GSGKSVTSMAILKLLPESTTIYKTGEIIFENQDLLKLKEKELQSIRGNKIAMIFQDPMT
FT                   SLNPYLKISTQIEETIMLHQKLNKKQAKQKAIEMLKTVGVINAEERIKHYPHQFSGGMR
FT                   QRVMIAMALSCHPSLLIADEPTTALDVTIQEQILLLIKNLSRKFNTSTILITHDLGVVA
FT                   EICDTVSVMYQGKFVEEGTVQEIFKNPKHPYTIGLLKSILTLDKNPNEKLYSIKDYPIE
FT                   TITNNNEGI"
FT   gene            365153..366136
FT                   /gene="oppF"
FT                   /locus_tag="BRE_338"
FT   CDS_pept        365153..366136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="BRE_338"
FT                   /product="oligopeptide transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_338"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94583"
FT                   /db_xref="GOA:B5RRE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRE9"
FT                   /protein_id="ACH94583.1"
FT                   /translation="MTNEKDIILKVENLVQTFTIGENFLFWKNKRKVNAVNGISFEVER
FT                   NKTLGLVGESGCGKSTTLRTIMQLYTPTSGRIYFNGKDITKLSKKELLKTKKDMQMVFQ
FT                   DPHTSLNPRMTIREIIAEPLVIYNENKIIPRTKQEIEQRVNELMDITGLSKSMLSRYPH
FT                   EFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKDLQKELSLSYLFIS
FT                   HDLAVVKYMSDKIAVMYQGIILEIAPREILFSNPKHPYTKTLIASILEIDPEKIKNKTI
FT                   KLDEPSLTNIRNTYSPTENEILEEVEKDHFVSKYLFDEMNSLLNKN"
FT   gene            complement(366262..367068)
FT                   /locus_tag="BRE_339"
FT   CDS_pept        complement(366262..367068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_339"
FT                   /product="P26"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_339"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94584"
FT                   /db_xref="GOA:B5RRF0"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF0"
FT                   /protein_id="ACH94584.1"
FT                   /translation="MCSLFVKELFGEFYNSIMGKTLRWLFCSIFFFCNVINVLATSYII
FT                   ENFDLSLNEFLEVSTRENNLSPIVDSKRVIMFYPPNKGIRKIFAAFEFDDYAKKYLFKK
FT                   NKYGLFFVKINLPHGIGKIKYRLIVDGIWTNDEYNKNVVFNKDLIPFSIIDIGVDYGYV
FT                   SLRNPIDSSDGREVELFYIGQPGHIVTIAGNFNNFNPFLNRLVEQESRKGVYTIKLKDL
FT                   PKGRIYYYFVDSGNKVIDKNNVNRVNLYSVENVENKVDFEVSYFDN"
FT   gene            367146..368444
FT                   /gene="eno"
FT                   /locus_tag="BRE_340"
FT   CDS_pept        367146..368444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BRE_340"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_340"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94585"
FT                   /db_xref="GOA:B5RRF1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRF1"
FT                   /protein_id="ACH94585.1"
FT                   /translation="MGFHIYEIKARQIIDSRGNPTVEADVILEDGTLGRAAVPSGASTG
FT                   TNEAVELRDGDKSVYMGKGVLKAVENIINIISPELEGMSALNQVEIDRKMLELDGTPNK
FT                   SKLGTNAILAVSMATARAAAEHLGLKVYQYLGTYKANILPTPMCNIINGGAHSDNSVDF
FT                   QEFMIMPIGAKTFSDAIRMSAEVFHTLKSILSKKGYATSVGDEGGFAPNLKSNEEACEV
FT                   IMEAIKSAGYTPGTDIAIALDPATSELYDPKTKKYVFKWSTKEELTSQEMVEYWAKWVE
FT                   KYPIISIEDGMAEEDWDGWKKLTDKIGNKIQLVGDDLFVTNTSFLKKGIEMKVANAILI
FT                   KVNQIGTLTETFEAVEMAKKAGYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRT
FT                   DRIAKYNQLLRIEEELGSIAEYHGKDVFYSINK"
FT   gene            complement(368515..368925)
FT                   /gene="rpsI"
FT                   /locus_tag="BRE_341"
FT   CDS_pept        complement(368515..368925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BRE_341"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_341"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94586"
FT                   /db_xref="GOA:B5RRF2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRF2"
FT                   /protein_id="ACH94586.1"
FT                   /translation="MAKSDVKGVNLGMGTGRRKSSVARVYIREGKGDIKINHKNFDVYM
FT                   QLEKLKTIALSPLALTHTLGKYDIYINVYGGGISGQAGAIRHGIARALFDLDEEYKMVL
FT                   KSNEFLTRDSRKVERKKFGKKKARKSFQFSKR"
FT   gene            complement(368936..369385)
FT                   /gene="rplM"
FT                   /locus_tag="BRE_342"
FT   CDS_pept        complement(368936..369385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BRE_342"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_342"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94587"
FT                   /db_xref="GOA:B5RRF3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRF3"
FT                   /protein_id="ACH94587.1"
FT                   /translation="MNKMTNNKTIWMKPRYVKKKWYVIDASDKVLGRIATEAIKILRGK
FT                   HKPYYTPHQDLGDNVVIINASKVKLTGKKYFQKIYYRHSRYPGGLYSDTYRTLSERKPT
FT                   APLEIAIKGMLPKGPLGRELFRNLKVFADANHKLSSQNLYKLEAN"
FT   gene            complement(369465..370250)
FT                   /locus_tag="BRE_343"
FT   CDS_pept        complement(369465..370250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_343"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_343"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94588"
FT                   /db_xref="GOA:B5RRF4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF4"
FT                   /protein_id="ACH94588.1"
FT                   /translation="MCSKSLFSCFPIIKRARFFYLYDINGNRYLDLYLNEGLNFLGHRV
FT                   QGLNLILKQTFSRGLTASYPSIFKKQFENVFFSYFKEAGFVRVFRFERDARDFLLSLTG
FT                   QNYFSNPWEVRQGIYEFKFGFNNVRYPMFIKLPMPGCMSINIVIVDNLSKKMEFRDSFD
FT                   ALTLAVAKHMLVKILSYEKSLKINFDIFSTPMFKLINRYMFPCYKSEYHGEVFKEYLSN
FT                   GYLISPVFDFPSLLPLKFSKGDLDGFRKISAKLQNKFGC"
FT   gene            complement(370243..371700)
FT                   /gene="gatB"
FT                   /locus_tag="BRE_344"
FT   CDS_pept        complement(370243..371700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BRE_344"
FT                   /product="Glu-tRNA(Gln) amidotransferase, subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_344"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94589"
FT                   /db_xref="GOA:B5RRF5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRF5"
FT                   /protein_id="ACH94589.1"
FT                   /translation="MEYKLLIGLEVHVQLGLKTKAFCGCKNDFGGIPNSRVCPICLGLP
FT                   GALPSVNKELVSSAILAGHATNSTIRNIVKFDRKHYAYPDLPKGYQISQNDAPICENGF
FT                   IFIKTSLGVKRINIARIHMEEDSGKSLHLLSNDNQSYIDFNRAGAPLLEIVSQPDIRSG
FT                   EEAVAYLNALREIFRYLDLSECSMENGSFRCDVNINLLINENDVNYKTPISEIKNLNSF
FT                   KSVKLAIDYEESKQKEEWILYRKTLESVGKCTMGFDDKKGITVLQRSKETISDYRYIKD
FT                   PDLPLIKLESDYIENIKSHRMVELPFDARIRLQEQYGLSDFDVVTLTSDKNLVKYFEEA
FT                   ALTSSEPKKVANWILSEVLSVLNEREIGILDFNLPASYIGELVEFILNGKISGKISKEI
FT                   FLEMVDRNVSSITIINEKKLEQISDKSFIESIVIEVLNENPKSIELYKKGKSHAVKFMM
FT                   GQIMRKTSGKVNPVLSNEILMNKLQDV"
FT   gene            complement(371690..373135)
FT                   /gene="gatA"
FT                   /locus_tag="BRE_345"
FT   CDS_pept        complement(371690..373135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BRE_345"
FT                   /product="glu-tRNA amidotransferase, subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_345"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94590"
FT                   /db_xref="GOA:B5RRF6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF6"
FT                   /protein_id="ACH94590.1"
FT                   /translation="MDLSGLNLIKIKELILTRKYKIYDIILYYKKVYEDNRDINGYVEF
FT                   FDDALEIAKEYDDLLSKGGGQDLPLLGIPIAVKDNIAIKNKDLTCASEILQGYISPYDA
FT                   TVIKRLKDNGAIIIGRTNMDEFAMGSSCEFSYYGVTLNPSNKEYVVGGSSGGSAAVVAR
FT                   GQSPFSLGSDTGGSVRLPASFAGVIGFKPSYGGLSRYGLSSYSSSLDQIGFFANSIDDV
FT                   ALILKYTCGIDTMDSTSIDIIQEPYPLLNKPLKGTKLAVIKEFSKDLMEEDIYCEFSKF
FT                   KSALLSKGVEIHEISIEAVNFVLSLYYSISPVEAASNLARYTCLHYGKRLNDTLSLNDF
FT                   YYKHRSLFLQEEVKRRVVLGNYLLSEGYDLEYYTKACKIIENVLIPKFDEIFNNYSYII
FT                   TPTSFLKPFKIGENFDDPLKMYYSDLCTVIANLIGFPALSIPFAKDDKGLPIGMQVIGR
FT                   VKRDFELLSFSKNIIEELELDGI"
FT   gene            complement(373147..373422)
FT                   /gene="gatC"
FT                   /locus_tag="BRE_346"
FT   CDS_pept        complement(373147..373422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BRE_346"
FT                   /product="Glu-tRNA(Gln) amidotransferase, subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_346"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94591"
FT                   /db_xref="GOA:B5RRF7"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF7"
FT                   /protein_id="ACH94591.1"
FT                   /translation="MKNIHLENSLKLSLLKLSEDEKQQFVMKFEKIVCMLDKISEFKIK
FT                   DGFHKAVCNFSDLRDDEILPSLTIESIKNFSNVFVDGYFLSPKVLE"
FT   gene            complement(373432..375528)
FT                   /gene="uvrD"
FT                   /locus_tag="BRE_347"
FT   CDS_pept        complement(373432..375528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="BRE_347"
FT                   /product="DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_347"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94592"
FT                   /db_xref="GOA:B5RRF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF8"
FT                   /protein_id="ACH94592.1"
FT                   /translation="MMSEIQKFLFSLNFDQKQIVFDDTTNPILVLAGPGSGKTRVITAK
FT                   FAHLINKGKVKPEEILALTFTNKAAREMNFRLNSLFNFDRSLHIQTFHSFGAWLLRLYF
FT                   KEYDENYDSNFTIWDVNDVVKFVKQIGLASNIECAKYVTSSILKYKENYSLHNNCGFDD
FT                   KIYSEIEFYEQEKSKSNAFDFADLILKSVLMLQNCENIRMRVQKRFKAIFVDEYQDTNY
FT                   SQFLFLRELYYKDAYFMVVGDEDQSIYSFRGARVENILEFERTFDNVSKYYLVQNYRSS
FT                   LSIVNVANNIISKNQNRYDKVIATENKIGKKIKIFIFQNPTEEAEYFANFLIENKLETA
FT                   VLYRFNHQSLQFEKAFFKNNIAHKILGSIRFYEREEIKDVISLLRLFVNKKDKVSFLRI
FT                   INKPARGLGKTTIDKIIATLNDTDVNLDLMLASRKVVKNLKGKARDSLDIFLSLYDELK
FT                   ENIQKGIYVNLSEFIKDVTMGFGIWNYYQKFDKDEKSKNIDELISSGVEYSGSFEGLVI
FT                   FLENSSLSPLVHGDFASSVLLSSIHGVKGLEFDRVIISGLEKGLLPSEIEELTADRLEE
FT                   ERRLFYVAITRAKFELFITINLQRFFKGILKNTAISVFFQEIHKDNYDIVFVPEYLKDN
FT                   FKFFFTRSDNKNFNIGDYIIYNGENGIIVDKWYQDGGPFLKISLKNGKKAILSSSYIKK
FT                   LSKM"
FT   gene            complement(375525..376727)
FT                   /locus_tag="BRE_348"
FT   CDS_pept        complement(375525..376727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_348"
FT                   /product="uncharacterized conserved protein"
FT                   /note="AMIDATION"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_348"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94593"
FT                   /db_xref="GOA:B5RRF9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRF9"
FT                   /protein_id="ACH94593.1"
FT                   /translation="MDRSDFIRFGDFLKKTRIDKGFTLEMIADDIRISIKYLRALEDSN
FT                   IESFPNEVLAVGFLRTYSEYLGVDVWYVSSLFKEYKRRLNSNYIGIKSDDQNGSVTFVS
FT                   ESKLGNKYFDVTNIGFSKIIKILVGVVGIVFLVFVVTNISGFKQILGRIFKANYVGKRV
FT                   PEVHEVLFDKENFWNVVLGEGDFLSLIFGNSIAKYRVSFMNDDLVITNDLENEQYVFNL
FT                   GKFREVDLNGNIRVKIVYDNYSQDKVRKAHVSLESFMLNVEYVFETNLSNRFNVVNWGF
FT                   EVNGPKNRVISEYPTVYSSTNISDINLSINFLNDTFLRYVDENNLYGKSLLLLKGSDPL
FT                   NLNFKKSLILFFTRLSDVNIVLQGKDVTSVLKSYGSEMIAIQFFWLKTPGGFDLKVSEV
FT                   Y"
FT   gene            complement(376739..377416)
FT                   /locus_tag="BRE_349"
FT   CDS_pept        complement(376739..377416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_349"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_349"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94594"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG0"
FT                   /protein_id="ACH94594.1"
FT                   /translation="MSFIMNKIKKIILIISPYLLFAQISANQYFEEVHSKYQNVNDMQA
FT                   KISLNIKGLKQTGTLLYKSPDKFIINLDSNNQVFVSDGEFLTIYVPSLGTSFRQQLTMG
FT                   KSGSGFMNILSTEYSVSYTNSPNLEPLDESGGRGGAENFMKLTFSRRLYKGAATIDSFM
FT                   IAFTPSGAIRRVIAYPTDGGREIVIDLLSVKFNVGISDSKFKYDLPKNANKVDNFLYDV
FT                   KKT"
FT   gene            377556..378965
FT                   /locus_tag="BRE_350"
FT   CDS_pept        377556..378965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_350"
FT                   /product="fibronectin/fibrinogen-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_350"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94595"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG1"
FT                   /protein_id="ACH94595.1"
FT                   /translation="MSLNYHEINILLEELPLINSFLKKIKQPNYKNLVIEFYNKSTDEK
FT                   IFNVLISLDPQKTRIHKTNKKFENIKPPLRFFEFLKSKVTNAKVCEAHQIKNERIILIK
FT                   INKNQNYYCIFIKLWTSSPNIIVTDTNFKILDAYYRRPKSKEITGEIFTKAKKIIENND
FT                   MTEKKEVKLKNEYDNKLPYSTFIENYYDNLKIKETKTHNTEMFNKTYEQEKINLERKIY
FT                   SLNKQLISMDIIATHKEKGEMILSNINKIKKGMSEITLQNNNEEEIKITLEKKLSPQDN
FT                   ALKYFKTYKKNKIFLKIVQEQLKNAKTQYNTLISNTTYTKEKNHITLTNEKTTKQKTIQ
FT                   KTSIGLHFISHGFEIIVGRNAKENDELLRSWAKGNDYWLHTRDYPGAYVFIRNKKDKTP
FT                   PLEVLIDAGNLCVFYTKPAKQAGKADLYYTNVKYLKKIKGEKKGLVIPHREKNLNIKLD
FT                   LKILNKLKNKN"
FT   gene            379079..380512
FT                   /gene="pyk"
FT                   /locus_tag="BRE_351"
FT   CDS_pept        379079..380512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="BRE_351"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_351"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94596"
FT                   /db_xref="GOA:B5RRG2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG2"
FT                   /protein_id="ACH94596.1"
FT                   /translation="MIQKLTKIVATISDLRCDPEHIKELYEAGVNVIRLNTAHQSHADA
FT                   IKVINNVRQVSNKIALMIDTKGPEVRTANIEKPITVKIGDKVIISTTPINDSNAFQTNY
FT                   NGFVNEVPNGAKILIDDGELEMIVIEKSADKLICQIKNDGQIKNKKSINTPGISLKLQS
FT                   VTDKDKGFIELAAKQNIDFIAHSFVRHAQDIQDVKDILNAAGNPDVKIISKVENQEGID
FT                   NIEEIAKASYGIMVARGDMGVEIPAEDVPLAQIKITKTCIKYGIPVITATQMLHTMIEN
FT                   PRPTRAEVSDVANAILNGTDAIMLSGETAYGKYPIEAVKMMTKIAREVEKYREQTLFQD
FT                   EIFCSKKIIRNYIIKCAIDATKIMPIKAIIVDSLKGRTARIMATYRASVPLFITTNNER
FT                   IARELSLSYGVYSNLVENNFKRTNEFVATSLKMLKTQEIVKNSDIIVIISGNPNRDTNK
FT                   GTEFMEINTVEEAIKGHNL"
FT   gene            complement(381286..381564)
FT                   /gene="rpmB"
FT                   /locus_tag="BRE_352"
FT   CDS_pept        complement(381286..381564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BRE_352"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_352"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94597"
FT                   /db_xref="GOA:B5RRG3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRG3"
FT                   /protein_id="ACH94597.1"
FT                   /translation="MGRECEITGKRTMFGNNVPRKGLAKKKGGAGQHIGVKTKRTFKVN
FT                   LINKKFFIPELGKNVSIKISASTLRSISKVGLNVFLKKNNKKIDDFI"
FT   gene            complement(381574..383172)
FT                   /locus_tag="BRE_353"
FT   CDS_pept        complement(381574..383172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_353"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_353"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94598"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG4"
FT                   /protein_id="ACH94598.1"
FT                   /translation="MITLNFVFKRRAINVSLVDFLVAIFNRERTPEQVKQRRLKEVKKS
FT                   LSKSSNFFSVSKIQALPQFAKFIYNLYKVFYPLKLFVQRYRNSNEIIHFVVEKYLNSTQ
FT                   KQALEHIYSFSANEIVNFTSDMLKNLDTNLNYLLKSITQEQVRLIDETCGALDIFFDLA
FT                   SYQYYILIKHFDSLFPEDDFIYKPRFSAVSCGVILDDIKDYLECIYSIKDISIWRNLYD
FT                   ILLKIYGDEDNFPMKPNVWLKMITSIIEINKNKEILYLVRYVSGDPNYLPISGLKKTKA
FT                   KAFFNYLSKHVSNEMLKSEILQKNSKSKILAKKLFPGVTLLTLDNYNEHMNMKITSKIT
FT                   NTTGYVYADILGYLKTHAVNLVKKDLNDIVNILIIKGQWKDMEISRDVSNDIHDLVNIY
FT                   SNLIDFDNSLGEQGNYGNRINALLHRVYVGGDKSSEKLLLNIIVDVNKKALILLNDYYS
FT                   KIYSLKQLLSGCLEDYFKPSSEKELIYNWKELDLELVKSYGNNVNFSSIIKNIIEGLTL
FT                   FLKLMDLYLTKKNGI"
FT   gene            383256..384371
FT                   /locus_tag="BRE_354"
FT   CDS_pept        383256..384371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_354"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_354"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94599"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG5"
FT                   /protein_id="ACH94599.1"
FT                   /translation="MYIKKLILMTILALIFSCSKETAITILTDNKIIPIYINQFNVQNK
FT                   TNFIIKYKKNINVQTINKENAQIIIAKNLDNINITKNFKNIQKYYYSDYPILNNISKKF
FT                   AYKIVPLSFDIPILIYKNEYDIQKYIDIQSIKEIYTNFKKDKKIFISPYISENIFYTIS
FT                   EINDINIYFGNNKPEYDEKKILNIINYFKSFIDVNELTLHKNFTEKYKYLNLETILLQQ
FT                   KTILIAGLTNLAYYNKLNQNIKDKINFSYLTNKEKKSSICNINFMGVKETSQPIAKFIR
FT                   WILNQKIQQSLITLKDKAKFNEHFGLINGFTPYKGLNLKLKHVIKEIPQFIINENYMNK
FT                   DSYILNKEQIEKENNIINELMLYNIKNANSS"
FT   gene            complement(384366..386180)
FT                   /locus_tag="BRE_355"
FT   CDS_pept        complement(384366..386180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_355"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_355"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94600"
FT                   /db_xref="GOA:B5RRG6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG6"
FT                   /protein_id="ACH94600.1"
FT                   /translation="MLDMKKELFTFLSNFIVFLFLFVALVFCYTYFFGVAYLEKHILVA
FT                   TFFDTVLSVYHNFNGFFIFFVLIYFIFLAKPETRLYFKGYKGYLFKKFYPFMFLFFVIG
FT                   IVFVLIFNSIMSYILSQKNEYKYNYERYNLLAEQTTTIMNELKNIDINLSSNKTLDVNE
FT                   LVEVFKQKKKYLEELLRIYEKMRLISDNDELSINYYLARSEYDRMPLYGVDLEKVRKTL
FT                   KMYLIKSLSKRDFQDIINGFIDKGDYATANYFAYIGFFATKDDEFSALLDLTFKAINEY
FT                   KNVELEREASIFEEKQRNFLYLNTEKFKPAYYGFLKLHNLFPNDNEILSYKNKSLDKLK
FT                   IHYFFFDEIEKYYEHYGINDVFLVQSNSGDGTYDYIYMQKVVNTVFSYTKMIKNFELIR
FT                   FDSLGKVILHIKVPFATLKGNTVYQNVLDKKSENSDITATRVFVLLKDFDLSDIKIIDL
FT                   NNNVDNLHLFANSVKGSIFLPIQVLISAFNQIKTFNLRLIGIFSSSLFLMISPILLVFF
FT                   GVLFIAVASKVDFEFDLKFMVFLVSIVVAIFSGIVSLLINYLLLTLIALFMHLSGNIYI
FT                   SFILIFSFLFLIVLYVMLVNYKKDIPSL"
FT   gene            complement(386186..387130)
FT                   /locus_tag="BRE_356"
FT   CDS_pept        complement(386186..387130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_356"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_356"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94601"
FT                   /db_xref="GOA:B5RRG7"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG7"
FT                   /protein_id="ACH94601.1"
FT                   /translation="MLNIVRFISLISCRFIFMFFLFSFVFVCTSYLKYTFLHVDLSVLS
FT                   FELYYDAYLYAFPLSLVVTFMRIAYPFSMTTFRVSGILYIVVFIFILFLSYFGFLASVN
FT                   FNTIFFDLHNRDEKIIKDDTVHFFDDQIVFYSNDIKSFGFKGVLKITDNEFDDEDFKSF
FT                   SYNSGFSESDVANFNENAFFTQKLYSNLVGYTFNDLDIFNNFLLSLESFGLILNIFGFV
FT                   LLLFSFSYIFNFIFLNSLSLFLYPIFVILFFKVYNIYAIEFPESLDLIMGENVISNYLT
FT                   FIFCVLTFCSTYLIGFLFKYIKVNEGFDNNTLH"
FT   gene            complement(387157..387651)
FT                   /locus_tag="BRE_357"
FT   CDS_pept        complement(387157..387651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_357"
FT                   /product="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_357"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94602"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG8"
FT                   /protein_id="ACH94602.1"
FT                   /translation="MSFVLDQAVVYPMQGVGKIKNIQNKEFNGEFIDYYEIYFPFNEMT
FT                   FMVPVARAADLGIRALVSKEKVEEVFDIIKDFEGQIDQKKIKDGSHDFYKQSDILSTAK
FT                   LYKFLYVKSMQKELPFYEKRILNDFELILQHEISLALQISFEEAKEKIREVLSGGQAVL
FT                   D"
FT   gene            complement(387696..388289)
FT                   /locus_tag="BRE_358"
FT   CDS_pept        complement(387696..388289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_358"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94603"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRG9"
FT                   /protein_id="ACH94603.1"
FT                   /translation="MANLKDIYSKPDRIYFFGAPIDVFKNHEKLISRFEYLISHPYHSM
FT                   VIFIDCKSLLKFLIFKSFRNLVKSSSLVFSNSRLLRTLCKFLKRIDIGCYDSNSILLVL
FT                   MSVLENTYKTCYIIDKDKIISKKNFLRLKESHKEINFIGYYDLRAVKRNKEMFFANINK
FT                   LTPSMIISFCNSNYLENLFYVNKFGIRTNLTVFL"
FT   gene            complement(388282..389010)
FT                   /locus_tag="BRE_359"
FT   CDS_pept        complement(388282..389010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_359"
FT                   /product="uncharacterized protein conserved"
FT                   /note="2 amidation motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_359"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94604"
FT                   /db_xref="GOA:B5RRH0"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH0"
FT                   /protein_id="ACH94604.1"
FT                   /translation="MKQIVLDYSCLFDDDIIIDDIKIYHYLVNVRRLRVGDRLNILLGK
FT                   REIRFSEILSIENHRIRFATLRVEELKMRDFEIDIFISNLKGRKLDLSLRQVVEIGVNS
FT                   INIVNADNSIAKLDMDNLEPKKLRFLKIIDEALKQSGNAQIPSINFYNDFFSIPYSSSV
FT                   NYYVAYSKGDFLHLGENISVFGKIGILIGPEGCFSKLEIDFFKKLNFKFVRFNTPILRA
FT                   DTAIVYALAHFKLLLEGNNG"
FT   gene            complement(389014..390498)
FT                   /gene="ctp"
FT                   /locus_tag="BRE_360"
FT   CDS_pept        complement(389014..390498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="BRE_360"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_360"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94605"
FT                   /db_xref="GOA:B5RRH1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH1"
FT                   /protein_id="ACH94605.1"
FT                   /translation="MCRNFSMKKKFLVFLYVVLALVISSSVIVESIFAQANSSKSNLSA
FT                   SSYGQMMIEAFNFIKKNYVEPIDDEAVFEGALQGMFKALNDPYSQYLTKKDLVEISKTT
FT                   EGNYVGIGVVIAKKEISKKSNNTASDVPYIMIINAFEEGPAYRAGVRSGDYIKAIDGNS
FT                   TDSMTIEQVSEFLKGKAGTKVKISILRNKNLELEYDLVREKIDIETIKYSVINNDVGYI
FT                   RILSFNPSTNIYFKKAFEKLKLQNIKSLILDLRLNLGGYLTDAIEIANDILVEGLIVST
FT                   KARDFKIPLEYVTREYRADSSHIVPLDMPIVALIDKYSASASEVLVGALRDNQRVYVIG
FT                   EKSYGKGVIQRIVPFHTGGFKITHSKYYTPSGQSIHNVGIKPDLEIKERELSEVEFGVY
FT                   TRMLNEEAIEKFLNSKINKKSLSEKEVDIFVNKFLETSYVKAGKDISNIDKKALGRYLF
FT                   LQFYQDIHHNQPIYNLYYDEVLKTAYEYLVKKGTQN"
FT   gene            390541..390972
FT                   /locus_tag="BRE_361"
FT   CDS_pept        390541..390972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_361"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94606"
FT                   /db_xref="GOA:B5RRH2"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH2"
FT                   /protein_id="ACH94606.1"
FT                   /translation="MLKINSLKTKRIIMTLIIAMQTIASTLILLALYKLTSNTIFINNS
FT                   SIKFLIAFIIFSPELCIAILTIQYILYDQLKILSNLINITKSLQIIMNILLATLGLALE
FT                   LFKTYQPWLFTFLEIIIITYVIFNLVILILLKFKDKITE"
FT   gene            390976..392109
FT                   /gene="ylxH-2"
FT                   /locus_tag="BRE_362"
FT   CDS_pept        390976..392109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylxH-2"
FT                   /locus_tag="BRE_362"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_362"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94607"
FT                   /db_xref="GOA:B5RRH3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH3"
FT                   /protein_id="ACH94607.1"
FT                   /translation="MIIIPIASGKGGVGKSLFSTNIAICLANEGKKVLLVDLDLGGSNL
FT                   HSMLNIIPKKSIGTFLKTQIPFQDIILESGIKNLNFIAGDSDIPELANIAIFQKKKIIK
FT                   NLKNQNYDYLIIDLGAGTAFNTIDFFLMSNRGVIVTIPTVTATMNAYLFLKNAIFRLIS
FT                   KIFTKETKAYKIVSNIRKDSTDLQKIYIPNLLLKIEEHDPENYAKFMQIFAQFSPFIIF
FT                   NMLNKPEDIIKTEKILKSAKNYLNINLQSIGSIYKDELVDQALNHKIPITIYKPTSLIS
FT                   KSIKKIAKRLIELEDVINDVELLNEDDLNASYYFVIKEAQDEYLEKYAYLESLLMNKTI
FT                   DNNAIIDIIKSQQKEIATLRKQNIMFKKKLFTKLKKD"
FT   gene            392120..393073
FT                   /gene="lgt"
FT                   /locus_tag="BRE_363"
FT   CDS_pept        392120..393073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="BRE_363"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_363"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94608"
FT                   /db_xref="GOA:B5RRH4"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH4"
FT                   /protein_id="ACH94608.1"
FT                   /translation="MPNYINYPSWLHPEIIKGIPITWYSLSYIIIIIISYKFIWYQIRT
FT                   DKLDIDKNDYEQLMFSIVMGAIIGGRLASTLIYDKSGIYYTHPWMIFLPFDQNWNFTGF
FT                   RGMAIHGGFFGVIIAPLIMINTKLKNTNVKKYFKKITDYGAIAFSLGYILGRLANFANA
FT                   ELYGRPMKGGVIFPNAEPFKISQNGVKEFAESVGLEILPHDLFINLPRIPSQLIEGLFE
FT                   GPVIFLLLWFIFRKIKKYDGFIFGVYIILYGTFRFLIEYLREPDKEIGFIITYRKPESM
FT                   LDFSFLNISMGQIFSSILILAGIIWLIWTKKQAQKN"
FT   gene            393131..395128
FT                   /locus_tag="BRE_364"
FT   CDS_pept        393131..395128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_364"
FT                   /product="periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_364"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94609"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH5"
FT                   /protein_id="ACH94609.1"
FT                   /translation="MRNKNPNAIVISEKAVSDKDVIKIKSIFTISQIIESRKNVSSSYI
FT                   KQSNIKFAVIYNHKRPIDFSINIANDLKSINNVHSIIINNEYIDESIYRPNYIEILQSI
FT                   QELSEKNKLIQQKKFYYDNKNANLDFFLNLSELIQEIVIITNTENDIIYINEKGSKELE
FT                   LPIKIKGKTNKISDIDIIDFEKETKIDLSYNIDDIPEFKNILITDCLLKGKNNKKLTVD
FT                   LFISTIAQNNIDKLITIKDVSDLKSKHNIPHFEVIDQETDLYNIKELEKLLINQIDYSS
FT                   KKTYLFDLDLHINTEYEYKGNRDHIDVKILKKITSRIMSFYSEYIFKLKDNNLIVIIST
FT                   SGGEQRVISIAEEIKKTISRELKKEGLIILKFNIGIIEVNLKEDIETKISKLKIATKIS
FT                   DEYKDSMPILYKDELPETIIIKNQNKIFEYIIKAIKNDFFSLYYQKITPLKKDLTPKIE
FT                   ILTRLFDYTGTPIPNNHVFGLIDKYNLTVEVDKLVVTKALREYTNFVTKNGVHIFSINI
FT                   SPYSLKSKNFRIFLKETLLQSHVSLQNICLEITETGIVENFELINTYFNELKTFGIKLA
FT                   LDDFGSGYTSLSYIKILPIDIIKIDGSFIQVINSSQIDLVIIKSIKEIADTKQIKIIAE
FT                   FVSNEEIFKKISEIGIDYGQGFLWHKPEPI"
FT   gene            395261..396634
FT                   /gene="yscI"
FT                   /locus_tag="BRE_365"
FT   CDS_pept        395261..396634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yscI"
FT                   /locus_tag="BRE_365"
FT                   /product="aminopeptidase I"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_365"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94610"
FT                   /db_xref="GOA:B5RRH6"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH6"
FT                   /protein_id="ACH94610.1"
FT                   /translation="MTKQNPWLSLNEEKKNNILEFAHKYKKFLNTVKTEREATNYAIQK
FT                   AKEKGFISACQKKELQAGDKIFYTSRNKNIALVFIGREPIENGMHFIVSHTDSPRLDAK
FT                   PSPISQENEFTMMKTNYYGGIKKYQWLSTPLSIRGIIFLHNGKQVEISIGDNNDDPVFV
FT                   IPDILPHLDRKVQRDKKADDIIEGENLRIIIGSLPIESREKEKVKFATLTLLKEKYNIS
FT                   EEDFVSAEIEIVPAGEAKDVGIDRALIGAYGQDDRVCAYTSLEAILNLEETPNKTAICF
FT                   LVDKEEIGSTGSTGLQSRYLEYFVSDIIFKLKQKEYNNLIVHKALWNSKSISADVCGAI
FT                   NPLFKVHDEQNAPKLGYGIPIMKYTGHGGKIMASDADAELVFYIRNLLDKNNIAWQVAT
FT                   LGKVEEGGGGTVAKFLAHYGIRTIDMGPGVISMHSPFEITSKFDIYTAYMAYKAFFKG"
FT   gene            396585..396902
FT                   /locus_tag="BRE_366"
FT   CDS_pept        396585..396902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_366"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_366"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94611"
FT                   /db_xref="GOA:B5RRH7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH7"
FT                   /protein_id="ACH94611.1"
FT                   /translation="MTYILLIWLIKHSLKDDKMHKETIETSEHILECFGGITNIKQVVK
FT                   DLTRIKILVDSNSLVKRENLTKNKNIIGAIKSNEVTEIVMNFAIIDDVYTNIIYMINKK
FT                   K"
FT   gene            complement(396923..397975)
FT                   /gene="gpsA"
FT                   /locus_tag="BRE_367"
FT   CDS_pept        complement(396923..397975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BRE_367"
FT                   /product="glycerol-3-phosphate dehydrogenase, NAD(P)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_367"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94612"
FT                   /db_xref="GOA:B5RRH8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRH8"
FT                   /protein_id="ACH94612.1"
FT                   /translation="MKISIVGAGAWGTAVAKVLADKFKDPVLIWSFEEDVRESINNSHE
FT                   NTKYLKGIKLPDNLIASSDLLDIVNQSDYIFVVTPSLYTLNVLNKLKSVLTTKKFKLAI
FT                   LTKGFITIDDKPCTIIEVAEGVLREYKDEITYIAGPSHAEEVGLGIITGLVAASRNRAN
FT                   AFEFINLFSGTSISMFYSYDILGVQVASALKNIFAIAFGILDECKIKDPNLIGNNTESF
FT                   LFSVSLNDMKNIAFKLGSCNEETFLFLAGSGDLDVTCRSIFGRNRRFGREIVGKNILED
FT                   FRDIDDLISNINKIGYLPEGLVAAREVALLFKFLGISSDFQNLAMIVYKILNKELKPEA
FT                   VIDYIKNFKF"
FT   gene            complement(397999..400311)
FT                   /pseudo
FT                   /locus_tag="BRE_368"
FT                   /note="pseudogene"
FT   gene            complement(400301..401521)
FT                   /gene="tyrS"
FT                   /locus_tag="BRE_369"
FT   CDS_pept        complement(400301..401521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="BRE_369"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_369"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94613"
FT                   /db_xref="GOA:B5RRH9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRH9"
FT                   /protein_id="ACH94613.1"
FT                   /translation="MNLSLKVLDKRGFLKQCTNLEELSTLMDREKIVFYVGVDATSASL
FT                   HIGHLIPFMVMLHLQRQGHIPIILIGGGTTKIGDPSGKDSMRKILLKEDIDENVKTISS
FT                   QLLKIIDLSNGGYILNNAEWLDGINYIEFLREVGIYFSVNRMLSFETYKRRLKDGLSFI
FT                   EFNYQLLQSYDFYMLSRMKNCKLQIGGDDQWGNIVSGVDLVNRKSGNKVFGLTLPLITR
FT                   SDGNKMGKSEKGAVYLDSELYSVYDFYQYFRNIPDLDVKKFLYLFTFLEEEEIERIASV
FT                   KGQLLNNAKEILAFEITKIVHGKDEALKASSAAKAAFKGGDGRADIPFFKLELTNLEES
FT                   ILLVDLMVLAKVVSSKSEARRLIDSGGVYIDKVRVGDQNYCLCKDNFINGEIELKIGKK
FT                   KILRIVL"
FT   gene            complement(401526..402863)
FT                   /gene="glyS"
FT                   /locus_tag="BRE_370"
FT   CDS_pept        complement(401526..402863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BRE_370"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_370"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94614"
FT                   /db_xref="GOA:B5RRI0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI0"
FT                   /protein_id="ACH94614.1"
FT                   /translation="MFDMAKIEDIISLAKRRGFVFQSSEVYGGLSGVWDYGPLGVEIKK
FT                   NIQEEWWKSMVYFHENVVGLDSAILMRPEVWKASGHVDSFLELLVDCKNCKNRFRTDFI
FT                   DLSKGCPNCGSIGTFTTPRSFNLMFKTNIGAVEDSSSEIYLRPETAQGIFVNFRNVLDT
FT                   TRLKVPFGIAQVGKAFRNEIIAKNFIFRVCEFEQMEMQFFVHPSQMDDWYCYWREKRMN
FT                   FFIETLGIKADNLRFQKHNDDELAHYAKAAVDIEYNFPFGFQEIEGIHNRGNYDLNQHA
FT                   KFCGKSKLFEYHDLITGDKYIPYVIETSLGLTRSVLMTLCDAYACEELEGGDKRIVLHL
FT                   HPKIAPYKVAILPLVKKDGLPELARKVFMQFSDDFYMFYDENGTIGKRYRRQDEIGTPY
FT                   CVTIDYDTIENRTITLRDRDTMTQTRISIDDLYSYVKTGILNYKGV"
FT   gene            complement(402878..404398)
FT                   /gene="gltX"
FT                   /locus_tag="BRE_371"
FT   CDS_pept        complement(402878..404398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BRE_371"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_371"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94615"
FT                   /db_xref="GOA:B5RRI1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRI1"
FT                   /protein_id="ACH94615.1"
FT                   /translation="MIFQKRTFFIKRGCVLNIRVRYAPSPTGLQHIGGIRTALFNYFFA
FT                   KSFNGKFLLRIEDTDQTRYYKEAEEDLYQSLAWLGIDFDEGPTCGGSYSPYIQSQRTEI
FT                   YRKYAKELIESGNAYYCYCSPDRLERIRKIQTINKMVPGYDRHCRHLNKDEIKDALSLG
FT                   ISPVIRFKIPFDGETSFNDILLGKITWANKDISPDPVILKSDGFPTYHLANVVDDHLME
FT                   ISHVLRAQEWISSGSLHVLLYNAFGWNPPIYCHLPMVMGSDGQKLSKRHGATALKQFID
FT                   DGYLPEAIINYVTLLGWSYDGKSEFFTKNELQKLFSIDKISKSPAVFDYNKLDFFNSHY
FT                   IRTKEDHELAELLLPFLQKAGYIKKDSNSCDKEKLLLLVPLIKPRIRKLGDAVGMLRFF
FT                   YTNISTWNVNEFLGKKKTVRDIYLLLEKIKPVLEGFETRILSENEQIFYNFAKENNLKI
FT                   GEVLIPIRIAVLGSKVSPPLFDSLQLLGKVKVFDRINKAQDFLKKYEL"
FT   gene            complement(404367..405149)
FT                   /locus_tag="BRE_372"
FT   CDS_pept        complement(404367..405149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_372"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_372"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94616"
FT                   /db_xref="GOA:B5RRI2"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI2"
FT                   /protein_id="ACH94616.1"
FT                   /translation="MMVDRILFIFNILFFCFFLYFIYFLQIFNFSSFLNFIILHRYFIL
FT                   YFIVFVFVFNIVYSKFLYSRLYFILNGIENTYTFLRLKMIRKTLKSVFDISTLLKITLI
FT                   KQDKKAFDDIYLYLKDTKMSNKTIIELYAICVSFREQEKACSLIMNHVENRNKWVRYCV
FT                   SLHAIFDEDYEKLNNEINFLKKSFLKGDLIFTIYFYYLLKKSKLERHLVEEKRLEIRNK
FT                   YLKRKDRLNIKHTKLLGSNLFFVVFYYIYDISKKDIFY"
FT   gene            405281..406426
FT                   /locus_tag="BRE_373"
FT   CDS_pept        405281..406426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_373"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_373"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94617"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI3"
FT                   /protein_id="ACH94617.1"
FT                   /translation="MQSFDNLAKEIKNFSYVIEKDFLIWPKDSLLQPINTELIEKWGLK
FT                   NAIQIERNFFNESLIRETKKYININEEYDEESIANYHILISNLEEIYETCKKNKKIYYQ
FT                   DVIPIVKKVMEFYKKNQQTFIKYIKIPKLLSDYHVVHSINTSILTVALGNEMNLNNHKT
FT                   VELCTTALLHKIGFLFIPLSISKKKEKLTDKEFEIIKKYPVLGHKIISTTNFSRSICLA
FT                   ILTHKENLDGSGYPNKLKSEQINIEANIIGAASAYSAILLDKIYKGASSSGASLIELIQ
FT                   DADKKFDKRVLKLIIKVLSQCPLDFIVELNDNSIAKIIKINEININVPYIKYIIKDGKV
FT                   IHPNDNQGYIKSIPKTETGIKKILRQDEINLILKKYSLKEI"
FT   gene            406440..407153
FT                   /gene="pfs-1"
FT                   /locus_tag="BRE_374"
FT   CDS_pept        406440..407153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs-1"
FT                   /locus_tag="BRE_374"
FT                   /product="5'-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_374"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94618"
FT                   /db_xref="GOA:B5RRI4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI4"
FT                   /protein_id="ACH94618.1"
FT                   /translation="MILITSAMDEEAREIHQIIENKEEIKIDNYLGEKKIYKGEIEGHK
FT                   IISLTTGIGKVNAAMWNSYIIAKYQITHIINSGTAGGLQESSNIKISDIIISSQTAFYD
FT                   FNLTQFDYQIGQVPGFPQKFESDKTLLNKVISIIKDKFQNVNVHIGLILTGDQFIEDEK
FT                   QIEKIKNDFKDALAVEMESAAIAQVAYTFNIPFIVTRSISDFPNNKNNHIDFNKFLQDA
FT                   SKNSAKMVRELIKSI"
FT   gene            407170..408339
FT                   /gene="metK"
FT                   /locus_tag="BRE_375"
FT   CDS_pept        407170..408339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="BRE_375"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_375"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94619"
FT                   /db_xref="GOA:B5RRI5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI5"
FT                   /protein_id="ACH94619.1"
FT                   /translation="MNNNNLTATSESVSEGHPDKIADQISDAILDEILKKDKMAKVACE
FT                   TLVSQNLIVIAGEINSKAKKDIDIKETAKQTIKNIGYTNIEYGLDYKSATIIDAIGSQS
FT                   IDITNAVEKKDTKDIGAGDQGIIFGYACNETKNFLPIAYELSNLILKEASKLRKSGEIK
FT                   WLRPDAKSQVTIEYDSYKNPIKVSNIVLSHQHDPDIPYSYLKQTIIEKIIKPVLNSRSM
FT                   FDNNIEYYINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATKVDRSA
FT                   AYMARYISKNMVAAGISREFEMQIAYAIGIPKPISIKITTGINDNEYEKKILNFIINNF
FT                   DLTPNGIIKKLKLREPIYSQTCTYGHFGKNELEWEKLDFVDTIKKEFQI"
FT   gene            408252..408809
FT                   /locus_tag="BRE_376"
FT   CDS_pept        408252..408809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_376"
FT                   /product="autoinducer-2 production protein"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_376"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94620"
FT                   /db_xref="GOA:B5RRI6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI6"
FT                   /protein_id="ACH94620.1"
FT                   /translation="MYIRTFWEKRIRMGKIRFRRHNQKGVSNMNKISSFTIDHTKLQPG
FT                   IYISRKDTFDNLTLTTVDIRMKTPNKEPVINNAEIHTIEHIGATLLRNNKVWGDKIIYF
FT                   GPMGCRTGFYLILFGNYESKDLIDLISWLFNEITNFQGNVIGATEKECGNYQDHNLNMA
FT                   KYESSKYLETLENIKKENLIYP"
FT   gene            complement(408938..409369)
FT                   /gene="pkcI"
FT                   /locus_tag="BRE_377"
FT   CDS_pept        complement(408938..409369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="BRE_377"
FT                   /product="protein kinase C1 inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_377"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94621"
FT                   /db_xref="GOA:B5RRI7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI7"
FT                   /protein_id="ACH94621.1"
FT                   /translation="MEEILSDCIFCKIVKNEISCYKVYEDNLILAFLDINPLNIGHTLV
FT                   IPKQHSNDILDVNNELDGQLLGVCKKVALSLKKLDFNICQGVNIYSAIGSEAGQVIFHT
FT                   HFHVIPRFQGDNLGFKRNCSIELSGDEYLDLSKKISKNI"
FT   gene            complement(409405..410766)
FT                   /gene="mgtE"
FT                   /locus_tag="BRE_378"
FT   CDS_pept        complement(409405..410766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="BRE_378"
FT                   /product="Mg2 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_378"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94622"
FT                   /db_xref="GOA:B5RRI8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI8"
FT                   /protein_id="ACH94622.1"
FT                   /translation="MIDVVFLKTLLKEKKYSDIKEELLKYDAFDISEALKKLNGSDLIL
FT                   IYRFLPKKVAVEAFSNFDQVTKNKLANSFTNKEIREMVDELNLDDVIDLLEEVPANVVQ
FT                   RFLASSTEENREIINKFLSYSDDSAGSIVTIEYIELKEYFHVREALDYIRKVAKTKEDI
FT                   YTYYITDEEKRLKGVVKIEDLMLSSDDVVISTIMKNSGFYIVKVGDGKEDVALLFQNHD
FT                   ISSVPVVDNEGRMIGVIIIDDILEVIQNLNTEDFQIMAAVTPLGKSYLDTSIFDMTKNR
FT                   IIWLLVLMISSTLTATIITNYQNLVLSLVILTSFIPLLMDTSGNAGSQASALIIRELAL
FT                   GTLKVKDFFRVLFKEICVSILVGLILASVNFLRIVFFVIPAHDEKFKIAFVVSACLMIG
FT                   LMVAKILGGLLPIMAKLVKIDPALMAGPLITTIADVVTLIAYFNIAKLVLSNYF"
FT   gene            complement(410821..412245)
FT                   /locus_tag="BRE_379"
FT   CDS_pept        complement(410821..412245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_379"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_379"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94623"
FT                   /db_xref="GOA:B5RRI9"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRI9"
FT                   /protein_id="ACH94623.1"
FT                   /translation="MNKNVFPKIYYYDQDFIDIYNKSLSWIRDKIIFSQSLEKGKKDKN
FT                   YYSENVEFIDQLQACLSSFFLVYSNGEYSPTSTIDKFYELQESSGAIRSRYDHNNNIIQ
FT                   LEGNDDGIGLPIFAWVEYNLYHKTGNKKRICDVLPVLDKYYKWIEKKFLKSNGLYSIDM
FT                   NKIFYKNSPRKNVHYPIDFNSFQVHSAYCIAKLADILNDKNLSLEYKKRFFSLKAKINS
FT                   LMWDEVDGFYYDLDVNEKIIKLKTIVGFLPLLSEIPSEDRIERMVLYLKSHEHFGTPNP
FT                   FPTLSANDPNFNLDGNGYYGSVYTYMNFFVIKGLEYCRRANIAREFTIRHLYYILDTLL
FT                   PDGKIKGHIWEAYKPMKEGPAYLDVTKKTLPEKDVICYLALFSISLMIENIIGLTISLP
FT                   DKTVYWNIPALEIMGIESLSLKKNQTTIICNKGKRGWEIKMESEKLYYFTINILNKKEK
FT                   TLPIPSGRCSMLLDKL"
FT   gene            complement(412519..413538)
FT                   /gene="bmpA-1"
FT                   /locus_tag="BRE_380"
FT   CDS_pept        complement(412519..413538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpA-1"
FT                   /locus_tag="BRE_380"
FT                   /product="basic membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_380"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94624"
FT                   /db_xref="GOA:B5RRJ0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRJ0"
FT                   /protein_id="ACH94624.1"
FT                   /translation="MINLLLVLCLLYFSCFTSEVDGEPVKVGVLVDGFFDDESFNKSAL
FT                   NGIKKVEKEFGLEVAIKESSPNSYLSDLNSLKADGSNFIWLIGYRFSDVALKIALKNPE
FT                   IKYVVVDFIYDSDLSIPKNLSAITFRVEEVAFLVGYIAASISKTGKIGFLGGMDDDFIN
FT                   IFRYGYEAGAIYANQNINIDNKYVGSFVNSESGEILANEMYVDGIDIIYYAAGLSGIGV
FT                   IEAAKKLGAGHYVIGVDQDQSYLLPEHIITSSVKDIGRILSLVISNYLKTRAFEGGQLL
FT                   NYGLKEGLLYFVKNPKKISFNLEKELDDIYSKIINGKIIVPNNKDAYNRFLKIFFNQY"
FT   gene            complement(413594..414664)
FT                   /gene="bmpC"
FT                   /locus_tag="BRE_381"
FT   CDS_pept        complement(413594..414664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpC"
FT                   /locus_tag="BRE_381"
FT                   /product="basic membrane protein C; lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_381"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94625"
FT                   /db_xref="GOA:B5RRJ1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRJ1"
FT                   /protein_id="ACH94625.1"
FT                   /translation="MSKNLSFILLFVLMFISCFFSKKKFAKSVDDQIVIGLVASGSFDD
FT                   EGYFQNFLDGVIDIKNEFGTKVIPKVITPYPSEEKMLMTASELLLEDVCELQNKGANLV
FT                   WFIGASFSDSVIRFAHENFNVLYGIIDPLHYENILIPQNFVAINFRSEEGSFLAGYLAS
FT                   KMSKSNRIGFVTGVNMDYVERFVIGFRAGAFYANPTTRVIVKRMLDEVDKVAGKLFAEH
FT                   MYVEDGVDIIFPVMGPASLGMFKAAKELGVGHYIIGVNKDQSYLAPGHVITSVIKDVGQ
FT                   AIHDYSANLIKNHKFAGGKVFDLGLEDNVIDIVKDPDIIDSGLIDVLIEIQTKIIKKEL
FT                   IVPSTEHEFDLFKARL"
FT   gene            complement(414823..415851)
FT                   /gene="bmpA-2"
FT                   /locus_tag="BRE_382"
FT   CDS_pept        complement(414823..415851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpA-2"
FT                   /locus_tag="BRE_382"
FT                   /product="basic membrane protein A; lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_382"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94626"
FT                   /db_xref="GOA:B5RRJ2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRJ2"
FT                   /protein_id="ACH94626.1"
FT                   /translation="MNKFMVLICVILIFLGCSKKTSILGTSGKALISLIVDGTFDDKSF
FT                   GEDAWRGAKVLEDEFEVEIVGRASTSSAYAGDLESLKDRGSDIIWGVGFRLQESIEHAA
FT                   LLNRDIIYGAVDVIYEDNTSIPDNLLGLSFKVEEASFLAGYLAAKISKTGKIGFLGGMD
FT                   GMVINAFRYGYQAGAKYANKDVGLTSQYLGSFVDLSLARTIALKMYKDDVDIIFVSAGL
FT                   AGLGAIEVSKELGDGHYIIGVDQDQSYLAPDNVLTSVIKNVGNSIYEITKDYLNTKSFN
FT                   GGKLLKLGLKDKAVSIVKNGFKITDELRSEIQIIENKIVNSDIIVPSNFDKYNNFLNIH
FT                   IY"
FT   gene            complement(415875..416921)
FT                   /gene="bmpD"
FT                   /locus_tag="BRE_383"
FT   CDS_pept        complement(415875..416921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bmpD"
FT                   /locus_tag="BRE_383"
FT                   /product="basic membrane protein D"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_383"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94627"
FT                   /db_xref="GOA:B5RRJ3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRJ3"
FT                   /protein_id="ACH94627.1"
FT                   /translation="MGGGLYMRWLTKVVLLFLLLSCSDSQDKVSFSNTVSVIVDGIFDD
FT                   RGFNENSSKAMTQIKEEFKVNIIQKESKASSYLSDIGGLEESGSDLIWGVGFKFSDVFL
FT                   RKALENANVNYGIIEGSYLEDVKLPQNLVNINFRSEEGAFLVGYLAAKISNTGKIGFLG
FT                   GIEGVVLNAFRYGYEAGAKYANKDIEVSFQYVGTFSDLSLGRSIASKMYSSGVDIIFAA
FT                   AGLSGLGAIEVSKELGDGHYIIGVDQNQSYLAPGNVLVSYVKCIDIVIFDLIKSYLKFD
FT                   NWRGGNLEFGLKDGALDLIFNETINLDLIRNPDFLLEIKEKIINNEITVPKDEKSYNYF
FT                   ISDHLHKR"
FT   gene            complement(416985..417458)
FT                   /gene="rpsG"
FT                   /locus_tag="BRE_384"
FT   CDS_pept        complement(416985..417458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BRE_384"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_384"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94628"
FT                   /db_xref="GOA:B5RRJ4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ4"
FT                   /protein_id="ACH94628.1"
FT                   /translation="MSRKSKKIKKKVFKDSKYDSQVIAKFVNRMMYDGKKFISESIVYN
FT                   SIDMLAEKLEEVDKVAAFNKALDNVKPLVEVRSRRVGGATYQVPVEVREERREALAMKW
FT                   IISAARKASGKSMQEKLANELVNSYNSTGAAFKKREDTHRMAEANRAFTHYRW"
FT   gene            complement(417473..417847)
FT                   /gene="rpsL"
FT                   /locus_tag="BRE_385"
FT   CDS_pept        complement(417473..417847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BRE_385"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_385"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94629"
FT                   /db_xref="GOA:B5RRJ5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ5"
FT                   /protein_id="ACH94629.1"
FT                   /translation="MPTINQLIRKPRKSQKEKTASPALQNCPQKRGICTRVMTVTPKKP
FT                   NSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAKDT
FT                   LGVNNRKQGRSKYGTKRPKA"
FT   gene            complement(417910..422043)
FT                   /gene="rpoC"
FT                   /locus_tag="BRE_386"
FT   CDS_pept        complement(417910..422043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BRE_386"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_386"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94630"
FT                   /db_xref="GOA:B5RRJ6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ6"
FT                   /protein_id="ACH94630.1"
FT                   /translation="MKEIKDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKDG
FT                   LFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELSAPVAHI
FT                   WYYKYIPSRIGLLLDITASNLNSILYYEKYIVIEPGDTDLKKMQLLNEDEYSEAKERYG
FT                   MSFSASMGAEAIKTLLENLDLDELSSKLRLQMIDKDDKTDKKLLRRLEIIENFKISGNK
FT                   PEWMIMDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNAPEIIV
FT                   RNEKRMLQESVDSLFDNSHKRKVVKGTSNRPLKSLSDALKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLHQCGIPAKMALELFKPFVIRKLIESEAVFNIKRAKSLIEQEVDEVWQ
FT                   ILDNVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADFDGDQMAVH
FT                   VPLTPAAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMERKNVMGEGRKFS
FT                   NFNHVLLAINNKSLDYNAQIYVKVGEEYIKTTAGRVVFSEALPGKISFVNKTLSDYELQ
FT                   TLISEVYVIYGSSIVIEMLDIIKELGFRYATKFGCTISMSDIIVPQEKKVYVEKANREI
FT                   AKIQNDYTKGVITGEERYNNVVSVWSKTNEELTNKMMEILKKDRDGFNVIYMMADSGAR
FT                   GSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTNGARKGLADTALKT
FT                   ADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVEALKNGEEIIEPLREKAVGSYSIERIK
FT                   SPITGEIILDVNEEITEDKIKLLETVGIDKLVIRSVLTCEAEHGVCQKCYGRDFSNNKP
FT                   VSIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKIALKNAFILNGLEGFNVQ
FT                   VDGGLLFTRKGVLRIINVIYEESIKKIKKLKVSDSQKVIKGMSLFIDKSGVEVLSSHIG
FT                   YIKIKDNKLMIVSEEQEISLKVGTRLEINVGDYVEAGRVIGTFDPFAEPIIAEVKGKIK
FT                   FKDIILGTTLKEEINLETGNIEKRITDQVFESLDPRILIINDRGVEIASYVLPGDAYLQ
FT                   VEDGQDIDIGDIIAKLSKGSEKTQDITGGLPRVNDLFETRIPKNLTEMAKVSGVVQFKA
FT                   IQKGKRLINVIDEYGVEHKHYIPAGKHLLVRDGDVVRAGDMLCDGRINPHDVLEILGGI
FT                   SLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKVKIVSVGDTNFVYNQKVDKHAFY
FT                   EQNKRVIEQGGEPAVASPILIGITKASLNIDSFISAASFQETTKVLTDASIAGSIDDLR
FT                   GLKENVVIGHLIPTGTGMNLYKRVKVRENSNSEV"
FT   gene            complement(422058..425525)
FT                   /gene="rpoB"
FT                   /locus_tag="BRE_387"
FT   CDS_pept        complement(422058..425525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BRE_387"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_387"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94631"
FT                   /db_xref="GOA:B5RRJ7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ7"
FT                   /protein_id="ACH94631.1"
FT                   /translation="MIKRVHLGQGKAEEILNLPNLIEIQLNSYEKFLQLERLKNNKPLL
FT                   NEGLESVFRDVFPMKSSNGEVALEYEKYYIEYDSISFTEKECKRKGQSYEAVLKIRLNL
FT                   QFLTTGEIRQKDVYMGTIPLMTDRGTFIVNGAERVIVSQIHRSPGVVFYKEKDLYYARI
FT                   IPYRGSWLEFEIDSKKDYLYVKIDRKKRILVTLFLRALGLDTREKIIETFYKIRKIEVN
FT                   DDTKREITGQYLATNITIKENMTYRAGDKITLQDIEDFLQNGVKEINLIDFDGYDSVPG
FT                   KHFISSDVILNCFEKEDAYFALKDGFKELSRESVMLAVYSVLLPGEPISIDNAENDLRT
FT                   IFFSEKRYDLGHVGRYKLSKKFGLDDLTTSVLTMTDIVNTISHLLRIYDGHDVLDDIDH
FT                   LGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPVVSAVKEFF
FT                   ATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPE
FT                   GPNIGLIVSLATYSKVNDYGFLETPYRKVIDGKVTDDIEYLSAIDEEKKCIAQANASVS
FT                   SDGNYTDDLVSVRISGDYTTMMPKNIDYMDVSPRQLISVSSALIPFLEHNDANRALMGS
FT                   NMQRQAVPLLFPQPPIVGTGMERIVAKDSGVVIKAKRPGRVVLATNKKIVIKPDNATSE
FT                   RDLDEYELYKYERTNQDTSFNHSVLVKNGQIVNKDEIIADGPATRYGELALGNNLLVGF
FT                   IPWNGFNYEDAILISERIVKEDLYTSIHIKEFSIEVRETKLGPEKVTADIPNVSGKILS
FT                   KLDENGIVRIGTYVKPGDILIGKVTPKSEGDITPEFKLLTSIFGEKAKDVKNNSLKVPH
FT                   GTEGTVIDVQRITKDDVGNLPPGVDEILKVYIAKKRKLKEGDKMAGRHGNKGVVAKILP
FT                   VEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKYLGEYYDVPVFESATNEC
FT                   IQEKLKKAGFNETSKAVLYDGYTGEPFENEVMVGVIYMLKLHHLVDDKMHARSTGPYSL
FT                   VSQQPLGGKAQFGGQRLGEMEVWALEAYGAAHTLQELLTVKSDDMSGRVKIYENIVKGI
FT                   PTNVSGIPESFNVLMQELRGLGFDLSIYDDNGNQIPLTEKEEELINKT"
FT   gene            complement(425611..425982)
FT                   /gene="rplL"
FT                   /locus_tag="BRE_388"
FT   CDS_pept        complement(425611..425982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BRE_388"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_388"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94632"
FT                   /db_xref="GOA:B5RRJ8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ8"
FT                   /protein_id="ACH94632.1"
FT                   /translation="MALNKEDILTWLEEAKTSEVVELITAIEEKFGVTAAAVAVAAGPG
FT                   PAAGGVEEQTEFDVMLVSFGDSKINVIKEVRAITGLGLGEAKALVESAPKAVKEGVSKS
FT                   DAEEIKKKLEAVGAKVEIK"
FT   gene            complement(426056..426544)
FT                   /gene="rplJ"
FT                   /locus_tag="BRE_389"
FT   CDS_pept        complement(426056..426544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BRE_389"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_389"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94633"
FT                   /db_xref="GOA:B5RRJ9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRJ9"
FT                   /protein_id="ACH94633.1"
FT                   /translation="MDKKINPKKVEMFNSLKEFLDGKDNIFFLDYRGLTVAELTKLRSR
FT                   VEDEKGALKVVKNNIMKRVLKDKDIEGLDSYLLGPTAVVTAFDEANVIAKIFYEFVKTT
FT                   TLKVKGGFVLGEVYDESKLSAYSKLPTKIESISLFMSVLKAPMSKLVRTLKALSDIKV"
FT   gene            complement(426555..427229)
FT                   /gene="rplA"
FT                   /locus_tag="BRE_390"
FT   CDS_pept        complement(426555..427229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BRE_390"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_390"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94634"
FT                   /db_xref="GOA:B5RRK0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRK0"
FT                   /protein_id="ACH94634.1"
FT                   /translation="MAKSGKKYIQALSKVNKLKSYNIDDAISLLKEIKFVKFDETIDVS
FT                   VNLNLKKNHTVRETLVLPHQFMKEKRILVFAKGEKAEEAREFGAAYVGDDDLINKIKDG
FT                   FSDFDVVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIASLKKGRTEFRAN
FT                   KNGVINFSVGKSSMDSKKIRENYDEFIKELLKRRPSDLKGTFVDSVYVSSTMGPSVKID
FT                   FV"
FT   gene            complement(427229..427663)
FT                   /gene="rplK"
FT                   /locus_tag="BRE_391"
FT   CDS_pept        complement(427229..427663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BRE_391"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_391"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94635"
FT                   /db_xref="GOA:B5RRK1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK1"
FT                   /protein_id="ACH94635.1"
FT                   /translation="MSKKKKEVAWVKLQVPAAQAAPGAKIGQTLGPHGVSGPQFVKEFN
FT                   ERTAKMEPGIVVPVIITVYSDKSFSFVVKTPPASVLIKKAVGIETGSKKSNTDKVGVIS
FT                   KEKIMEIAKIKMPDLNAKTEQAAFKIIAGSARSMGVEVEK"
FT   gene            complement(427719..428273)
FT                   /gene="nusG"
FT                   /locus_tag="BRE_392"
FT   CDS_pept        complement(427719..428273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BRE_392"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_392"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94636"
FT                   /db_xref="GOA:B5RRK2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK2"
FT                   /protein_id="ACH94636.1"
FT                   /translation="MSRAWYVLQTFSQYEKKIEQEIKLLISEGVFGNNVLDVKAPIERV
FT                   EEIRNGKKRIRERKIWPGYILIELDLSDQEWKSTVANIIKISGVVNFVGTTKEQKPLPI
FT                   SDEEVKSVFMLAGEIKADKSIFILYDFEEGERVRIKGGPFDSFEGVIGSIDYEKKKLKV
FT                   AVQIFGRSTPVEVDFQHIEKI"
FT   gene            complement(428284..428454)
FT                   /gene="secE"
FT                   /locus_tag="BRE_393"
FT   CDS_pept        complement(428284..428454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BRE_393"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_393"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94637"
FT                   /db_xref="GOA:B5RRK3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK3"
FT                   /protein_id="ACH94637.1"
FT                   /translation="MFKFFKESVLELKKITWPRYNEVIGSGKQVFWLVVFISVFLGVVD
FT                   YIMYLVITYIF"
FT   gene            complement(428485..428556)
FT                   /locus_tag="BRE_394"
FT   tRNA            complement(428485..428556)
FT                   /locus_tag="BRE_394"
FT                   /product="tRNA-Trp"
FT   gene            complement(428567..428746)
FT                   /gene="rpmG"
FT                   /locus_tag="BRE_395"
FT   CDS_pept        complement(428567..428746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BRE_395"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_395"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94638"
FT                   /db_xref="GOA:B5RRK4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRK4"
FT                   /protein_id="ACH94638.1"
FT                   /translation="MGKKKGKGAVGLIALVCEETGIRNYTTTKNRRNTQEKLELMKYCP
FT                   SLRKHTLHKEGKIK"
FT   gene            complement(428770..428841)
FT                   /locus_tag="BRE_396"
FT   tRNA            complement(428770..428841)
FT                   /locus_tag="BRE_396"
FT                   /product="tRNA-Thr"
FT   gene            complement(428944..429795)
FT                   /locus_tag="BRE_397"
FT   CDS_pept        complement(428944..429795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_397"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_397"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94639"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK5"
FT                   /protein_id="ACH94639.1"
FT                   /translation="MNLLNGLLNFLFLFYSNVSIINDVSSKSSIKRTIDWDAKIVYFDI
FT                   IKPVDEDRFGRVGIDSTSRLVFSVNDFKDTLIRESLFEIIIDSDSTFKDYFDSDPHLIL
FT                   YFSGLDSILKRGYMKYSEDLKNITVRYELCIFPDFINLFLGHSKPYKAFFPLMNTTVEQ
FT                   FVYTGIIIYAGDDYKSSSGSIVKLADAFFVKIYDENIKLYFDKRMVDPDALKKWGMFEY
FT                   TNDISYKNKDRIGDYPLRLIAKGVYGKNHSDIILDDYSINKIFSNENNINLLREGKFVI
FT                   IK"
FT   gene            complement(429806..430870)
FT                   /locus_tag="BRE_398"
FT   CDS_pept        complement(429806..430870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_398"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_398"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94640"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK6"
FT                   /protein_id="ACH94640.1"
FT                   /translation="MYFVMHDLYYIIKTMKLLIQVFGLVLIFSCYKSKQSDIKSLTSLL
FT                   EASNKKGLNRFLIIDRIVDIHMHNKDYEDALSFVNKGIADDEDKEYYPLYFYLIGNIYS
FT                   YIKEDEIAFTYYRYIVDNFDDYIYENSSIKLDIAKRVINLNIDAIDKINYYKLLLNDNF
FT                   ESMTNADRGNYYYNLALSLEDVQSYDEAYLYYKKLLSIPRSDLKIDSRDYSAVMTKINY
FT                   YDNPDFVVYRNLNDLISDVKRYIFSGNTAKLLSIRDKHNFFIQSWDQRSGKSNSINTNS
FT                   FLTTMIKLSSRRKNGIQFAKTFEADSSNDISYLGSSGWEHIWEWYFVFKKISYPKDPEI
FT                   NDGWAWIGVYLGKK"
FT   gene            430853..432208
FT                   /locus_tag="BRE_399"
FT   CDS_pept        430853..432208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_399"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_399"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94641"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK7"
FT                   /protein_id="ACH94641.1"
FT                   /translation="MHNKIHLKFNKKYWNFNMNKKLIYILLYLLFLSCSNKNDKYGIIL
FT                   DSNNREKLPNGSLVTIENINQDKKATINYNGIKFIVYKFTIEKFQTKKEAEEFQNSIQP
FT                   YINKYAISKKDLLPLRTSPDNYRENIIHRIPKETILKIIHIGETTEAGSLKGKWLYALT
FT                   KDGHKGYVFDYALEVFDNIPGKILTHSLDQTSQDNVIHTFKNIKYLRPLYYEKMIANNT
FT                   YNKNLLKNEYGLFFTQQNKIKINIPELNLIFKFDIIEEVKPNGFLFKSKNSKEDFILIV
FT                   KSNQNYYKAIIQVKENQLESNFVIIEQNIEKIILESERQNQNLINKLTSYENLTNTQYG
FT                   NIKFNKDKTFVWEIDNKIYNLPSSGTFEIIGFSPNLQISYKNALKLINEEGKEYFCLID
FT                   YTNNALQLIFISSKNVENKLIITNDKDKIAVIIFNNNSSNQDIITKQFQKTI"
FT   gene            432221..432877
FT                   /locus_tag="BRE_400"
FT   CDS_pept        432221..432877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_400"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_400"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94642"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK8"
FT                   /protein_id="ACH94642.1"
FT                   /translation="MKIIFIILLTQFITSLNANETIKTIKELSKTVYNFNNQEYTTNKE
FT                   KLDKLIELIDINNKNILQELQKIKNEFLITSIYFQNIKGTLIAINLAAQINFRYKVSPL
FT                   SIAIINNDFKTTKILIDYGIKINNIDETKHSPIFWAIYLNNEKIFNLLKEQGADLSLTL
FT                   KNGKTPIQAAIEIENINLIELLLKKNVYISDEYKKEIKNLKNQNIINIFKKYKTT"
FT   gene            433027..434217
FT                   /locus_tag="BRE_401"
FT   CDS_pept        433027..434217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_401"
FT                   /product="glutamate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_401"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94643"
FT                   /db_xref="GOA:B5RRK9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRK9"
FT                   /protein_id="ACH94643.1"
FT                   /translation="MNEKIKFFLTIPIGILFGLFLPSETYNALSHIFIRLTYFSLIPFL
FT                   IFAIPLGIENIIENKKFKRLFGKIIYYGILINISGVIIAIAVSTIYLPQRIPILDKNIQ
FT                   NQYLFDKKIFLETFFPKNIFTIFTNSNPNLLNIYLISIIIGASFYYAKQKGRIAKELLL
FT                   SMSNLFYNTNDIIVKISQFGIIFITAAYAVNLKNFKNYQYYINSIIFLSLWTGIIILII
FT                   IPMISYRLTKNFKLSYKNILTSLHNIIFAGLTMDTYAPYSLLIENIKNEKINIKKSIII
FT                   NIPIINFMSKFGTIFISTISFFIILKSYSSLPITIYEISYMSILAFISIFAFPHIPNSL
FT                   IYIITMLCSTYTKGIELSYSNIIPILPILTSLAIMIDFTSSIAIMQIIDFNDSQYT"
FT   gene            complement(434244..435719)
FT                   /gene="proS"
FT                   /locus_tag="BRE_402"
FT   CDS_pept        complement(434244..435719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="BRE_402"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_402"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94644"
FT                   /db_xref="GOA:B5RRL0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL0"
FT                   /protein_id="ACH94644.1"
FT                   /translation="MWFMSDFIASREEEFSKWYLDIVQKAKLVDYSPVKGCMVIMPYGY
FT                   AIWERIQSVIDDKFKESGHENAYFPLLIPYEFLEREKEHVKGFSPELAVVTTAGGEELR
FT                   EPLVLRPTSETIIWNMYSKWIKSYRDLPIKINQWANIIRWEKRTKPFLRTTEFLWQEGH
FT                   TAHETSNEAQEEALFILNLYKKFVEDYLAIPVFYGKKTEREKFAGAVSTYTIEALMQDK
FT                   KALQAGTSHYLGLNFAKAFDVKFQNKNGEMSYVFATSWGVSTRLIGALIMVHSDSKGLI
FT                   LPPKIAPIEILIVPILKKDDDVNKKILEYATTIFDILVKEKFRVEIDKDFKNSPGFRFA
FT                   ASEFKGIPIRIEIGSNDILMDCVTVARRDRDKNSKYQVSFKELLPKIKEELETMQCELF
FT                   NKALEFRNSNTKEIIGFKENDYDLFKTYIKDNLGFVLSSWCGNEVCEENIKNDTKATIR
FT                   CIPEDFQDKSLDNVTCIYCNTSAKHFVLFARAY"
FT   gene            436493..437116
FT                   /locus_tag="BRE_403"
FT   CDS_pept        436493..437116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_403"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_403"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94645"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL1"
FT                   /protein_id="ACH94645.1"
FT                   /translation="MKTQLTILMIFLTISSSIATTIDPEALNRVLNKQHSQKSSYPSNI
FT                   FGIGFGIGNPITNIIINFPYVDVDFGYGGFNGLHPNNFIPYIVLGTDIVFKEEVYHNTT
FT                   LSGGLGIGIDLSQVKPNEQDASNVTQQNNNGQNKQEEFSLTSSNNRLGFTIRLPIILEY
FT                   GFLKNVFIGFKAITTIGATMIFNPTLMEGIRFGFFGFGFIKIYI"
FT   gene            437140..437964
FT                   /locus_tag="BRE_404"
FT   CDS_pept        437140..437964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_404"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_404"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94646"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL2"
FT                   /protein_id="ACH94646.1"
FT                   /translation="MGKNTKKILTLLLIFNLYNLAFSQYDSMYFIECKQKKDGTICTTN
FT                   DKPIVPEQPKIEPEQPEIEPEQPEIEPEQPEIKPEQPEIKPEQPEIKPEQPEIKPEQPE
FT                   IKPEQPKPNNTANNNKKYKNAYSFAAGTGTGSPLINLLISVPYVDIDFGYGSFLYFNTI
FT                   NFKPYNLIAIDLIFRQLIGKSLIIGGGFGIGVDWSQANLTSPSSQKPSPYDRIAIVTRL
FT                   PLSIEYKIIKNLSLGFKIYPTLGPTIFLTEPKIVFEGMRFKFFAIGFIKMFI"
FT   gene            complement(438015..439136)
FT                   /gene="manA"
FT                   /locus_tag="BRE_405"
FT   CDS_pept        complement(438015..439136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="BRE_405"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_405"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94647"
FT                   /db_xref="GOA:B5RRL3"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL3"
FT                   /protein_id="ACH94647.1"
FT                   /translation="MSVDNIFLMKNEIKEYDWGGYGFIPSLLGQKENGLPKAEMWLGAH
FT                   KTFSSKILVDGQYVSLFNFLEIHKELLGFGSELSFLFKILSVHKPLSLQIHPSKDIALK
FT                   GFAFENNKKIVIDDSKRIYKDENPKVELVYALSDFYALKGFLPLDGINHIYRSLGLDFN
FT                   FMTHESFVKTLFDLHEFEIENIIYKVLGNLNFIDEFRAFWFNEIYKMYGIDIGLLVFLG
FT                   MYIFKLKTGEVFYTESREVHAYLKGECIELMTNSDNVIRAGFTTKHIDKDEMLKVGKFE
FT                   EGVFSLLKSENIDGCDVFKLPGTNLSLFHKCIGGESYFERVGVMILLVIKGKVQLNNRI
FT                   SLKMGDSVFIGNCDCNKELLICGNGEIFIALSL"
FT   gene            complement(439249..441000)
FT                   /gene="fruA-1"
FT                   /locus_tag="BRE_406"
FT   CDS_pept        complement(439249..441000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA-1"
FT                   /locus_tag="BRE_406"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_406"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94648"
FT                   /db_xref="GOA:B5RRL4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL4"
FT                   /protein_id="ACH94648.1"
FT                   /translation="MFLDFLKKELIFVSSTICSKDEALNFLVEEVSKKGYTNDKSVFMQ
FT                   GLLDRENIGDTSWENGVAIPHFVGDVVSISFISLLYIKGNGIKWSDDNPPVNLIFLICM
FT                   SKNQQGTGHIKSIAFIARLFENDDFKNFLKNGNNSDEIYSYIKNVENNYLESDFSISRT
FT                   ENILAVCACPVGIAHTYIAAKKLEVEAKRQGYSIKVETQGSIGIDNPLKKEDIEAADVI
FT                   ILAVDKDVDELRFDGKRVYKISTARAINDVENVIKEAFSAPVLTFKGINTLKDNSNNSK
FT                   SGFYKYLMSGVSPMVPIVASGGILIAFGISLAGVGSGGPNFEQYPFYKTITDIGGVAFS
FT                   MMLPVLSGFIAMSIADKPGLAPGLVGGVLARDVKAGFLGAILVGFMAGFIARWLARRQI
FT                   PEWLRPIMPIFVIPLISTVIIGFFMIYGGVYIAQFMGLLENGLKELQSNSDAHGIIGKL
FT                   LLGAVLGAMVSIDMGGPFNKVAFLFGVGMIPSVPQIMGMVASAIPVAPMAMGLATLIMP
FT                   QLFEEEERESGKISFLISFIGISEGAIPFAASDPARVLPSIVLGGAVSSIIAAFWGVAD
FT                   HAPHGGQ"
FT   gene            441125..441805
FT                   /locus_tag="BRE_407"
FT   CDS_pept        441125..441805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_407"
FT                   /product="uncharacterized conserved protein in borrelia"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_407"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94649"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL5"
FT                   /protein_id="ACH94649.1"
FT                   /translation="MKKIIYCCLLLSCINLYSLNNEIKNKENKISNEKTQKKDEINKKN
FT                   SPLKEKSEKNKNSIFSINRGFIYSTGIGLGTGFFLNANNNHIIFRPYYTFATNNLDFMA
FT                   VCMILMIEDYNVSKKIQFSSTYIGIGINWNIINFFQKLKYLSTSMGIGGRFYLSTNLIG
FT                   NFRFYNKIPYVVEPYIFFEFSTKESISYLNIYSKVECLFLDTFNISFNFGIRYNLKNKK
FT                   GENQ"
FT   gene            441802..442686
FT                   /gene="nucA"
FT                   /locus_tag="BRE_408"
FT   CDS_pept        441802..442686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BRE_408"
FT                   /product="endonuclease precursor"
FT                   /EC_number="3.1.30.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_408"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94650"
FT                   /db_xref="GOA:B5RRL6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL6"
FT                   /protein_id="ACH94650.1"
FT                   /translation="MKKKSKILIILYISILIGFLFLHQNPKIVNKIKEITSNYLEEIKN
FT                   RFYRPQIPIKLQEEYLLPQGYLTTQVLHKKYYSLGYAEHARQSEWVAYQLKREMVELAL
FT                   ILVKEKKITRSKKFFEDPDIKGIAPKLSDYLHSGYDRGHIVSSADMSFSKEAMRETYFL
FT                   SNISPQKSSFNSGIWSKLEQKVRKWAISKEKIYIISAGILTENQGFIGNNKILIPKNFY
FT                   KIVLSLNNKSNNYEIVAFIIPNKKAKDTDLKNYVVNVNSIEEKTKIDFFAKLDAKIKKI
FT                   IKMQKNISSWELK"
FT   gene            442683..443447
FT                   /locus_tag="BRE_409"
FT   CDS_pept        442683..443447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_409"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_409"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94651"
FT                   /db_xref="GOA:B5RRL7"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL7"
FT                   /protein_id="ACH94651.1"
FT                   /translation="MKTLFSKLNFFLLTTISLGIIVISIFIYYLNTTINFYNYLSKIYN
FT                   TNTLALVNKFFIFNIGIIGSIWTYINYKRTNNIQFVFFYCFICFYIIEPIAIFKYYLLS
FT                   NTLSLELYSLMKFYHLIVIFSLLNLFFLSLYICDFQIKSITYTIYLIFTFSMIYSYLIP
FT                   INAYQHTNDFFSPIKNNKLYIYLFLLLILINFLVACLRKKNLSYLLLFVSTSLIVLGTY
FT                   LNLIEIPYAFIPISIGVPIYLQESGKLFFYWL"
FT   gene            complement(443467..444063)
FT                   /locus_tag="BRE_410"
FT   CDS_pept        complement(443467..444063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_410"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_410"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94652"
FT                   /db_xref="GOA:B5RRL8"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL8"
FT                   /protein_id="ACH94652.1"
FT                   /translation="MFNLIFFDEDIKYEFYRKFFHISSLVFLLLYKVNLWIGFVVSLFF
FT                   MVIYLILELLRVMQKKLFFLGNISEILVKTREVPFCKIYLSPIFLVVSMFCTYFFIAKP
FT                   FSYIGIFSACIGDGLASLFGKLIPSFKLVNNKTFAGSISVFVVAFIVFYYFVPNFVMAL
FT                   IVGMGAMLVELFDFAKYDNLFLPVGVATLSFLLVT"
FT   gene            complement(444063..445082)
FT                   /locus_tag="BRE_411"
FT   CDS_pept        complement(444063..445082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_411"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_411"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94653"
FT                   /db_xref="GOA:B5RRL9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRL9"
FT                   /protein_id="ACH94653.1"
FT                   /translation="MNKYLLFFILILMLVACASKRKNLMEEHGIFALIDTNKGTIKIKL
FT                   YYKIAPLTVMNFIGLSEGLIENSVTNQPYFDNLIFHRVVDGFVIQTGDPTGTGTGGPGY
FT                   VFPDEFTKGVRHDEAGVVSMANAGPDTNGSQFFITLADNLTYLDFKHSIFGKVVEGMET
FT                   VRSINLGDKIERVKIIRVGDHANSFKVNNEEFLKLKSSYETKKLKEYEKHMAWQFEIID
FT                   RDCKDFEKDESGILYKVIKQGNGKCAKNGDIVRVDYEGFLLNGFKFDSSLERGNIMEFE
FT                   LGLGRVIKGWEIMLSNMCEGEERVIIIPPNLAYGDRDFTSMIKANSFLKFNIILRKVN"
FT   gene            445230..446093
FT                   /gene="cheR-2"
FT                   /locus_tag="BRE_412"
FT   CDS_pept        445230..446093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR-2"
FT                   /locus_tag="BRE_412"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_412"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94654"
FT                   /db_xref="GOA:B5RRM0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM0"
FT                   /protein_id="ACH94654.1"
FT                   /translation="MLNINDELLIKFCNFIYDNSGIRFDEKNKIVLKSRINDAIHELKN
FT                   INTPQQLYELIISDKFKKEYFLDLVTTNLTRFFRNEAHFKTFEKFIIPQLINIKTKENK
FT                   NRIVIWSAGCSTGEEPYSLAFVLKYHIPENFEFIIIASDLSLKSLMIAKDGHYSSQQCE
FT                   HIPAEYKKYIKPHMDGYKVVNDIKKHIRFDYHNLNFESGFSNIDVIFCRNVLIYFDEKS
FT                   QIKVLKKFYSSMAMKSYLFIGHSESLFGLNLPFKFLKTPWAIIYEKDDESVPNEKKLSF
FT                   QNKYKL"
FT   gene            446129..447289
FT                   /gene="cheB-1"
FT                   /locus_tag="BRE_413"
FT   CDS_pept        446129..447289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB-1"
FT                   /locus_tag="BRE_413"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_413"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94655"
FT                   /db_xref="GOA:B5RRM1"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM1"
FT                   /protein_id="ACH94655.1"
FT                   /translation="MRITIYVLIIDSSSVNRKAISDIINSSSKLKVIATAANAEFALKK
FT                   LKQDPDVILLGLEKETIKDISLIQKKQNINNKIPVIILSSNKDLAINALLQGADDFIIK
FT                   IDSKLDKIKDKIIDLLTIYGNKSIKNKIITNINCKPETYIPSQNEKDKKNNLNIINIRE
FT                   HNLKKTNTKYIVTSLNQKQIINDQDLKKLKNRKFEMVVIGISTGGPEALKIILSEISKN
FT                   FPIPIVIVQHMPKGFTTEFANNLNKICNLTVKETKNNEILQKGCIYISSGGYHTKINKI
FT                   NDNYQIEVFDAENVNGHKPSIGVLFKSISENVKEKVIALIMTGMGNDGSREIGDIKKAG
FT                   GVTIAQDEKSSVVFGMPKIAIEENNIDYIVSIGHVVKLLETILLDG"
FT   gene            447313..448521
FT                   /gene="traB"
FT                   /locus_tag="BRE_414"
FT   CDS_pept        447313..448521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="BRE_414"
FT                   /product="pheromone shutdown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_414"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94656"
FT                   /db_xref="GOA:B5RRM2"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM2"
FT                   /protein_id="ACH94656.1"
FT                   /translation="METAKENTKDYFLHVSTLDIDHHKIYVLGTAHVSKKSSQDTANLI
FT                   DILKPNFIAVELDEARYHAILQTDENEKWRNLDIYKVIKQGKAFLLIVQIILSNFQKKL
FT                   AKEQGISPGEEMKTAILKAKEHNIPLILADRKVETTLKRAWNCVPIFEKTKIISSLFSF
FT                   SDIKVTEDEIEKLKEQDALSNIMEELAKEIPTVKKVLIDERDEFIASKILEGSGTILAV
FT                   VGAGHVKGIIENLKEIQDTKKIINIEELNTIPKNNFSISKLISYLIAISIIILIASSFY
FT                   FKDFEFAYKNLEIWIICNSVFAGIAAILLRANIITILTASIGAPIFSLMPFIGTGMVAG
FT                   LVEAYINKPKIKDFESLQEDLHNIKGYFKNKVTKILLIVFFVNIGSAIGTIVGFKFLLN
FT                   IFG"
FT   gene            448561..449208
FT                   /gene="adk"
FT                   /locus_tag="BRE_415"
FT   CDS_pept        448561..449208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BRE_415"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_415"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94657"
FT                   /db_xref="GOA:B5RRM3"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRM3"
FT                   /protein_id="ACH94657.1"
FT                   /translation="MKLVFLGPPGSGKGTIAKILSNELNYYHISTGDLFRTNIENDTPL
FT                   GKEIKQIVENGQLVPDSITIKVVEDKINTIDNRDNFILDGFPRNINQAIELDRLLENIK
FT                   IINFLINEKLLVKRLSGRRICQSCCKIFNIYTLPTKEKEICDFCQGILYQRKDDTKESL
FT                   KIRLQEYNLQTKPLINFYSNSNRLNNIDASKNINEVQKNLMEIISKIEKKLV"
FT   gene            449303..450379
FT                   /locus_tag="BRE_416"
FT   CDS_pept        449303..450379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_416"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_416"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94658"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM4"
FT                   /protein_id="ACH94658.1"
FT                   /translation="MLKKLLIILIFLQTVSTYSEEETKQKLETKENSTTKENSETKQNQ
FT                   TRYFYIDFQTAYYPPHALRISNSKFSPSFITPKFTSTDPSKQIEPSSWESAKLISHFGG
FT                   HKFIPLQNNFDSIFFKNNGIDLDVNIGLSPILALSHAKIGITPIAFLNIYTESEFGIGW
FT                   EAFGFKGIGVHLGNGKYSSKPEFYYEFTTGGRLQFDLNSILDGEWTHVITVVGNNMKLR
FT                   YNPHAKNNQLWKYKADEGKNINGTIINPYALLAYQMPMPLNLVGFLYEGQTYIGNARHV
FT                   STMQDKGWGSDFFYHNFSLIAKIQVIENLTLDVLFKFSTAPSYTEDTVGLADITKKVST
FT                   NNSYVYYDSIGLSLTYKI"
FT   gene            complement(450395..451327)
FT                   /gene="rrp-1"
FT                   /locus_tag="BRE_417"
FT   CDS_pept        complement(450395..451327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrp-1"
FT                   /locus_tag="BRE_417"
FT                   /product="response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_417"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94659"
FT                   /db_xref="GOA:B5RRM5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM5"
FT                   /protein_id="ACH94659.1"
FT                   /translation="MMKGIILDNFDEIAIEPQKLLLVDDTPTNLDLLLDILQNDYDIRV
FT                   ALNGFDALKQVEIDKPDLILLDVLLPDVSGYEVCRRLKNDPETRDISVIFISSRNSTDA
FT                   QLEGFNVGGVDYILKPFNGRIINARIKTHLELKRLRDYFKNLSRIDGLTQIPNRRFFTD
FT                   KFAKSWMQALEHQDNVIVGMLDIDYFKKYNDNYGHTNGDECLKLIAKSLNRIAIKYKID
FT                   VARYGGEEFILFSVNKSLEEMIKSVSFLIEDIRNLGIVHEYSDISHFVTVSIGLAEQVP
FT                   QDSNFTNIIKLADDKLYEAKISGRNQFKY"
FT   gene            complement(451324..455769)
FT                   /locus_tag="BRE_418"
FT   CDS_pept        complement(451324..455769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_418"
FT                   /product="sensory transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_418"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94660"
FT                   /db_xref="GOA:B5RRM6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM6"
FT                   /protein_id="ACH94660.1"
FT                   /translation="MCNLKIFLFVLFFSYISLPAKQTLKFKLVDQYYPLYYKNKEGKMT
FT                   GMIFYLLNKWAQDHHYEISVEAIDYLDQNKIEDDVVYLGLTYNSDLSEHLYFKNEIGKC
FT                   VTALVYNSKEEQKITNPFLSKEFRVGVVKNSIYKDILKLHGHIDNVFSFSDTQQLFSAL
FT                   RDNKIDLIYGSYKSLYFLWHIYFDPSFLKVFNSDYFYSFGIRVAISKKAVNELKNLDID
FT                   LLSYMKALSKSEYASFKELDYLFNLDVGIYNDYPPLSFINSKGQLSGILVDLWNDLSRE
FT                   YAFSLKFVGFPKESIKLSLDDKDISVWGGIIEDNNILTSKIYKVTDPICMLDFNFYLTN
FT                   SRNSDKILNSQIVDFHLSGIRLDKNTDIVNNFADIINNSYGFIENLITTNYLLRLHGYN
FT                   NILKFKDLSFNVQKPLILASNIRKLQLFSYMLDALTSNILFDTLLEIDKNWFTQNEIKD
FT                   YQSSCYSHVNSSNFNIEEKIWLEHNKKLNLAVKNWYPVDYVNSGRYKGINEWLIKKIKR
FT                   LTNVDFNIINVRERELKDLIKNGQIDILSSNLDSANLDYFFNIKSVSGIPLYIFSQKTN
FT                   LFIPKSSDRIAVLNFLYSNKLETQIGAQLVQVESFKEALDLIYKRKVDGILSDEYTATV
FT                   NFEDLNVRDLEKIVNVSDLSFNLNIAVYNQDYILRRIIQKILFRTNVNNKLYFDDWVFN
FT                   VHESSKDMKLKKSGILVLTIVFFVLTILMFFLFRLLKEIGFRKKMYSSVISEKKVIEDA
FT                   IVAKTIFLASMSHDIRTPINGIIAATELLDNTDLLGVQKEYVQMINYSSTSLLSLIDEI
FT                   LYISKIDMNGIYIENNEINLEYEIEEVVKSFQSQSAKHNLDLIFYSESDLNNYLIGDRS
FT                   RLKKVLINLISNAFKFTKEGIIIINYEIICTREGDNGDRIFTIEFKVIDTGKGIKKGNI
FT                   PVIFELFKQGDDFDAKEYEGTGLGLAISRKLVSLMGGPGITVESEVGKGTTFSFMLPFV
FT                   LGNEINDKEKSKFKLIRNKKILTLFSSNKAVVLLNEISEILDYKDNVRNFYSYEDAYEE
FT                   CSKYPYYDFIFINVDNADLQKCLKFAERLEKLNLDAKIVFVFYYLKNEEIIDFKYEYIQ
FT                   KPFKRWGFYSDWIINGSLVDAPLIDNSGIFKLKDNICILIAEDNEINQKILKNILIVIG
FT                   VREDSIDIVDDGFKAIDYLKTNRYDIAFVDIRMPKCDGFTVSEEIRRYEKQNNLNSCVL
FT                   IAVTAHALREYKDRCLESGMNDYLAKPIHIKSIKYILKKYLYIDEVKNNNIIEYKNLDK
FT                   LDDLDINRALQDLDISYDMYIDLCRGFVVMSDNIIRDLDEAFNLNNVVLIKELAHSIAG
FT                   ALGNMRSNLFDNFKQIENGTDSIEELRVLYSKARQNLIMLVKNIRDRILNVVDIDDYEK
FT                   LEFQSNNDFLIIMQKLLNEIENRNPKEYKKILETLKKYHWDDDNIVLFDSLVECLRVYN
FT                   FKESVDIIKRMMSHNRIGKS"
FT   gene            complement(455827..455939)
FT                   /locus_tag="BRE_419"
FT   rRNA            complement(455827..455939)
FT                   /locus_tag="BRE_419"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(455959..458902)
FT                   /locus_tag="BRE_420"
FT   rRNA            complement(455959..458902)
FT                   /locus_tag="BRE_420"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(459041..459928)
FT                   /locus_tag="BRE_421"
FT   CDS_pept        complement(459041..459928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_421"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_421"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94661"
FT                   /db_xref="GOA:B5RRM7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM7"
FT                   /protein_id="ACH94661.1"
FT                   /translation="MPRKFDVISFILKEDIAMNANYEKYKMLVFDLDGTLLNSKHEITP
FT                   LTLKVLLRLRDDFHIIIATGRRLYEIRDILLQLQDLRINEGYIVTANGSEVFLNNDLLL
FT                   RCSIDYGIVREIFKVDREGIDINLYDLHDWYSDREIRSPIMNHFIQNLGIKPIITDLSE
FT                   LKINSCSKIVYYSHDLLRLEEFANTLREKNFKGISMFYSANDLFEITNVDASKYNAIKN
FT                   ISLCECIGVDSILAFGDNGNDYEMLKNVGKGILMKNAHDRVKNSLPNNELTKFCNDDDG
FT                   VAKFLIEFFDLDIN"
FT   gene            460014..460538
FT                   /gene="hpt"
FT                   /locus_tag="BRE_422"
FT   CDS_pept        460014..460538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="BRE_422"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_422"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94662"
FT                   /db_xref="GOA:B5RRM8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRM8"
FT                   /protein_id="ACH94662.1"
FT                   /translation="MSDKISTLFTEKKIKSKIKELAQKIRSYYKDKNNVVFISLLKGFF
FT                   MFFADITREIGLNVKIDFLQASSYGNKTLSSLNVLIKKDIEINIENCYVIIFDDIVDTG
FT                   LTYKKIIAHLQTKKPKEIKIFTLFNKPSRRLTEIKIDYTDFEIQNDFIVGYGIDFNEKH
FT                   RTLRSVAKINQ"
FT   gene            460548..461831
FT                   /gene="purA"
FT                   /locus_tag="BRE_423"
FT   CDS_pept        460548..461831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BRE_423"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_423"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94663"
FT                   /db_xref="GOA:B5RRM9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRM9"
FT                   /protein_id="ACH94663.1"
FT                   /translation="MAIYAVVGTQWGDEGKGKIIDFLSSKIDYVVRFNGGNNAGHTIVV
FT                   NDKKFIFNLLPSGVLQGAKCILGPSVVIDPLILIQELEVLKNNNIKTEIFISDKAHIIM
FT                   PYHIKFDELSEQKKGIHKIGTTKKGIGPCYADKINRIGIRTIDLLNTEIFANKLKTNLE
FT                   EKNQIIEKIYNDKPLDYDDILNTYKKYIEILKSLITNTEKILHHAINSEKYILIEGAQG
FT                   TMLDIEHGTFPFVTSSNTLITAAAGCGIPISKIKQKIGIIKAFSSRVGSGPFVTEISNS
FT                   IGDIIREKGQEYGSTTKRPRRIGWLDLLTIKKAIALNELNHLALTKLDILNNIESLKIC
FT                   IAYEFQGKIYDYIPTSCETIEKVKPIYKVFKGFKEDISNIKNYDDLPIEAREYIEFIEK
FT                   EVGIQISILSVGSEREKTIFRNQEWSNI"
FT   gene            461816..463210
FT                   /gene="purB"
FT                   /locus_tag="BRE_424"
FT   CDS_pept        461816..463210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BRE_424"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_424"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94664"
FT                   /db_xref="GOA:B5RRN0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN0"
FT                   /protein_id="ACH94664.1"
FT                   /translation="MEQYLNPLKSRYASKEMLYIFSPKFKYTTWRKLWYNLALVQQELG
FT                   ININNDQLNELSKQIENIDFKLVAKYEKKFQHEVMAHLYAYADLVGEDAKKILHLGVTS
FT                   AYLMDNTDLIQIKEALLLIEKKLTEIIIILKQFSIKYKDLATLAYTHLQEAQLTTLGKR
FT                   SSLWLQSLIFDFRELKFILSNMCFRGVKGTVGNQNSFKELFLSNFDKVKDLDINLAKKM
FT                   GFEKVYKITGQTYDRKFDSSILNFLSNLAQSAHKITNDIRFMQHLREIEENFEKHQIGS
FT                   SAMPYKRNPIYSERVASLAKFIISLQSSGGLIATTQWLERTLDDSACKRLNIPQAFLAT
FT                   DAILILLNQIFSNIKVNERIIEKHVQTEMPFILTEDILMKATKNGGDRQILHEKIRTYA
FT                   MQVKENLYSGKNENNLIQLILNDKSFKLTSKDINEILNPNKNIGFASSQVEDFIKEIID
FT                   PIIKNQ"
FT   gene            complement(463216..463806)
FT                   /gene="mag"
FT                   /locus_tag="BRE_425"
FT   CDS_pept        complement(463216..463806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mag"
FT                   /locus_tag="BRE_425"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_425"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94665"
FT                   /db_xref="GOA:B5RRN1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN1"
FT                   /protein_id="ACH94665.1"
FT                   /translation="MNLVFVLFRIVLMNREFFMQDAVIVAQSLLGHLLVRKINEIEIIS
FT                   RIVETEAYMGVIDKACHAYGGKITNRTSAMYNVGGYAYIYMIYGMHYMLNVVASDKHAP
FT                   HAVLIRGIEPIFPKIDRIFTNGPGKLTKFLNIDLKFNKIDLLNDSKLFLRKSLSLNFEI
FT                   VCAKRINVHYAGEEYANKLWRFYIKGNKFVSKY"
FT   gene            463937..464010
FT                   /locus_tag="BRE_426"
FT   tRNA            463937..464010
FT                   /locus_tag="BRE_426"
FT                   /product="tRNA-Ile"
FT   gene            complement(464334..464407)
FT                   /locus_tag="BRE_427"
FT   tRNA            complement(464334..464407)
FT                   /locus_tag="BRE_427"
FT                   /product="tRNA-Ala"
FT   gene            complement(464493..466031)
FT                   /locus_tag="BRE_428"
FT   rRNA            complement(464493..466031)
FT                   /locus_tag="BRE_428"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(466526..467200)
FT                   /locus_tag="BRE_429"
FT   CDS_pept        complement(466526..467200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_429"
FT                   /product="uncharacterized conserved protein"
FT                   /note="RGD and UPF0011 motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_429"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94666"
FT                   /db_xref="GOA:B5RRN2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN2"
FT                   /protein_id="ACH94666.1"
FT                   /translation="MLYIVGTPIGNLGDITYRAIDILKLVDVIFAEDTRIAKRLLSHYG
FT                   IVKKLISCNAITEYKRIDLLLSYLSSGSNVAFVSDAGTPCLSDPGSLLVDAAFKNGYKI
FT                   CPIPGISSFNTVISVNPFRDKVIVFEGFLPNKGVKRVKRIEELYHRGDAFILLESSHRI
FT                   LKLLSEISLVDLNANVLVGREMTKLYEEYKIGKPLELKKYFEEHNKDKGEFTILVSRKS
FT                   KN"
FT   gene            467457..467774
FT                   /locus_tag="BRE_430"
FT   CDS_pept        467457..467774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_430"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_430"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94667"
FT                   /db_xref="GOA:B5RRN3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN3"
FT                   /protein_id="ACH94667.1"
FT                   /translation="MLKLIRKIFVIYFLCITLAGIAMVFIDSKFSEKETIQDGKSQIIK
FT                   HTISPNLIMLTSAVGGFLGTYSGVWLFNYEKDNFYLSWGSLLILIYNIGLIISIYSKTK
FT                   E"
FT   gene            complement(467781..468170)
FT                   /locus_tag="BRE_431"
FT   CDS_pept        complement(467781..468170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_431"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_431"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94668"
FT                   /db_xref="GOA:B5RRN4"
FT                   /db_xref="InterPro:IPR015067"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR037081"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN4"
FT                   /protein_id="ACH94668.1"
FT                   /translation="MISGLNPTLRLFKEHRILYSNMERGLKPLLEVDNFINKYIQNKEG
FT                   LEIYDKIVGKAAAVIIYNIGLQNVQAGVISQPAKDFLESRGIRVSFKKLVEKINDKTEN
FT                   LIESLENPEEVYKYLIKRGIIVSNF"
FT   gene            468284..468862
FT                   /gene="pepQ"
FT                   /locus_tag="BRE_432"
FT   CDS_pept        468284..468862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="BRE_432"
FT                   /product="proline dipeptidase (PepQ)"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_432"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94669"
FT                   /db_xref="GOA:B5RRN5"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN5"
FT                   /protein_id="ACH94669.1"
FT                   /translation="MMLIPKENIYSKIEVKKSIFLSYIFHVTTREEINKILKKYKLKFK
FT                   TATYVVHGFRIGNLNSFTNGMSDDKEPKHTAGKPTLEAILNKNLTDTLIITVRYFGGTL
FT                   LGKQGLNKAYSKSAYEVINKTNLIEKEENEILSLNLNYNQYNLLIRMQNKIEIKIIDAS
FT                   FLDKIHTKIQFNIKNKNNILKFLQGNSLL"
FT   gene            469035..469471
FT                   /pseudo
FT                   /locus_tag="BRE_433"
FT                   /note="uncharacterized conserved protein"
FT   gene            complement(469469..470251)
FT                   /gene="spo0J"
FT                   /locus_tag="BRE_434"
FT   CDS_pept        complement(469469..470251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spo0J"
FT                   /locus_tag="BRE_434"
FT                   /product="stage 0 sporulation protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_434"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94670"
FT                   /db_xref="GOA:B5RRN6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN6"
FT                   /protein_id="ACH94670.1"
FT                   /translation="MDESLKMVDINLLDIDKSQPRKSINLAELEELSISIKENGILQPI
FT                   IVYPNNGRYNIIIGERRFRAAKLSGMSQIPVIEIEASTKDKDFMSLIENIQRENLTPVE
FT                   EAYAYKNLMDKHALTQKALSEKIGKNRSHVANLVRILELEQEILNSLHKKEISLGHAKV
FT                   LLSLKDNQDRYALYLLIIKKKLSVRDAENYVKNLYKTINDKSEISRDPFLNSIKEFLIS
FT                   RIQTKISIKGSKEKGKIEISYFTSSDLKRIISIFENIK"
FT   gene            complement(470388..472835)
FT                   /gene="gyrA"
FT                   /locus_tag="BRE_435"
FT   CDS_pept        complement(470388..472835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BRE_435"
FT                   /product="DNA gyrase, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_435"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94671"
FT                   /db_xref="GOA:B5RRN7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN7"
FT                   /protein_id="ACH94671.1"
FT                   /translation="MIGALMAIENNKEQVLNIKIEDEVRTSYLNYAMSVIVSRALPDVR
FT                   DGLKPVHRRILYSMHEMGLKSDKSFKKAGRIVGDVLGKYHPHGDQSIYEALVRLAQDFS
FT                   LRYPIVSGQGNFGSIDGDPPAAMRYTEARMAKIAEELVIDIDKQTVNFKPNYDDSLLEP
FT                   EVLPAAFPFLLVNGSSGIAVGMATNMAPHNLREVCDAIIYMLEHDDVSIYDLIAIIKGP
FT                   DFPTYAEIIYNENLIKAYTTGKGSVVIRARYHIEEKSEDNISIIITQIPYAVNKSSLLM
FT                   KIALLIKEEKLEGVSDIRDESDREGIRIVLEIKKGFDPHVVMNLLYEYTELRRNFSINN
FT                   LALVNGIPKQLNLRELISEFIEHRKNILRRRVEFDLKRAQEKAHILEGLNIALRNIDRV
FT                   IEIIRFSRLVKDARECIMREFQLSEIQANSILDMKLQKLTSLEVAKIEEDFQVVLALIK
FT                   DYEDILISPSRIVNMIREEIINLSLKFGDDRRTKIIYDEEVLKTSMSDLMQRENVIVIL
FT                   TKQGFIKRVLQDEYKLQGIGGKGLGSFDLQDSDQVNVALCVNTHDFLLMISNEGKLYVI
FT                   NAYGIKDSSRISRGQNIRELINLGEKEEILAIKNCSELSVDNYLLITTANGKIARIETE
FT                   GFKTVKSRGVIIMKLDDKDFVTSAEIVSRDDKIICISKKGNAFAFSSNDIRLTHRGTQG
FT                   VSGMKVREGDMLIKALAIKQGSHLLIMSENGYGKRLEVSKVTGLKRGSTGYTCYKKSDE
FT                   KAGEVVDAITVSQDDEILLISKSSKVLRTLVDKISEQGKDARGMQVLSLDEDKLVAVSK
FT                   FIK"
FT   gene            complement(472832..474751)
FT                   /gene="gyrB"
FT                   /locus_tag="BRE_436"
FT   CDS_pept        complement(472832..474751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BRE_436"
FT                   /product="DNA gyrase, subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_436"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94672"
FT                   /db_xref="GOA:B5RRN8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRN8"
FT                   /protein_id="ACH94672.1"
FT                   /translation="MCGRFMSYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEI
FT                   VDNSIDEALAGFCDRIEVVINSDNSIMVNDNGRGIPTDIHEEEGISALELVLTKLHSGG
FT                   KFNKGTYKVSGGLHGVGVSVVNALSSFLEVVVSREGKLFKQTYSRGIPTSEVEVVGVSF
FT                   TTGTKVTFFADSEIFETLKYDFETLSRRLRELAFLNDKIRISIEDRRLGEEKFLEFYFE
FT                   GGIKAFVDYITNNNKNIQSSPYFIEGVCNDVIVSVGLKWTEGYSDNTLSFVNNINTKEG
FT                   GTHVAGFKSGLLKAMSETFRDSKISKKDIPNLTLDDFKEGLTAVISIKVPEPQFEGQTK
FT                   GKLGNSYIKKIVETIVYDGLLRIINENFVEIDIILNKAIRAARAREAARKARESERKKS
FT                   AFESLALPGKLADCTSKNPAEREIYIVEGDSAGGSAKMGRDRFFQAILPLWGKMLNVEK
FT                   TREDKVITNDKLIPIIASLGAGVGKAFYIEKLRYHKIIIMADADVDGSHIRTLLLTFFF
FT                   RYMRELIDNKHVYIAMPPLYKIKHENKVHYFYDDFEKETFLGSIDVGKRNKVSLQRYKG
FT                   LGEMNPTQLWETTMNPATRKMKLIEIDDAIQAEKIFVTLMGDDVEPRREFIEQNALDVV
FT                   NLDV"
FT   gene            474985..476439
FT                   /gene="dnaA"
FT                   /locus_tag="BRE_437"
FT   CDS_pept        474985..476439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BRE_437"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_437"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94673"
FT                   /db_xref="GOA:B5RRN9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRN9"
FT                   /protein_id="ACH94673.1"
FT                   /translation="MQEGKNIWSLILAAIRKELSEEEFYIWFENLYFIDAIGENIKIAT
FT                   PNSFHKNQVEKRFSKRIKEILIEKGHSTINVEFIHSQNELKDHNTESKDIPLKAITHQQ
FT                   DLQTKNKDIKTHAKNIINNTKQYSIKEEIHIKYRNPFLKKKYTFENFIIGTNNKLAYNA
FT                   SLSIAKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHKEFKILYVTAENFLNEFVE
FT                   SIKTNETKRFKKKYRHLDMLLLDDIHDLQKKEGIQEELFHTFNALYEDNKQMVFTCDRQ
FT                   PSELVNFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKNILNLVAKKVT
FT                   TNIRDLEAAVTKLKAHIDLEDIEIDTNIVDKIIKEIIAYENDHTNTPNKINIENIKKVI
FT                   LRELKLTNKDIEGNSKKPEITKARHIYAYLLRNFTELSTIEIGKIIGGKTHSTVLYSIN
FT                   KIDKDRNKNLEINNLIIELMNKINKN"
FT   gene            476703..477863
FT                   /gene="dnaN"
FT                   /locus_tag="BRE_438"
FT   CDS_pept        476703..477863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BRE_438"
FT                   /product="DNA polymerase III, subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_438"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94674"
FT                   /db_xref="GOA:B5RRP0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP0"
FT                   /protein_id="ACH94674.1"
FT                   /translation="MNEKFILCDTEQISDEIDKAKSIILNRNINDIWSAILLEIKSSNL
FT                   TIKATDRNIFFESTIPIVSTDNFNVLINASNLADAVKALNLYDELKMKFKEDENKLDII
FT                   GESDNNNENYINDHLSEPTFSTEEIENYNYDINDEVYNFAFELNQKDLKRIINKVAFSA
FT                   SHDESKNALNGIYFTKDSNSVLTLVSTNSYRMSIYKTDLIFEEDVNFIVPVKMFNLLKQ
FT                   MITGEGIIKFKVSDKKFYVEFNNYKIACSLISGNYPDYESIIPNEYTNRALIDVFMFKD
FT                   RLSRVNSYTDKRSKKVILNFSVNQLKLMAEDPITGRKGEFFMQGSNYDYAGTEEMLAIN
FT                   SVYITEAMGVFDTPKLEIKFSSGGLLKLNEEDKCDFIHLIMPLMFN"
FT   gene            477884..478951
FT                   /gene="recF"
FT                   /locus_tag="BRE_439"
FT   CDS_pept        477884..478951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BRE_439"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_439"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94675"
FT                   /db_xref="GOA:B5RRP1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP1"
FT                   /protein_id="ACH94675.1"
FT                   /translation="MVKKIEFFNFKNIENQVINFDFDNIYFCGENGSGKTNILDAIYCL
FT                   AFASSFLVNTDKELITYGEREFYLKCFYQTKEKNGEINLSVRNDKKEIKVNNSIVRDRR
FT                   DLILNIPAIIFSNHDIDFIIGTPMKRRWFFDQAMSFISLSYLDSLRKYRKILKQRNLIL
FT                   KQRDKDLLKIYNETFVDCALEITEMRKNFVEHFCRFFQYYCSLIFDVSCNLEIKYFPSV
FT                   TCCSKDKFFEILCLREKDELYSETTLIGPHRDLYEILSEHRVFTDHASTGQIRVLALIY
FT                   RLVQVIIFNDKFNMSPILLFDDVFLELDSIKRKKVFEILPKDSQCFFTFLDDCYDVNRE
FT                   SNFIVYRMNNGRFEL"
FT   gene            478932..479231
FT                   /locus_tag="BRE_440"
FT   CDS_pept        478932..479231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_440"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_440"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94676"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP2"
FT                   /protein_id="ACH94676.1"
FT                   /translation="MEDLSFKKVADVLKNYLNTNICSNKKLSANLLLSQNWQVIFKELA
FT                   DKVKLLNLKDNKILFVAVKNSSILYNISCNKAKIIQSIKESAGLEILDIKVLIR"
FT   gene            479326..479481
FT                   /gene="rpmH"
FT                   /locus_tag="BRE_441"
FT   CDS_pept        479326..479481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="BRE_441"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_441"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94677"
FT                   /db_xref="GOA:B5RRP3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRP3"
FT                   /protein_id="ACH94677.1"
FT                   /translation="MKRTYQPSRVKRNRKFGFRARMKTKSGRLILARRRAKGRSKLTVS
FT                   DEKKKY"
FT   gene            479462..479806
FT                   /gene="rnpA"
FT                   /locus_tag="BRE_442"
FT   CDS_pept        479462..479806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BRE_442"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_442"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94678"
FT                   /db_xref="GOA:B5RRP4"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRP4"
FT                   /protein_id="ACH94678.1"
FT                   /translation="MKKRNINIKSRLEIQELFKKGQFVKIEGINIFYRFTSLAISRILI
FT                   TFPRVFKGAVKRNRVRRVFKECFREYFTLLKDGCADFIFVVYPQKANINYHEVKTILKN
FT                   MIVYVIKRKV"
FT   gene            479803..481440
FT                   /locus_tag="BRE_443"
FT   CDS_pept        479803..481440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_443"
FT                   /product="60 kDa inner-membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_443"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94679"
FT                   /db_xref="GOA:B5RRP5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRP5"
FT                   /protein_id="ACH94679.1"
FT                   /translation="MSPNKRILRAVYLSLFFIGIFMLLDDFLFSRKASSFMNEEIKFDL
FT                   NKDFDIDNSLIDEDFTFNLSDNSEDINVDTDIYHATFATFGGNLISLKLKNHLNLDKKP
FT                   TEIVKVHPQNQSLFYITLDKLSKSLFLYEQIDSHVHDFKTNVEVNGKYYEYIKRYTFSK
FT                   SNEYLIKLEIFLNNIDVNDDIGIDFYKFVLNSGIEELSAKGKLQYNNYLSHAIYYDTKL
FT                   RYGKDGLNIANPKWVGAGTKYFEVLVSKENMKVEFKHENKVLNAFILNKLDNKNVSDVF
FT                   YIYAGPRDNKYLDIFNQRELNSFGLSNVEFGMSVEKSLLYFLQVPMQLIMQIFYNVIPN
FT                   WGLSIMFLTIVVRILIFPLTFKSFRATAELSKLQPKMKEIQVKFKSDPKRLNEEMGKLY
FT                   REEGVNPIGGCFPILLQLPVFFALYGLVNNFFVLRGASFIPGWIDDLSIGDSIYYFGYK
FT                   VFAWTDIRILPFIMMITQLLSTIVSSNVSFKSLGSQQKFLYFGMPIMFFFILYDMPSGL
FT                   LIYWITTNIFTILQQYYIKMNLSERRNK"
FT   gene            481437..482159
FT                   /gene="jag"
FT                   /locus_tag="BRE_444"
FT   CDS_pept        481437..482159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="jag"
FT                   /locus_tag="BRE_444"
FT                   /product="spoIIIJ-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_444"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94680"
FT                   /db_xref="GOA:B5RRP6"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP6"
FT                   /protein_id="ACH94680.1"
FT                   /translation="MSYEFYGKTEQEAIKKAMRDLDLREGEFDVEILDKEKVGFLFKKE
FT                   MIRIKVSPHAKEEEVKSDIQFDEDIYNQVLDFVKEIINKMGYSVNLKVESREGNYVKIV
FT                   IETDSPNILIGREGRNLDALQLLANIYISRLIGDTGNFNRVILDIEDYRERFKSRFINL
FT                   AINSLHKVKRSRRSILLPTMNPFERRIIHTTLNRYSDIKTESEGDGNLKRVRISYVRNS
FT                   KYNNNFRTYHKKDANSKK"
FT   gene            482216..483274
FT                   /locus_tag="BRE_445"
FT   CDS_pept        482216..483274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_445"
FT                   /product="nucleotide sugar epimerase"
FT                   /EC_number="5.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_445"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94681"
FT                   /db_xref="GOA:B5RRP7"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP7"
FT                   /protein_id="ACH94681.1"
FT                   /translation="MRVLLTGIAGFIGFHVAKKLADDGHEVLGIDILNNYYDPSLKYER
FT                   LEILGFNSENIDSKKVVNSHKYNNLSFVNLDILNKEQVLSLFNNYKFTHICHLAAQAGI
FT                   RDSIENPDSYIAINIVGFFNILDACRIYKDSIEHFVYASTSAVYGLNEKMPSSEDSITD
FT                   HPLNLYAASKKSNEVIAHAYSSSFNIPTTGLRFFTVYGPYGRPDMALYLFADGVMRQST
FT                   INVFNNGDMARDFTYVDDVVNGVCNVLKKPARSDSNFDKQNPNSSSSFAPYRIYNVGTG
FT                   QAVKLMEFINELEINLENKACKNFLPMQKADVVESCCDISKLKNDFAYEALTSIKDGIR
FT                   KFAIWYKSKISK"
FT   gene            483413..484492
FT                   /gene="fba"
FT                   /locus_tag="BRE_446"
FT   CDS_pept        483413..484492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="BRE_446"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_446"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94682"
FT                   /db_xref="GOA:B5RRP8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP8"
FT                   /protein_id="ACH94682.1"
FT                   /translation="MGVLNKIKPGVVYGKDLHTLYEICKSEGFAIPAINCVGTNSINAV
FT                   LEAAKEINSPIMIQFSNSGSSFVAGKGLKVEKSQGTSILGAISGAMHVHLLAEHYGIPV
FT                   VLHTDHCAKNLIPWVEGLLEYGEKYYKEHNRPLFSSHMLDLSEEPIKENIEMSKKFLER
FT                   MSKIEMFLEIELGITGGEEDGVDNSERAHHELFSTPEDIYYGYSELIKISPNFQIAAAF
FT                   GNVHGVYKPGNVQLTPKVLRDGQNYVISKINSTNPKPVSYVFHGGSGSTLEEIHEALSY
FT                   GIVKMNIDTDTQWAAWEGVLNYYKKNENRLQGQLGDGKDADVPNKKFYDPRVWLRESEI
FT                   SIKERVKIACKNLNNINRN"
FT   gene            484724..485155
FT                   /locus_tag="BRE_447"
FT   CDS_pept        484724..485155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_447"
FT                   /product="heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_447"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94683"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRP9"
FT                   /protein_id="ACH94683.1"
FT                   /translation="MIKKEIYMWLTNYNKNFLDFLNDDFDFVNSRGIQDVPVNIKDEGD
FT                   SFVLEAYLPGIKKEDISISIKNDYLTISYENKDEREERDDNYLRVERRDISFSRSFRLS
FT                   GNIEQNKIKSELKNGVLLIKLPKNSEVIEKSKEKKIVIE"
FT   gene            complement(485200..486951)
FT                   /gene="aspS"
FT                   /locus_tag="BRE_448"
FT   CDS_pept        complement(485200..486951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="BRE_448"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_448"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94684"
FT                   /db_xref="GOA:B5RRQ0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRQ0"
FT                   /protein_id="ACH94684.1"
FT                   /translation="MFKIIKCNQINNKLINKKIEINGWVKKIRNHGKVTFINIRDRYDE
FT                   AQILVSDEKLLKITSQIKMEYCIKIQGKLNLRPLELVNREMKTGELEIIAENIDIISKC
FT                   NELPFMIENNNNASDNSKLEYRYLDLRREEQKQKIILRSKVIHIIRNHLTKQDFLELET
FT                   PTFVKSTPEGARDFLVPSRIHKGHFYALPQSPQIYKQLAMIAGLDKYFQIARCYRDEDS
FT                   RGDRQPEFTQLDLEMSFIKKENIFKLIENLIFTIFKNSLNITLPKKFKKITYKDAMNIY
FT                   GSDKPDTRYELLIQDMSKALKQSPFDVFKDTLQNKGTIKALIIKNQAHNFSRSKINSLE
FT                   EHAKLYKARTLYFTKIENNEFTGGIAKFINPIKKTLIETYSLKNNDIIFFIADLWETAC
FT                   KAIGQIRIKIATELNLINKNIFEFLWIYDFPLFEYDEDTQSYKAAHHMFSMPQAKYINT
FT                   LESNPSKVLGEVYDIVLNGTELGSGSIRVHTKELQQRIFNIVGFNDKIAEERFDFFLKA
FT                   LEYGAPIHGGIAIGIDRLLMLMTNSNSIKDVILFPKNSFAASPLDKSPSKISDEQLKEL
FT                   NLTIENK"
FT   gene            complement(486955..489075)
FT                   /gene="napA_1"
FT                   /locus_tag="BRE_449"
FT   CDS_pept        complement(486955..489075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napA_1"
FT                   /locus_tag="BRE_449"
FT                   /product="Na+ /H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_449"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94685"
FT                   /db_xref="GOA:B5RRQ1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ1"
FT                   /protein_id="ACH94685.1"
FT                   /translation="MRKKLLYTILFNINPILSFGMVDYMKDTGHNIDAKISSFIMSLAI
FT                   IVISASLLGNLVNRFGIPKVIGQITAGILLSPTCLGKIKVPLLFPLGIINSGENYLINE
FT                   DIFAISTIASIILLFMAGLETDLKLFLKFLPRGGLIGITEVIGTFTSFALISTILFDVQ
FT                   LINPTSLFIGIIATPSSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMIMLTSVIT
FT                   ISRSLSDLDITISIRSTIQNILIWFCLTFILILLSKPISQLLKSFNSVTLATVITLTFT
FT                   FIISSIFQNLGMSFVIGAYIFGLAMSKTDIVYVIQDKLTLFERFFIPIFFTSIGMMADI
FT                   NVILSKEVLIIGTLLSLIAIATKVVYCFIPSYFLGFNKLGALRIAFGMVPRGEISLIIA
FT                   NVALSSEFISQKIFGIIIIIVFLPTIIATPIINILFQINKNGLKKEMKIEQNTQITIAL
FT                   KYDNLTKIFVWDLKNELRNEGFFTQQIKNDFSQYINARRNDISLSIKREGSKITFECPK
FT                   KHLIIIQDLLRETILNLEKITEEVKIVSVKAQKLNYSINYDKIRSNIALDKRIKKENII
FT                   LNLKATNKIEVLRELLSIIKVDIDKETILQDLMEREKLITTALKEGFAIPHLKTNLIKK
FT                   MHIAIGISHDGIDFNAIDKNLSYIFILILYPAKEHVNYPRILSSIVGKVDSNKKAMLKA
FT                   KTDKEIYNILIG"
FT   gene            complement(489072..489350)
FT                   /gene="ptsH-1"
FT                   /locus_tag="BRE_450"
FT   CDS_pept        complement(489072..489350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH-1"
FT                   /locus_tag="BRE_450"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_450"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94686"
FT                   /db_xref="GOA:B5RRQ2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ2"
FT                   /protein_id="ACH94686.1"
FT                   /translation="MQTTIEITNKEGLHARPSSMISELANKYSCCNIKLITEDGREADA
FT                   KSTVEIMILGILYKEKITIVANGKDEIEIIDELKKLIQSNFKKEIQK"
FT   gene            complement(489365..489676)
FT                   /locus_tag="BRE_451"
FT   CDS_pept        complement(489365..489676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_451"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_451"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94687"
FT                   /db_xref="GOA:B5RRQ3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ3"
FT                   /protein_id="ACH94687.1"
FT                   /translation="MKEKFMEPKIQAINYHLNDDMKDFILKKLDKIGTHIKQHAKSLKI
FT                   TIKKENDIFDIDAHLHFNWGKIIHITEEGKELHALTERLIERLQNTANKEKSKKDTIK"
FT   gene            complement(489651..490907)
FT                   /gene="ntrA"
FT                   /locus_tag="BRE_452"
FT   CDS_pept        complement(489651..490907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrA"
FT                   /locus_tag="BRE_452"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_452"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94688"
FT                   /db_xref="GOA:B5RRQ4"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ4"
FT                   /protein_id="ACH94688.1"
FT                   /translation="MLKQNLKLTHKLQLTQINTIKMLSLDKQELIQIISDELDNNEYIK
FT                   VDSNKIFFESLKTYKFKKIFYKENENNKTQYEIALAKTSPKISLKEHLLLQLRIQRLNE
FT                   EEINIGEIIINNLNRKGLYIINPYDFFNKEEWPQVTKMIKLIQQFDPIGICVPNIIESL
FT                   ILQAKYHNLDTNIIKILQKADLLTNTKEKLKKELNISTQDLNDAINTMKLKLNPNPTFE
FT                   FKDKDDTNDYIEPDIIVINKGNKLKIKIKEVSIFKTEINKQEVKDLCKYKQAKWLIEAL
FT                   RYRDETLAKIGIAIYTLQKEFLKRGFKRLRPMNLDDISTRINLSKSTISRAIKNKYLKF
FT                   DWGTIAIRKLFNSIGGTKTNEFSKLSIKIIIKGILEQNKNMVDSQISDILKSKGITISR
FT                   RTVNKYRNELKCEGEIYGT"
FT   gene            complement(490910..491443)
FT                   /locus_tag="BRE_453"
FT   CDS_pept        complement(490910..491443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_453"
FT                   /product="chromate transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_453"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94689"
FT                   /db_xref="GOA:B5RRQ5"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ5"
FT                   /protein_id="ACH94689.1"
FT                   /translation="MILLNLFITFFKIGILNFGGGNGITATIHKEIIERKEWITQEEFI
FT                   NIITISRITPGPIATNIATYVGAKIAGITGAIIATMALISAPILIIIFIISTIHKINFL
FT                   KYYLEQLKPVIIALWIITIIILFENIFFKIDYNNIKLSKSFALAGLNLLILLFYKNVSP
FT                   AILIISSGVLYIFM"
FT   gene            complement(491409..492023)
FT                   /locus_tag="BRE_454"
FT   CDS_pept        complement(491409..492023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_454"
FT                   /product="Chromate transport protein, putative"
FT                   /note="AMIDATION and MICROBODIES_CTER motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_454"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94690"
FT                   /db_xref="GOA:B5RRQ6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ6"
FT                   /protein_id="ACH94690.1"
FT                   /translation="MNEKKETSYELLKLFYLVFKITTITIGGGLLIISELKKAIVNKRK
FT                   LISEQEFKEILTTSSIIPGVTAINFAFLIGKKIKGFKGAFVLTIAGILPSIFVITIIAL
FT                   YINLNSNNIYFQKFIEGAKISSTIVMSMIIIEFSKKMLNRSIIKWGTCVLITYVLYKFH
FT                   IDLSYILLIFLLICSITYTMKKKFLKARYKFDFTKFIHHIF"
FT   gene            492147..493088
FT                   /locus_tag="BRE_455"
FT   CDS_pept        492147..493088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_455"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_455"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94691"
FT                   /db_xref="GOA:B5RRQ7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ7"
FT                   /protein_id="ACH94691.1"
FT                   /translation="MLIFYFLIVIRVLFFCYFCTILHLLMDKQLKISNVLKRVFILPDY
FT                   VHEIFQMIIDYGLRIVVALFAWCILRFIVKRLGTIFLKAYERSKLETKLDSTVLNFFKS
FT                   FFKVVINLVLILMILPYLGVSTASIFAVFGSLGLAVGFAAQGMLSNFVSGFVILNSNFF
FT                   KIGDYVNCDDAEGEVTDIQIFFTTLKTVDGKIIKIPNSKFTSTLVVNFSANFERRIAFT
FT                   FQVPYGINFALLKTEMENLAFSFNRETYNVRQPSLILKEYTPYYIIVEIRCFIRTEFFW
FT                   DFQYFMGEKIKDVLIDMGVEFPIHVVNLSKLC"
FT   gene            complement(493072..494238)
FT                   /locus_tag="BRE_456"
FT   CDS_pept        complement(493072..494238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_456"
FT                   /product="lipopolysaccharide biosynthesis-related protein"
FT                   /note="AMIDATION motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_456"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94692"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ8"
FT                   /protein_id="ACH94692.1"
FT                   /translation="MKIAIFTDTYLPDKNGVATCIKQIKEGFEQKGHTVYIFCPQYYKS
FT                   DLSKKNIYRCFSIKLNRTVDAKISFPNKAKIKKIIAEYQPDIIHTHSEFTMGNIGKNLA
FT                   LEYDIPIVHTNHTMWNYYLHYLGAIKYFINPDKMMKKFYNQIHHFIYPSIKAHDKYFHL
FT                   AKDADYKLIPNGIDRKLFIKELTQKKKQEILSKYDIKKNDKIIIFVGRINKEKNIYELI
FT                   QNLKKLLIENKHCKLILIGKGKEERNVKQFRKKYGLENQIILVGTIPWEEMYYYYKISD
FT                   VFASLSKSEVYPMTIIEALTAGIPAILSNDIIYKDVIHQGKNGFLIDNDEDMYKYMKEI
FT                   IENDEKLQTAKKYTEKTSIIHSSTSFVERIEEYYVQIIQNHKNLSKVY"
FT   gene            494306..495289
FT                   /locus_tag="BRE_457"
FT   CDS_pept        494306..495289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_457"
FT                   /product="DNA polymerase III delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_457"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94693"
FT                   /db_xref="GOA:B5RRQ9"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRQ9"
FT                   /protein_id="ACH94693.1"
FT                   /translation="MQEVYLLLGKEQGLKEAYLNDIFSKLNADDIHITKLFMSELSSIE
FT                   LSERFLSSSFFAKREVFIIYEIENLKNKKDLELIYNTLLKPLNKIIIFISDENSISFEP
FT                   KVSVNVIKKTFYELSDNDKFSFVKKSFFQLGIKITDKAINLMLFMLDADTKILQSYVNS
FT                   FALVIKDKTIDEDDVTAWLSFVRLENVFSLFESILKKDMERALVKVKAILEQGEELVGI
FT                   IMSLGWKFKKFLKIKIDCENTNNISSILKKHKIFFSLEKTYKIGLCNYSVLDIKFIFKI
FT                   LHKFDLYARVYGKNMHLNLSYFMVVILLNQDDTILENFSLKFKCDF"
FT   gene            complement(495293..497101)
FT                   /gene="uvrC"
FT                   /locus_tag="BRE_458"
FT   CDS_pept        complement(495293..497101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BRE_458"
FT                   /product="excinuclease ABC, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_458"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94694"
FT                   /db_xref="GOA:B5RRR0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRR0"
FT                   /protein_id="ACH94694.1"
FT                   /translation="MRKHLNDLYKQIEKFPKTSGCYKMYSKDNKILYIGKAKNLRSRVK
FT                   NYFSKRTSHKTKILMNNVTNIEIITTNSEYEALLLECNLIKKYKPTYNIKLKDDKGYPM
FT                   IRITCEKYPRIFKTRKIINDGSEYFGPYVNVKNLDLVLDLINKTFKTKKCKKKSKNPCL
FT                   YFHMGQCLGVCYREDLEDEYRKEIEQIKHILNGNISKLLNDIEIKMKEVIMKENFEAAI
FT                   KLKETKKSLIEISQTQIITKIDKLSEDYLYIHKTNSLNTIVILKYKDGKLTEKDIHFDE
FT                   SIYEEDELIEKFITQYYTSPNMIVPDKIHIFKKIDTSNITKLINELKNIKTEIIYKETK
FT                   DNIKIIEMATSNAKLALITYNHEKNKAIENLKTILEMKKLPKTIEGFDIAHINGYKTVA
FT                   SLVTFKMGKPFKDGYRVYKINSLSNGEIDDCKAIKEVISRRYSKLINEQLKLPDLILID
FT                   GGKGQLNSAYSILKGLRIEEKIAICALAKKEEIIFLPNKNQGIKLQKRNSALQVLQNVR
FT                   DEAHRRANNFNNKLHNNIKLNYTKIKGIGEQKAKKILKVLGTYKDILLLNEDEIATKMK
FT                   INITMANKIKKFAEEQNLNNKQNNHI"
FT   gene            497212..498729
FT                   /locus_tag="BRE_459"
FT   CDS_pept        497212..498729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_459"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_459"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94695"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR1"
FT                   /protein_id="ACH94695.1"
FT                   /translation="MRLIFIFSLFCLYVFSAFSQELKLILDYKDGFKFIQEAHNVNFAR
FT                   DNRGILGIYLDRYKGILDYNNIDFRLEIEKDNLLKDAALNYFVDSNNAKISNSFHNISG
FT                   NSLIFYSSRNTVKLKPLTRKAFFYSGNVIADFTIQFWVYRSTSVTGEVIVSWNGYKNIK
FT                   GVWVDQAIRLESEGGTFVWNFNNVFLNDNGDPVKIKLKSDDDFVPKEWHLHTVRYRQKD
FT                   GLLEYLIDSKPQAIEYVTFDKREGSGYLLNIGNFIDFALGQYFTGAIENFEIYKSFEEV
FT                   RSAFFSRDKGYIITKPIELSKDYSQILSIEFDSLKPKDTDIFYYYRLDNKVFYEIDKNG
FT                   EIKRNLTGDWIHFDSKNGLPKFDISKYIQFKVEFYPSGNPIESPSLYSMVVTYIPESAP
FT                   FPPLITKAVPGSSEILIEWFPVISSNIGGYYIYIGVSPGNYHGNAGNILKSPIDVGNQT
FT                   SFKITGLENGRLYYISVASYNLDKSVNEESFSKEISVRPMEFFKQYE"
FT   gene            498665..500029
FT                   /locus_tag="BRE_460"
FT   CDS_pept        498665..500029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_460"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_460"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94696"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR2"
FT                   /protein_id="ACH94696.1"
FT                   /translation="MKSLFQKKFLLDLWSFLSNMNSINFEKALELYKKGDFKNALLNLD
FT                   VFDDSFDSLSLKSLLYFRLKDYKALLYVLDTYPVLSEYSFLIKLLYDGEFKSDEGNLSY
FT                   FQNYNLGVFYFGLKNYEKSLNCFLTSIKQYPNLIQAFNNAAVLFEMLGNRDDALEMLVK
FT                   ATGIDKDNALIKLNTWFLNNTCAFKSVRPFKLDGSFLNVNLSLIINYLMYYLYFMGEID
FT                   GAIKLSEKFLTDSNYSKYIWHNRATILHKIGNMTQATKSYVKSILSFPNVYTIYNMHIA
FT                   TIKLLNFDSKKAIDRMLLDYPDMELVYFYAFLFFLRNRELEDAYFYIKKLCVMNIDTYS
FT                   RFLNLLESSEDIFIEELLDECALILKGEWILEYLFFVDNSLDLREPVFVFDYYTRICPY
FT                   IWKVKDEHIELRASNSEFEITKEILSDEFTQVQLSVTIKEIKDLIEAYKDFKINY"
FT   gene            500099..500188
FT                   /locus_tag="BRE_461"
FT   tRNA            500099..500188
FT                   /locus_tag="BRE_461"
FT                   /product="tRNA-Ser"
FT   gene            500254..500339
FT                   /locus_tag="BRE_462"
FT   tRNA            500254..500339
FT                   /locus_tag="BRE_462"
FT                   /product="tRNA-Ser"
FT   gene            complement(500352..501083)
FT                   /locus_tag="BRE_463"
FT   CDS_pept        complement(500352..501083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_463"
FT                   /product="putative lipoprotein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_463"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94697"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR3"
FT                   /protein_id="ACH94697.1"
FT                   /translation="MTSKFSISIIIIFLITIACTKHDKKTESAEINIETKIIKEDTTNE
FT                   DNIMFHIDAQIPTIEGIEFGFEELIKKWKNDTIELFKTIKEKKEPHESFYYSDFEIFKN
FT                   LNLNITSILYNQFQIDKYAANGLTTYHSINLRGKEKIELADIISKDQLDSLIQVLREEV
FT                   KTKFEKIATHYDNKSTFEIEFEKIFKQYQYYFKNNEVVIFYNPLIIGPHSDEKIEFTFP
FT                   INNNSEGDITKKKKTDCPICS"
FT   gene            501206..501279
FT                   /locus_tag="BRE_464"
FT   tRNA            501206..501279
FT                   /locus_tag="BRE_464"
FT                   /product="tRNA-Arg"
FT   gene            501295..501381
FT                   /locus_tag="BRE_465"
FT   tRNA            501295..501381
FT                   /locus_tag="BRE_465"
FT                   /product="tRNA-Ser"
FT   gene            501628..503295
FT                   /gene="dnaX"
FT                   /locus_tag="BRE_466"
FT   CDS_pept        501628..503295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BRE_466"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_466"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94698"
FT                   /db_xref="GOA:B5RRR4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR4"
FT                   /protein_id="ACH94698.1"
FT                   /translation="MLFMGDGMISARGTAIKRRPRDFTSLEGQDFVVETLKHSIESNKI
FT                   ANAYIFSGPRGVGKTSSARAFSRCLNCQTGPTIMPCGTCFNCKSIDNDNSLDVIEIDGA
FT                   SNTSVQDVRQIKEEIMFPPANSRYRVYIIDEVHMLSNSAFNALLKTVEEPPNYIVFIFA
FT                   TTEVHKLPDTIKSRCQHFNFRLLPLDKIYEMLKCVCLEDDIKYEDEALKWIAYKSGGSV
FT                   RDAYTLFDQIVSLSNSDIKFDQIRSKMGLTSDEFLEKLVLSILNDDLKELLSVLDTVFL
FT                   TGISCEQFLLDAIEFFREILFLKLDIKNIMFIGIKFESLKESLLNFDLQHVERSISVLL
FT                   ETYRDLQFSINPKYEIEINFIKILRLKNYIPNHLLIKQIQDIETKALNEINCDIDKINC
FT                   DVNLKSELSDVPLMEPDNATEEEIPLKVKIQEPDVHCDSEDDDIDKIFIETKDNFDKID
FT                   DNDRIKETFIYLVSKYVQTLVYSGEVLIDGGVLYYKIFSGFEYNQLQAYQNEIRTEFCK
FT                   EFPRLNVIFQKQFKDNDDEFDNEVLRVKNIFGASEVKE"
FT   gene            503298..503597
FT                   /locus_tag="BRE_467"
FT   CDS_pept        503298..503597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_467"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_467"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94699"
FT                   /db_xref="GOA:B5RRR5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRR5"
FT                   /protein_id="ACH94699.1"
FT                   /translation="MAVNPLDFLKNMSNFKDNIDNIKKEISQIVVCGRAGSDVVVVEMN
FT                   GEFVVKKILIKEDFFNDLDNEALEHMIKSAFNDAVFKVKEEIKSKTMGSIPFGI"
FT   gene            503601..504185
FT                   /gene="recR"
FT                   /locus_tag="BRE_468"
FT   CDS_pept        503601..504185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BRE_468"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_468"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94700"
FT                   /db_xref="GOA:B5RRR6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR6"
FT                   /protein_id="ACH94700.1"
FT                   /translation="MIIQDLIELVSKLPGIGKKTAARMVYDILYTGKNFSRALGQILIR
FT                   LHLEIQKCKNCYNFAEEELCDICTNLNRNKGIICVVEMPQDLEVIEATKEYDGFYFVLH
FT                   GHLDPLRNIGPDELNLDKLENYIKLLKAEEVIIATEFSIEGDVTANYISNLLKDLDINV
FT                   TRIASGLPAGGSISNADKVTTLRALRLRLKM"
FT   gene            504437..505018
FT                   /gene="ndk"
FT                   /locus_tag="BRE_469"
FT   CDS_pept        504437..505018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BRE_469"
FT                   /product="nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_469"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94701"
FT                   /db_xref="GOA:B5RRR7"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR7"
FT                   /protein_id="ACH94701.1"
FT                   /translation="MHIHELNKLCLIISLHCIKNIGRLFMSTLIQKTLCIVKPDGVRRG
FT                   LIGNVVSRFERVGLKIVAAKMVLVDRKMAEEHYLYDDIAARHGESVWKSLVNFLMSSPV
FT                   FAFVIEGVESVEVVRKFCGSTEPKMSAPGTIRGDFSYHSFNYANAKNFAVYNVIHSSAS
FT                   LIDANREIPIWFTKDEIFTYKRDDEFEHYY"
FT   gene            505022..505846
FT                   /locus_tag="BRE_470"
FT   CDS_pept        505022..505846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_470"
FT                   /product="putative adenine-specific DNA methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_470"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94702"
FT                   /db_xref="GOA:B5RRR8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR8"
FT                   /protein_id="ACH94702.1"
FT                   /translation="MIMSVVIRPILKWAGGKKNLLNSILNNIPLSFNNYIEPFIGGGAL
FT                   FFALNLKNSIINDINFHLINFYMEVAHNLNNFLLRIEKYNNVPLTKEYYIDIRNSFNNA
FT                   NLTNLEKACIFLYLNKTCYNGLYRENGSGQFNTPFGKYKKINLFEIENLRLASKLLREV
FT                   RVLSLDFFCLLNVIKKDDFVYLDPPYIPYSKTSNFTSYNKYGFDFSMHERLLRFCDKID
FT                   KKGAKFLLSNSNTTSSLELYKNYNIIFVDSKRLINANPIGRGNIREILVKNF"
FT   gene            506060..506596
FT                   /locus_tag="BRE_471"
FT   CDS_pept        506060..506596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_471"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_471"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94703"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRR9"
FT                   /protein_id="ACH94703.1"
FT                   /translation="MIGYALFYLLPLFLLFNCTFDYEEYSNRTGAAKEAPTIQILKISY
FT                   HNIVGGKKQTILEALSFNYFNYYKLYKVENGRFLYHALENRISGKFSNLEGSHVTKDLD
FT                   MKDSVELKIEDMNNYYLINTNRLLWRDNEKKLFSPPNELVFIRFDESNITGKGFSYFFK
FT                   SNNFYFYSGIEGLVK"
FT   gene            506593..507288
FT                   /locus_tag="BRE_472"
FT   CDS_pept        506593..507288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_472"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_472"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94704"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS0"
FT                   /protein_id="ACH94704.1"
FT                   /translation="MKSLILCLICISLFGYAQSKNGLDDPSKLKEKDNSKKKSEFTFRA
FT                   DFSHGILSPLYRRIILKGNPEVISSDFKLRADEIEIYGEGSSYIEARGNVYYEDYTNKM
FT                   NVKSQFLFVNRKLDNFYLQKGVELEDLENKLVVKAERIEGSRKTSVYIMQYSVKIYKGD
FT                   IFARAENGIYNKEEKEIVLEGVPVIYQDDNYYSASRIVLNTETKKYNLEGDVEGKFTQV
FT                   EENVPQQEK"
FT   gene            507224..508057
FT                   /locus_tag="BRE_473"
FT   CDS_pept        507224..508057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_473"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_473"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94705"
FT                   /db_xref="GOA:B5RRS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS1"
FT                   /protein_id="ACH94705.1"
FT                   /translation="MRVMLKVNLLKWRKMFLNKKNRIESIKEKLSLNAVTDIVLKADSI
FT                   VKKYGEKVVVNGVTIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIKANSGRVLINNHDVS
FT                   KLNMYERARLGIVYLPQEPSIFRELTVEDNILVALERREDLSQAERKIELVNLLKDFEI
FT                   KRIQYQKAYTLSGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIKDIIRILKSK
FT                   NIGVLITDHNVRDAFDIIDRAYIIYQGQVLDSGNVDYIINSEKAKKLYLGEEFRL"
FT   gene            508054..508743
FT                   /locus_tag="BRE_474"
FT   CDS_pept        508054..508743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_474"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation and RGD motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_474"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94706"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS2"
FT                   /protein_id="ACH94706.1"
FT                   /translation="MKVLERELYYEFEVDSSVKLIYTKKPFDLEIKNISNDNLSFIPKN
FT                   KEIKYLKQLHTNIVYEVADDFVNFQRGDGLVSSSFNVALLAYYADCLPIYIFDKSKKYI
FT                   GLAHSGYKGSFQLILLKMLFKFQDMGSNFEDLRIIFGPYNRGCCYEVSSEFVSKINLQF
FT                   SKKLLDMSFCKKDDKIYFDNANFNLGLISNFNLKVEDSGLCTYCNCNLYSHRKFKGKRS
FT                   YAVIWRT"
FT   gene            508745..509491
FT                   /locus_tag="BRE_475"
FT   CDS_pept        508745..509491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_475"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_475"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94707"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS3"
FT                   /protein_id="ACH94707.1"
FT                   /translation="MTVKELSLHLDEIFKVNDHKDIDKSLNGLQVGNLELEVKKVALAV
FT                   DASMATLREVKGYDFLITHHGIFWSKSDKIIAGMYDKVKWLINNDLSLYCVHLPMDAHT
FT                   IYSHSRVLSDFLGFHNPIPFANYKGINLGIISIAEFGFSEILKRIEAHNKHILFYKKFK
FT                   EYVSRVAIVSGSGYSFFEEALEYDIDLFITGDTSHQIYSLAEERGVNLIFAGHYFTETF
FT                   GLLKLMEYLKNQRGLEVDFILQDTNL"
FT   gene            509501..510013
FT                   /gene="lsp"
FT                   /locus_tag="BRE_476"
FT   CDS_pept        509501..510013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lsp"
FT                   /locus_tag="BRE_476"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_476"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94708"
FT                   /db_xref="GOA:B5RRS4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RRS4"
FT                   /protein_id="ACH94708.1"
FT                   /translation="MNINRNRLVSNLIFISILVFFDQWSKYLVVTYVRLGTEYLSFFGD
FT                   LFKIIHVRNTGVLFSLGSNIDSSLKNLFFLIIPIIILVFVFSFSLKENNKVSRFALILI
FT                   LSGGIGNIIDRLFRPLGVVDFLDVKFFGIFGLQRWPTFNFADSYVVVGMIVFIIYDLFT
FT                   KDKSTNL"
FT   gene            510010..510234
FT                   /locus_tag="BRE_477"
FT   CDS_pept        510010..510234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_477"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94709"
FT                   /db_xref="GOA:B5RRS5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS5"
FT                   /protein_id="ACH94709.1"
FT                   /translation="MNFLYFVLCSLINLSLMFFIFFLEFLFVSRLNIIVSPIFQYVLII
FT                   VMIFISIAISYFLSSVIFRNIISKFFDLD"
FT   gene            510249..511067
FT                   /locus_tag="BRE_478"
FT   CDS_pept        510249..511067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_478"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_478"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94710"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS6"
FT                   /protein_id="ACH94710.1"
FT                   /translation="MSLRILVSGEIVGKPGVFVVKNFLHSFKEKNKIDFVISGNNFTTG
FT                   FRGLCKRHAFLLKKYGVDVLTLGENAFVRAGLSDELDRYNFILKPLNCPARLKGYSYFI
FT                   YSINGIKLAVLRLVGQTGITKYNFNNPFLTFDYFYERIKSITNNIIVLFDSNTTAEVNA
FT                   MFFYLKSRVSACLGIGKRILTADLRIFDNTAVITDLGRVGSLDSVVGYSTVFEIDKFLK
FT                   GFLNNKFTESWDGLGFNGIIVDIDDGKAVFVEAIREYIDFDSSIANSTDI"
FT   gene            511126..512406
FT                   /gene="murA"
FT                   /locus_tag="BRE_479"
FT   CDS_pept        511126..512406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BRE_479"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_479"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94711"
FT                   /db_xref="GOA:B5RRS7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS7"
FT                   /protein_id="ACH94711.1"
FT                   /translation="MYSYLVEGGFKIGGKITASGNKNAALPCMIAALLTDEEVILENVP
FT                   NIRDVEVILKILEDIGVDVVRDGNILKIKALNIAKTEIDSSLTDLIRASILFVGPMLAR
FT                   CGRIDIAPPGGDVIGKRRLDTHFYGLGKLGAKLIENERIVLEVDNLIGAEMFLDEASVT
FT                   ATENIIMASVLAFGETVIMNAACEPHVQDLCNMLNLMGADISGIGSNLLKIRGVKKLRG
FT                   AKFRIGADFMQIGSLISLAALTGGELEINKADPGNFILIKHVYSKFGIDFEYDNENIYV
FT                   KEKQYLKVRLDFGGHIPKIDDGPWPSFPTDLMSIMIVTATQVQGTVLIFEKMFESRMFF
FT                   VDKLIKMGAQIVLCDPHRVVVTGKTILKGNDVSSPDVRAGMSLLIAALCAEGKSRIHNI
FT                   YQIERGYEDVVSKLSFLGARIKRVRDE"
FT   gene            512643..514001
FT                   /locus_tag="BRE_480"
FT   CDS_pept        512643..514001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_480"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_480"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94712"
FT                   /db_xref="GOA:B5RRS8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS8"
FT                   /protein_id="ACH94712.1"
FT                   /translation="MSTSKTKIRKLILEGNLYLVFLFISFPIMVTNLLQSCYELVDMFY
FT                   VGKLGAMPLAALSLTGPINFLIMVFAMGMATGSVSLMSRSIGEKTFSKFSKYAGQLIFL
FT                   NFIFSLFVAILIFIFIDSILELVGVRGELKELTRSYFYVIVYGIPVMFLSISVVYILNS
FT                   QGETVVAMFLILVANIINFFLNPILMFTLGLGIAGAAWSTLLSKLITVLSYLFFTYRLN
FT                   CGLKVHFKDIIPDINVIRKIISLGLPAAFGQVMASLSFLIFNHIVIQISSKFLAAYGMV
FT                   NNIISFLLLPGMSIGTGIISIVGQNLGAKNIMRVRDILKKGFFVTLVIMLTVASFIMSF
FT                   KDVIIALFTFDLEVIKYANGYLSLAVIGTVGFGLQQVFLGVLVGSGLTKLVMIVVCIRL
FT                   WIIRLPTVFILQYFGIVEDSLGYAFIISNYLALIILLFVTLTRYGQICNKSNM"
FT   gene            complement(514148..514471)
FT                   /locus_tag="BRE_481"
FT   CDS_pept        complement(514148..514471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_481"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_481"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94713"
FT                   /db_xref="UniProtKB/TrEMBL:B5RRS9"
FT                   /protein_id="ACH94713.1"
FT                   /translation="MSQFKLKYKLLKNSIILIIFINISCIKNNDVKSKETGREITYIVN
FT                   IKKNTEKIEIIRFKTNKKNKLIITLKNNKKIDIKQNSLAIFKKGNKTGHIIQEGIKAGE
FT                   KNI"
FT   gene            514819..516003
FT                   /gene="tuf"
FT                   /locus_tag="BRE_482"
FT   CDS_pept        514819..516003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BRE_482"
FT                   /product="translation elongation factor TU"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_482"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94714"
FT                   /db_xref="GOA:B5RPI0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI0"
FT                   /protein_id="ACH94714.1"
FT                   /translation="MAKEIFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKVNKDAKA
FT                   LKYEDIDNAPEEKARGITINARHIEYETANRHYAHVDCPGHADYIKNMITGAAQMDAAI
FT                   LLVAADSGAEPQTKEHLLLAQRMGIKKIIVFLNKLDLADPELVELVEVEVLELVEKYGF
FT                   PSDTPIVKGSAFGAMSNPDDPEATKCIKELLETMDNYFDLPERDIDKPFLLAIEDVFSI
FT                   SGRGTVATGRIERGVIKVGQEVEIVGIRETRKTTVTGVEMFQKILEQGEAGDNVGLLLR
FT                   GVDKKDIERGQVIAALGTITPHKKFKASIYCLTKEEGGRHKPFFSGYRPQFFFRTTDVT
FT                   GMVSLEGKEMVMPGDNVDIVVELISSIAMDKNVEFAVREGGRTVASGRILEILE"
FT   gene            516049..516360
FT                   /gene="rpsJ"
FT                   /locus_tag="BRE_483"
FT   CDS_pept        516049..516360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BRE_483"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_483"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94715"
FT                   /db_xref="GOA:B5RPI1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI1"
FT                   /protein_id="ACH94715.1"
FT                   /translation="MITKDKIRVRLFSFDVKILDQSAESIVRAVQKSKTQIKGPIPLPT
FT                   KIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIKQ"
FT   gene            516394..517023
FT                   /gene="rplC"
FT                   /locus_tag="BRE_484"
FT   CDS_pept        516394..517023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BRE_484"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_484"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94716"
FT                   /db_xref="GOA:B5RPI2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI2"
FT                   /protein_id="ACH94716.1"
FT                   /translation="MFGLIGKKVGMTQVFQSNGIVVPVTVIEFEPNYVIGKKTMERDGY
FT                   DALIMGSVDLKGSKVSRPIKGQYKKLENIEPKRYVIEFKGLKGYDAGDEVGLDAFREIK
FT                   YVDITGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGGTGQATTPARTFKGTKMAGRM
FT                   GGEQQTIQNLEIVFIDEEKRAILVKGAVPGVKGSFVIVKKAKKVGI"
FT   gene            517025..517654
FT                   /gene="rplD"
FT                   /locus_tag="BRE_485"
FT   CDS_pept        517025..517654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BRE_485"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_485"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94717"
FT                   /db_xref="GOA:B5RPI3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI3"
FT                   /protein_id="ACH94717.1"
FT                   /translation="MERKVFSKDGQELRTIDLDDGVFNIDVSYGSIYNAINNELANLRV
FT                   GTASTKTRAEVRGSSKKPWKQKGTGRARVGTRRNPVWVGGGIALGPKPRDYSYKLPKKV
FT                   KRLAFKSVLSLCASVDDRLKVVENFTIDSGKTKELALIIKNFIKHNGRTVILLGNDDQM
FT                   IKRAGKNIRDLKILSFNRLRVVDLFYTKNLIALESAINGLNELYVK"
FT   gene            517676..517972
FT                   /gene="rplW"
FT                   /locus_tag="BRE_486"
FT   CDS_pept        517676..517972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BRE_486"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_486"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94718"
FT                   /db_xref="GOA:B5RPI4"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPI4"
FT                   /protein_id="ACH94718.1"
FT                   /translation="MKVYDIIISPMLTEKTNIQRENMNVYAFKVKKQANKKEIGAAIKE
FT                   LFNVTPISCNLLNVKSKVKTVVSRKGYPIGRGKTSSWKKAYVYLKKEDKIDIF"
FT   gene            517991..518824
FT                   /gene="rplB"
FT                   /locus_tag="BRE_487"
FT   CDS_pept        517991..518824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BRE_487"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_487"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94719"
FT                   /db_xref="GOA:B5RPI5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI5"
FT                   /protein_id="ACH94719.1"
FT                   /translation="MGIKIYRPKTSSLRYKTTLSFDELSKGNDPLKSLTKGKVSRAGRD
FT                   SSGRISVRRRGGGHKRRYREIDFARRDKFGIPARVAAIEYDPNRSPNIALLVYRDGDKR
FT                   YIIAPKGVKVGDILESGPNAPIKIGNALPLENIPVGKMVHNIELNIGKGGQLVRGAGGY
FT                   AMIIASDGDYVTVKLPSGEMRMIFKKCIATLGEVGNEDYMNVSIGKAGKSRWLGRRPKV
FT                   RGVAMNPIDHPHGGGEGKTSGGRHPVSPWGQPAKGYKTRKKNKYSDKFIVKRRNN"
FT   gene            518834..519112
FT                   /gene="rpsS"
FT                   /locus_tag="BRE_488"
FT   CDS_pept        518834..519112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BRE_488"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_488"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94720"
FT                   /db_xref="GOA:B5RPI6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI6"
FT                   /protein_id="ACH94720.1"
FT                   /translation="MARSIKKGPFIEKSLYQKVLASSGKEKRVVIKTYSRASTIIPEMV
FT                   SLTISVYNGKSFIPVYITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK"
FT   gene            519119..519481
FT                   /gene="rplV"
FT                   /locus_tag="BRE_489"
FT   CDS_pept        519119..519481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BRE_489"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_489"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94721"
FT                   /db_xref="GOA:B5RPI7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI7"
FT                   /protein_id="ACH94721.1"
FT                   /translation="MFVNKKYTAKGKNLPSSPKKVRPIANNIRGKPYNEAIAILCSMPN
FT                   KGAKLLGKVVKSAASNAMYHNRNLSEDMIFVKTVMVDDGRKRRSIWPRARGRADRLINR
FT                   SCHIFVEVYEKMYGGE"
FT   gene            519485..520315
FT                   /gene="rpsC"
FT                   /locus_tag="BRE_490"
FT   CDS_pept        519485..520315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BRE_490"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_490"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94722"
FT                   /db_xref="GOA:B5RPI8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI8"
FT                   /protein_id="ACH94722.1"
FT                   /translation="MGQKVHPYSLRIKINRDWKSKWYFDKKLYSEILHEDFLIRRETMK
FT                   FLKGIKFDISDIEIIRNNLQRVTVVISTPRPGSVIGVKGANLEKIGQLLTRKVSKKINI
FT                   KIKEIKKPEFDAQIVANGIAKQLENRASYRKLLKSSLLSSISKGIQGIKIKVSGRLGGA
FT                   EIARSFEVKEGRIPLHTLRANIDYGFAEAYTTYGVIGVKVWLFKGEILGKQINSDAGQV
FT                   INRKPSKDKVERFDKGKIDDKGRKVVNDDKFSREKLEIGSRSKNDFKNKNDSDI"
FT   gene            520334..520750
FT                   /gene="rplP"
FT                   /locus_tag="BRE_491"
FT   CDS_pept        520334..520750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BRE_491"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_491"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94723"
FT                   /db_xref="GOA:B5RPI9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPI9"
FT                   /protein_id="ACH94723.1"
FT                   /translation="MLSPRKVKYRKKQRGRLSGEAQKGNKISFGEYGLVSLEADFITAR
FT                   QIEAARVAMTRRVKRGGKVWIRIFPDIPYTKKPAETRMGKGKGGVDHWNAPVKLGTVMF
FT                   EISGVPRELAESAMMLASSKLPVKTTFVVRRDLR"
FT   gene            520754..520954
FT                   /gene="rpmC"
FT                   /locus_tag="BRE_492"
FT   CDS_pept        520754..520954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BRE_492"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_492"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94724"
FT                   /db_xref="GOA:B5RPJ0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ0"
FT                   /protein_id="ACH94724.1"
FT                   /translation="MLKNLKDLTLEDMKVKRLTLKKEYMDLRFKTVVGHVENPLKKREL
FT                   RRDIARLNTIIHEYAIGIRKV"
FT   gene            520960..521214
FT                   /gene="rpsQ"
FT                   /locus_tag="BRE_493"
FT   CDS_pept        520960..521214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BRE_493"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_493"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94725"
FT                   /db_xref="GOA:B5RPJ1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ1"
FT                   /protein_id="ACH94725.1"
FT                   /translation="MARENKKELIGKVVSDKMSKTVVVEIVQRKMHPIYHKYLKVSRRV
FT                   KAHDEREESKLGDKVKIVESRPISKEKRWRLVEILERSK"
FT   gene            521262..521630
FT                   /gene="rplN"
FT                   /locus_tag="BRE_494"
FT   CDS_pept        521262..521630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BRE_494"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_494"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94726"
FT                   /db_xref="GOA:B5RPJ2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ2"
FT                   /protein_id="ACH94726.1"
FT                   /translation="MVQMQTYLTVADNTGGKIAQCIKVLGGSKRRYAKVGDIIVIAVKQ
FT                   AIPNSPVKKGDVHKAVIIRTSKEIRRKNGTYVRFDDNACVILDANLNPRGKRVFGPVAR
FT                   ELRDANFMKVVSLASEVI"
FT   gene            521641..521946
FT                   /gene="rplX"
FT                   /locus_tag="BRE_495"
FT   CDS_pept        521641..521946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BRE_495"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_495"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94727"
FT                   /db_xref="GOA:B5RPJ3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ3"
FT                   /protein_id="ACH94727.1"
FT                   /translation="MKTKLRVGDKVKILCGKDRGKVGEIASIDRKKFKVTVKSCNMIKK
FT                   VIKARTPQEKGKIIDKEAPMDISNVMLFSNGVISRVGIKFENNEKKRYLKKSGENV"
FT   gene            521950..522498
FT                   /gene="rplE"
FT                   /locus_tag="BRE_496"
FT   CDS_pept        521950..522498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BRE_496"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_496"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94728"
FT                   /db_xref="GOA:B5RPJ4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ4"
FT                   /protein_id="ACH94728.1"
FT                   /translation="MSYIPELKRRYRDNIVKELVSEFQYKSIMQAPKIEKIVVSMGVGD
FT                   AVKNKKLLDSAVMELSQITGQKAVKTKAKKAISGFKIRQGQEIGAKVTLRGNMMYEFLY
FT                   KLVNLALPRVKDFRGINGNAFDGNGNCSFGIAEQIIFSEIDYDKIERISGLNVTIVTTA
FT                   LNDKEGKALLAKFGMPFSN"
FT   gene            522513..522698
FT                   /gene="rpsN"
FT                   /locus_tag="BRE_497"
FT   CDS_pept        522513..522698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BRE_497"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_497"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94729"
FT                   /db_xref="GOA:B5RPJ5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ5"
FT                   /protein_id="ACH94729.1"
FT                   /translation="MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFSMCRICFR
FT                   NHASAGLIPGVSKSSW"
FT   gene            522708..523106
FT                   /gene="rpsH"
FT                   /locus_tag="BRE_498"
FT   CDS_pept        522708..523106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BRE_498"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_498"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94730"
FT                   /db_xref="GOA:B5RPJ6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ6"
FT                   /protein_id="ACH94730.1"
FT                   /translation="MAVTHSVGDMLTKIRNASRVKHESVDLKMSKINRSILDILKEEGY
FT                   IKNYNIFDKKGIPFIKAMLNYDGKRNPAINRIDAISTPGRKVYSSYKNMPRIKNGYGIL
FT                   IVSSSKGVITGKQAKDNKVGGELICSVW"
FT   gene            523126..523668
FT                   /gene="rplF"
FT                   /locus_tag="BRE_499"
FT   CDS_pept        523126..523668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BRE_499"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_499"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94731"
FT                   /db_xref="GOA:B5RPJ7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ7"
FT                   /protein_id="ACH94731.1"
FT                   /translation="MSRIGKLPIKIADSVKVDIKDNFITVEGKRGKLSQEINSSIRVKI
FT                   EDNNIIVERAFNNKQTRAFHGLYRSLIFNMVKGVSDGFSKSLTINGIGYRVEQQGNSLF
FT                   FNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRSLKVPEPYKGKGIK
FT                   YDNEVIRRKVGKSGVKK"
FT   gene            523686..524045
FT                   /gene="rplR"
FT                   /locus_tag="BRE_500"
FT   CDS_pept        523686..524045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BRE_500"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_500"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94732"
FT                   /db_xref="GOA:B5RPJ8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPJ8"
FT                   /protein_id="ACH94732.1"
FT                   /translation="MKKVKEAEKKNIKRKKRIRDRIGFGVAERPRVTIFKSNKYFYAQV
FT                   IDDIVGRTLASVSTIEKELSLNKNISDVKKLGEVLAKRLKDKNISKLIFDRNGYKYHGL
FT                   IAGFATALREAGIDV"
FT   gene            524057..524551
FT                   /gene="rpsE"
FT                   /locus_tag="BRE_501"
FT   CDS_pept        524057..524551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BRE_501"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_501"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94733"
FT                   /db_xref="GOA:B5RPJ9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPJ9"
FT                   /protein_id="ACH94733.1"
FT                   /translation="MESQVHKKQIEKLISLNRVTKVVKGGRRFSFSAFMVVGDGEGKVG
FT                   WGFGKANDASDAIKKSLTNARKNLKTVPIKKGTLPNMVIGNFKKAKVLIKPATQGTGII
FT                   AGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFELVLDARKIAHIRGKTLRTLW
FT                   S"
FT   gene            524555..524866
FT                   /gene="rpmD"
FT                   /locus_tag="BRE_502"
FT   CDS_pept        524555..524866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BRE_502"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_502"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94734"
FT                   /db_xref="GOA:B5RPK0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK0"
FT                   /protein_id="ACH94734.1"
FT                   /translation="MIKRKLRLQLKKIRFKAARSRFKNKAFIKRMEYNREVIAKSDIKV
FT                   EVELRRSLIGKSDSKVKTLKALGLKRIGDKRIHILNKSLQGMLNSVISMVFISEVTDD"
FT   gene            524859..525296
FT                   /gene="rplO"
FT                   /locus_tag="BRE_503"
FT   CDS_pept        524859..525296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BRE_503"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_503"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94735"
FT                   /db_xref="GOA:B5RPK1"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK1"
FT                   /protein_id="ACH94735.1"
FT                   /translation="MIKLKRPLGANKSKKIVGRGQGSGLGKTSGRGQKGQKARNSSPRV
FT                   GFEGGQTPLYRRLPRRGFSNHDYKIRYEIVGLGDIDRKFETGDLVNYDTLFQKGLVNKN
FT                   KKNIKILANGELTKKVNFEISRISKSAEELATKIGCSIKLI"
FT   gene            525309..526613
FT                   /gene="secY"
FT                   /locus_tag="BRE_504"
FT   CDS_pept        525309..526613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BRE_504"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_504"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94736"
FT                   /db_xref="GOA:B5RPK2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK2"
FT                   /protein_id="ACH94736.1"
FT                   /translation="MKGLFLNLLTIKDLRSKFLFTLFILFIFRVGSYLPIPGIDPVALR
FT                   SYFKFQSDFSITNYFDFFSGGAFSNFSIFMLSIGPYISASIIIQLLVYSFPSLKKMQEG
FT                   DNGRKKIKKYTKYLTIVAAMAQGYATSLYAKSIPGALNIPFYRYIFVAILTVTTGTFVL
FT                   LWLGEQINQRGIGNGVSLIIFSGIVVRLQAALFNLFQSMRDPSQNINPVFVILVLSIFI
FT                   LVVILIIYEYKAQRRISIHYARANSKNTVSSYLPIKLNPSGVLPVIFASVLITLPLQIL
FT                   SGFAGTSVLSRQILSYLRPNGLYYTLLNVCLIIGFTYFYSKIQLSPKDISNNILKNGGT
FT                   IPGIKADEMETYLDKIMNRTLFSGSIFLSMIAIIPFLVQNIFRFPYDVSRIMGSSSLLI
FT                   MVGVALDTLIQIDAYLKTQGLSRGPGKKYAFLQKI"
FT   gene            526623..526736
FT                   /gene="rpmJ"
FT                   /locus_tag="BRE_505"
FT   CDS_pept        526623..526736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BRE_505"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_505"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94737"
FT                   /db_xref="GOA:B5RPK3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPK3"
FT                   /protein_id="ACH94737.1"
FT                   /translation="MKVRVSVKPICEKCKVIKRKGVLRIICDNLKHKQRQK"
FT   gene            526746..527123
FT                   /gene="rpsM"
FT                   /locus_tag="BRE_506"
FT   CDS_pept        526746..527123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BRE_506"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_506"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94738"
FT                   /db_xref="GOA:B5RPK4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPK4"
FT                   /protein_id="ACH94738.1"
FT                   /translation="MARIAGIDLPNNKQLQIALTSIYGIGRSRALEICKKTGILPEKRA
FT                   KDLDNEEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQRTK
FT                   TNARTRKGKRKTVANKKIAAK"
FT   gene            527154..527543
FT                   /gene="rpsK"
FT                   /locus_tag="BRE_507"
FT   CDS_pept        527154..527543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BRE_507"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_507"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94739"
FT                   /db_xref="GOA:B5RPK5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK5"
FT                   /protein_id="ACH94739.1"
FT                   /translation="MSAKVSTNKRKVKRSIGEGNVYIQATFNNTIVTVSDIRGNTLAWA
FT                   SAGGMGFKGAKKSTPYAAQMTAEAALGKVKDFGINYVHVFVKGPGIGRESAIRAVGSSG
FT                   IIVKSISDVTPIPHNGCRPKKTRRV"
FT   gene            527559..528590
FT                   /gene="rpoA"
FT                   /locus_tag="BRE_508"
FT   CDS_pept        527559..528590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BRE_508"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_508"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94740"
FT                   /db_xref="GOA:B5RPK6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK6"
FT                   /protein_id="ACH94740.1"
FT                   /translation="MSLGKLLKDFTIPDRIEFVRGEDDGSYGKFVIYPFEKGFGVTIGN
FT                   TLRRVLLSSIEGYAISAMRIQSNQEESLKIVSSEFDLIPGVMEDTLEVIANIKNVHLKL
FT                   DEGVTNTTINLSVNGKDNNVLKAGHLEREGVEVFNKDLVIATLSSDANLDFEFQVNYGR
FT                   GYVSSEQNAKYLEEVNTIALDSIFSPIEKVTYSVEDTRVGQRSDYDKLVMEIWTTGVIS
FT                   AKDAIKKAASVVREFLLPLVNFEDKVIHSVDYAEFRDSDILSMNVEKLNLSVRSLNCLI
FT                   KENVKTLGELISKSPVELSKARNFGKKSLEEIVEKLNAYGLFLGMSKVEALKVLSKHDK
FT                   ISH"
FT   gene            528609..528980
FT                   /gene="rplQ"
FT                   /locus_tag="BRE_509"
FT   CDS_pept        528609..528980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BRE_509"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_509"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94741"
FT                   /db_xref="GOA:B5RPK7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPK7"
FT                   /protein_id="ACH94741.1"
FT                   /translation="MKTKVGFNRLDRKSSHRKALLKNMVISLFRHERITSTKAKLSEVR
FT                   RFAEKLITRAKVDSVHNRREISKFIHDKYILNKLFTKISPIFKERKGGYTRVIKLGQRY
FT                   GDAAEMAILELVDKTLGEK"
FT   gene            529055..530596
FT                   /locus_tag="BRE_510"
FT   CDS_pept        529055..530596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_510"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_510"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94742"
FT                   /db_xref="GOA:B5RPK8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK8"
FT                   /protein_id="ACH94742.1"
FT                   /translation="MSYITFSSILAGVLGVILGFIIRIILGRFSLLNLDKKLKKVQEEA
FT                   ILEIENERKRVISHAKSQMLKDKNQQDREIRERKNEVFNLEKRLLQREETLDKRIAALD
FT                   KQQSRIDFKLKEFEQKEKIIREKELSLVKKIENIAGLTKDEARKIVIEKVENESKRDAQ
FT                   IIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEFTVTSVELPNDEMKGRIIGKEGR
FT                   NIRVLETLIGADIIIDDTPEAVVISCFDPVRKEVAKRTLERLISDGRIHPARIEEIVYS
FT                   VTNEINNIILEEGERAVFDLNIHGFDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEI
FT                   LAKEMKLDPVVVKRACLLHDIGKGMESISENSEGHAITGAELAQSCGESDIVVNAIAAH
FT                   HNEIKPESFEAIVVQIADAISASRPGARRESLNNYITRLKRLEEIAYGFAGVQKCYAIQ
FT                   AGREVRIIVDNLLVNDEKATMLARDIAKKIEVEMRYPGKIKVTIIRETRVIEYAR"
FT   gene            530565..531377
FT                   /locus_tag="BRE_511"
FT   CDS_pept        530565..531377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_511"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_511"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94743"
FT                   /db_xref="GOA:B5RPK9"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPK9"
FT                   /protein_id="ACH94743.1"
FT                   /translation="MRPGLLNMQDSDVIRTLIVGDIVGNGGLKKIFFHLKSLKDKYNID
FT                   LTIVNGENSSGGFGITPEIAENLFKTGVNVITTGNHIYADPSIREYLNKQEYILRPNNF
FT                   SDLLEGHGHCILNVKGEKVAVINIQGFLGMTFIVKNPFENVKKVINMIKNKVKTIFVDF
FT                   HAESNYEKESFGYFLNGLVTGVVGTHTHIMTCDERILDKGTAYITDLGMTGSLNSVIGF
FT                   NPEISLKGLLEYISLRTETVEEDVIIQGVVITSHLYTGRALKIERIQK"
FT   gene            531358..532149
FT                   /gene="tlyA"
FT                   /locus_tag="BRE_512"
FT   CDS_pept        531358..532149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="BRE_512"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_512"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94744"
FT                   /db_xref="GOA:B5RPL0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL0"
FT                   /protein_id="ACH94744.1"
FT                   /translation="MREYKNSLLNVLCRNYPSLTRDELRILIVTGRVYVNSHKEKNPKV
FT                   LVLKNSKIELVESKSKQFVSRGGDKLFEALEIFKIVVKDKICVDVGASTGGFTDCLLQE
FT                   GAKLIYAVDVGLNQLSYKLRIDPRVKVFEKTNIFNIKKFDIQPNLAVIDVSFRSVISIC
FT                   ANLIDKLSDKLIIALVKPQFELKDLDLNIKDFNGIVEHKYLNEILNKVIKKFYDNYLQI
FT                   KGILKLTTKGHKGNQEFMFLVSKNSGVNLMQSLAFLDDIDF"
FT   gene            complement(532146..532925)
FT                   /locus_tag="BRE_513"
FT   CDS_pept        complement(532146..532925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_513"
FT                   /product="uncharacterized conserved protein"
FT                   /note="LEUCINE_ZIPPER and MICROBODIES_CTER motifs
FT                   (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_513"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94745"
FT                   /db_xref="GOA:B5RPL1"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL1"
FT                   /protein_id="ACH94745.1"
FT                   /translation="MPITSGYSIDKKKKNSRRKTSSFNQVDIFLILFAIFLTAICLLLI
FT                   IKSSLLNNIFNNEQINNNFELLKAKPKEIEVKIDNTKSETIKMLNNEKFLIKPPEIKKI
FT                   KEELQEQEHKHLQNQKEVKLHFIKVTSEGHFLKQGVKRNIHYDKNILEKTLKALFNGPN
FT                   EYELKNNFLSLIPINTQILNLSVNEGIAHINLSKEFYENSFGIEGIINQVKQIISTCLE
FT                   IQGIKGITLNIENNPIILEDLNLNFSGVLDNTKLAKY"
FT   gene            532981..534303
FT                   /locus_tag="BRE_514"
FT   CDS_pept        532981..534303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_514"
FT                   /product="GTP-binding protein"
FT                   /note="2 ATP_GTP_A motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_514"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94746"
FT                   /db_xref="GOA:B5RPL2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL2"
FT                   /protein_id="ACH94746.1"
FT                   /translation="MTLIGSKIQNYSSVLIVGRPNVGKSTLFNKLLSSNRSITNEVYGV
FT                   TRDLVREICKINSYKFYLIDAGGFTLLKDELSQVVVNKVIGLLDSVDLILLVLDVNEIL
FT                   LEDYELIDRLRKYSDKVVLILNKVDSSHKEVLAYEFQKLGFRKSFLVSATHGKGINDLR
FT                   IFLRDSVGKLSDDEHIDVKIGIIGKPNSGKSTLVNFLSGDEVSIVSSMAGTTRDFIKAK
FT                   FQRNSKTFELIDTAGIRRRARINEIIEHYSVSRALRVIDMVDVVFLLVDVNEDLTSQDK
FT                   KIAHYAAKRGKGIIIVFTKWDLVKYRSGYFEAVKNRVKFFFPVLNFSPILKISVHNRMG
FT                   LDNLFKETIKLKEQLDLKINTSDLNKMLNLWVKDYHLNSSYKVKYITQISVNPIKFILF
FT                   ANKITNFPNSYYNYLVNNIRKIGYYNVPILIELREKTRELK"
FT   gene            534300..535553
FT                   /locus_tag="BRE_515"
FT   CDS_pept        534300..535553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_515"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_515"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94747"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL3"
FT                   /protein_id="ACH94747.1"
FT                   /translation="MRYIFLFLIVGNLGLFAFENFFYDFSVRSSYSNYFSSSDDAIKIE
FT                   TTKYHILDNYYIEVSNSIVGDYVYYSFFNRKNGVSYIFPGSYVIKVGKHGIEQVKIFFL
FT                   NRSDTFIRIKAGDVHSNADFYLINTLIHKDIKLPFKISDIATGSFIEVVRYIDNFIDFE
FT                   LFNPKYLEVYDNVSNMVDSLKSFLKISPLMFEVHDGAMNEFGEMVYIKTGEPQREPIGF
FT                   NCSGFSKWVADSIYKVKTEKLLKIKDLKVRHIGVRGNAFTKYHEFSRDPFFGLDWTRNI
FT                   AYKLHNVNVNLDLSKIKEFDVNNIGFLKYIENRGYEIDNLEFILYYLAVKDPGHIYLGS
FT                   LNTTIDGFPGKIFHKHIVVLFPFIDQNSIFRVSLMEINDETSIKSLKDRYPNSYIHLVK
FT                   VKVPKHISVVSIPRRIKN"
FT   gene            535559..536245
FT                   /locus_tag="BRE_516"
FT   CDS_pept        535559..536245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_516"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_516"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94748"
FT                   /db_xref="GOA:B5RPL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL4"
FT                   /protein_id="ACH94748.1"
FT                   /translation="MIKAVVFDLDGTLYPERSINLIMFPEFLKNIRFFLAFKKVRKEIR
FT                   ILQRGKSVPSSRDELISRQVNMLANRLGFNENKCEFLLNKIYYGTSFSDKFRKIKPYSG
FT                   VHDLIYSLKSNGIKLGVMSDFPIATRVSNLLNIDDSFWDILYSSEDTGYLKPNKVAFLR
FT                   ILDELGLDNKHVLYVGNSYEYDILGANSLYMQTAYLSKKKLLKDMNCDFIFSDYKDLQR
FT                   YILLNI"
FT   gene            536264..543250
FT                   /locus_tag="BRE_517"
FT   CDS_pept        536264..543250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_517"
FT                   /product="p-512 protein"
FT                   /note="RGD and LEUCINE_ZIPPER motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_517"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94749"
FT                   /db_xref="GOA:B5RPL5"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL5"
FT                   /protein_id="ACH94749.1"
FT                   /translation="MIDFVTILVNLLTVFLILFIYRQYDRRSRALDKIKKFVDLAKDNL
FT                   EDFIDEKTKEINNLAVDMEAYQRSSIEIIKKIDEVQQKIKNKSDDFAEVEKKIAYHDSM
FT                   LKDLDDMALKVQDNIQRLQVDGKVVDKLAKTLKNFNTQIDSVDSKLNTIFEKFAKTNKE
FT                   NLESIKIESWEKFDNTIRDFSVRMDNLDKNLMSYQESLLMVEEKKRDLLDKGNEKLENE
FT                   FKDFLLKIESNIDNYNRGMEKSFDIYESKSKSIENSLDLIVEQAKIKINDKEDFILTKL
FT                   NEELQRKFNEVFIYVDDRSNRIKNELEGKLVLVDNEVLSLSSVFKDNTYSRLNSLEETI
FT                   RQEMRQYEEQFADILEQFRVQIESNVGDIYREYDSKINQFDKEIRERIDYSLEDANSKI
FT                   ESVQSGVKSLLDDLEDGSNNIYLEFKKKVKGDIDSFNEDVFSRMNNIGNDLDLKLLNIN
FT                   TNIQDEVSKLDNVLYLKLKELNEKFVNEYSDLYENVNSKYVMLLESLNLKSNELEIQLG
FT                   SKYKGIADKFERSINDFTVECDERFSNIAEKSDYDYQNFETISKRVNEGINSLNVLLEQ
FT                   NFETLKRNFESKLHGINSDIDNEVLNLKNHYGEEIGNFVRAMEANKLQYENWQKEVELN
FT                   LKEVKSNLNSANEEFLNLIETQRIKGTELSENIFNELSEHIHKKAMDMHTNWKDELIIL
FT                   NKSLLDIKISSEELLSSTSSKIDSFEKDVNERLEYVVSKTETFEGSVLDRYRELKDMSS
FT                   KNSEEVLLGIKEFIDNQAEIIHDKVIMMLNGFNDDFSNREEVIKNKIEELNYSLKDFKI
FT                   ECEDVLNNLRSDLDAFIETRVQKISAIKMDNQKQIDDFLTQISEDILSKKDMLDNEIDS
FT                   KLNTWQDKLGEISVNIENVLSSGKMDINSIDSEMALKINDLKTTFKGLESYYLEKIDEF
FT                   RNQGNVYADELLQNIMSHFDTNTKELEESLSKKFAIVLDKSEEFVKEVDSLLKDKRTDI
FT                   ASFQANIDITIDSLNSRFNDLNREINEKYSKVISDSREYSETLANKLENEIGYEIENVN
FT                   RRLTDKIDVLSKNMDENIEKFKESFDISRYQVENFEIRIKDIVEKEEVRIGELLREIEY
FT                   QYKMRREEAIDYRKVMDNDVIQLKERFIGVINELKNNIEDKSEFLNELYKERFKIVENN
FT                   FDERYSTFFVESEGAISRIRDEIYKILTDNDDRLRAKIAEMDRNFEIVDARSKEILEFE
FT                   EGLRKKIEENNNSIYEQFDIVKFDIEKEMKIQFNAYMMKVTSAINDEIEKYEYGINKKI
FT                   DVLKSIENNCEIIEQNLKEKMEKYNNDCDKVFDLKYAELEDKYNEKHSLIERKIDDKTN
FT                   VVEELISNKYAELEGKYNEKHSLIERKIDDKTNVVEELISNKYAELEDKYNEKYSLIER
FT                   KIDDKTNVVEELISNKYVELEDKYNKKHSLIERKIDDKTDVVEELMSNKYAELEDKYNE
FT                   KYSLIERKIDDKTNVVEELISNKYTELEDKYNEKHSLIERKIDDKTNVVEELISNKYVE
FT                   IDNKYSSMHFDVENKLNTFISELNLKLANSSEKMDRDIKEQLDNLTKLKLNLSNIEGDV
FT                   LKLKEDSYHNVSSHLKLLEEDFFRDLKERGDNLRSSLENFVTSSDQRIENLEREIIKNL
FT                   EDKENLIKDFRREIEQKFILNKENFYLEFSKEFDVKKRDIESKIVLMETNFTNRVDEFI
FT                   GFIDNRQSNVDSWFVKVKDDMLNWQKNAYKEFEERSGITKESLNQIKNDIDIIENDLAI
FT                   VKSNVTQQTKETFENLHTDIKDFEDRTYFNLKNISNEVQGKVLNIENNMNFKISSINEK
FT                   INLSTEELATQIEIKFLSQQKDLEDKIFEINEKLKYEYDLVTSKIEREKQSVVDNFLNG
FT                   KDSFESQIKLIQNDVSKLSEQVNTYRSDIEGTIKESYDSFSSIMKEEYSVFENEIKDNL
FT                   NYSEEEIRTLKNNLQIQVSNIETEFKDRYNLITKSVDENISELKLKALNYDNEFNNFVS
FT                   EIKNNLIAYKTNLMKELDDRYNVINTKIENFERLEAELEKNYELIKEVYHFKNKLEDLR
FT                   KTLIDEIDLVKKYKGDFESVTREIEDVKIRTSDIIEVFNDLKTHQMDIKGIKKDFVEFL
FT                   DFYSSFKERYKKFTESYDEIQIYKTKLKEIKDDQNTILDNYDRIGNKDTILKSTLESVD
FT                   RNFDLISEIESKMNVLFKESSGLTHNIGELKDIVSELLANKDLSQEALNNVQNLKEMLL
FT                   EIEDKLGYIQNVREKVAKSETRLENLNVAAEERIKTLGILVKTESKYKDNIGLNNATVR
FT                   DSVIKLMRQGWSALEISRATKLSVGEVELILELGIVSKSDD"
FT   gene            543261..544808
FT                   /gene="pheS"
FT                   /locus_tag="BRE_518"
FT   CDS_pept        543261..544808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BRE_518"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_518"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94750"
FT                   /db_xref="GOA:B5RPL6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL6"
FT                   /protein_id="ACH94750.1"
FT                   /translation="MGNIFDIAKTLHPLEVRVILNYKEEDSVFALRLSKDLNYNEGQSN
FT                   KVVEWLLSKGILKETFRKLNVFYRLTEKGVDAFNNGLIEERIVTLVSQKMVLVSNLASE
FT                   LKIDFRDVGKAFGNLSREGVLSLGSNKEIIIKNLECASYKMVKILVERARDQDLLEDAL
FT                   SQDELLIISNYSKKKGASDVLFKIIEKLDLRFEFTKFGLEIKSYLEKNDLKGNEIVKLT
FT                   PEMLKNKSYENKNFRAYNIHVSSNKTFIGRANPYSEYISKVKDKLVSLGFEEFDGPLVE
FT                   SEFFNNDALFMPQFHPARDIRDVYYIKEPNSLKSLPEPYFSNVKAVHENGYIAGSRGWK
FT                   YNFSESISKRLVLRTQGTVLSAKQLINAKNPGKYFGIVRCFRYDQVDATHGADFYQTEG
FT                   IVIGDVNIKTLLGLLEIFAKELAGATDFKYVPAYFPFTEPSIEVHVKHPILGWFELGGS
FT                   GIFRPEVTKPFGIDVPVIAWGIGIDRMALMHLGLSDLRELFTHSIGDVALRRGKSNA"
FT   gene            544801..546495
FT                   /gene="pheT"
FT                   /locus_tag="BRE_519"
FT   CDS_pept        544801..546495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BRE_519"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_519"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94751"
FT                   /db_xref="GOA:B5RPL7"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPL7"
FT                   /protein_id="ACH94751.1"
FT                   /translation="MPKVEIYKSILLEKIGKNLTNYELESIIETAKAEICEIDIVNDKI
FT                   KIEFNDTNRPDLWSSAGLARHIKTYLSGNVPSFDFFSMTDNLQKFYGEIFVSPEVFGIR
FT                   PFIFGFLAKGMICDERMLESLIQLQEKLSHNYGQKRKRIAMGMYSSNLIHFPINYVTCS
FT                   SDYKFVPLGMDIEMSIKEINERHPKGIEYSSIFENVDQYSLLLDYKNNVLSYPPIINSR
FT                   DIGTLKVGDTNLFIEVTGTDLEATLLSLSIVACDLYDMGFKILPVKTVFPRETLFGKEI
FT                   ICPYYFQNSLKINVDSVNKLLGSNFTANDMCLDLKKLGISAYFEESDTFYIMPPVYRND
FT                   FLHEVDVIEEVMIGKGLDNFKSELPKDFTIGKLSPIEEFSRSVRNLMIGMGFQEMIYNY
FT                   LGSKVDFIEKMNIKGSELLSVSNPMTESYEYIRGSIIPDLLKSESISSNFPYPHKIFEI
FT                   GKVALKDLVSDEGTVTYDNLAFLMADKEFSFNEINSLVSSLFYYLNIGFKVKESSKNLY
FT                   IDGRGADILVNDIVLGCFGEVSPYILNNFGIMVPCCVLEININGLLN"
FT   gene            546584..547561
FT                   /gene="trxB"
FT                   /locus_tag="BRE_520"
FT   CDS_pept        546584..547561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="BRE_520"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_520"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94752"
FT                   /db_xref="GOA:B5RPL8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL8"
FT                   /protein_id="ACH94752.1"
FT                   /translation="MLNFEVLDIKKCNREIIRTEVDFVEDVIIVGSGPAGLTAGIYTVM
FT                   SGYKTSILEGPEPGGQLTTTTEVYNYPGFKNGINGRELMLNMKEQAINLGATTYFETVR
FT                   SIKKRGDIFCLYTDNYIYKSKSIVIASGSIPKKLDTLKNLDLFWNRGISVCAICDGHLF
FT                   KGKTVAVIGGGNTAISEAIYLSKLAEKVYVIVRKNYMKAIDMLQKSIKTLSNVNILYNC
FT                   EAREVSGENIVSKIHIMDNKHNSAFELNVDGIFIAIGYKPNTEFVKGFLELDDDGYIST
FT                   QDIVKTSVNGVFSCGDVSNKLYAQAITAAAEGFLASVEVRNFLG"
FT   gene            complement(547590..548324)
FT                   /gene="yacO"
FT                   /locus_tag="BRE_521"
FT   CDS_pept        complement(547590..548324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacO"
FT                   /locus_tag="BRE_521"
FT                   /product="rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_521"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94753"
FT                   /db_xref="GOA:B5RPL9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPL9"
FT                   /protein_id="ACH94753.1"
FT                   /translation="MYITHANSIIESIKNNKGLELYISKTSPKAISIEQLARQHNIKII
FT                   KINDLTKILGNNNHRGFALKLQNLKDYNTINKNKNLEEYLKEFQHKNNILILILDSIED
FT                   PQNFGAILRTAEQFNIDLVITNQRKSVKDNATVLRTSSGASQYVNKLTVPNINNVIRYL
FT                   KKQGFWIYASDIKGQAINNTKITDNKIALIMGNEGKGIHNLLKNNSDFLIKIPTKGKID
FT                   SLNVSVSTGILIFEIKRQLNLL"
FT   gene            complement(548326..549426)
FT                   /gene="dnaJ-1"
FT                   /locus_tag="BRE_522"
FT   CDS_pept        complement(548326..549426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-1"
FT                   /locus_tag="BRE_522"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_522"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94754"
FT                   /db_xref="GOA:B5RPM0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM0"
FT                   /protein_id="ACH94754.1"
FT                   /translation="MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKDNKEAESI
FT                   FKEATEAYEVLSDDNKRAQYDRFGHTAFEGGASGFSGFSSGFSGFSDIFEDFGDIFDSF
FT                   FTGKRGQDKNRYQERGQDLTYQIEISLEDAYLGYKNNINISRNILCESCLGKKSEKGTS
FT                   PSVCNMCNGNGRVMQGGGFFRVTTTCPKCYGNGKIISNPCKSCKGAGGVKHKETLELKI
FT                   PAGIDDAQQIKMRAKGSINPDSQQYGDLYIKILIKPHKIFKRNGKDLYATLPISFTQAA
FT                   LGKEIKIQTIANKKISIKIPKGTENDEQIIVKNEGMPILHTEKFGNLILIIKVKTPKNL
FT                   NNNAIKLLETLSKEIKDIDEVTLNKI"
FT   gene            complement(549426..551324)
FT                   /gene="dnaK-2"
FT                   /locus_tag="BRE_523"
FT   CDS_pept        complement(549426..551324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK-2"
FT                   /locus_tag="BRE_523"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_523"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94755"
FT                   /db_xref="GOA:B5RPM1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPM1"
FT                   /protein_id="ACH94755.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEHGKPVVIQNSEGGRTTPSIVAYTNK
FT                   GERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEEVASEIKMVPYKVEKGQNGDARVNIS
FT                   NIKKQMSPPEISAATLTKMKETAEAYLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGL
FT                   DVKRIVNEPTAAALAYGIEKKHEEIVAVYDLGGGTFDISILELGDGVFEVKSTNGDTHL
FT                   GGDNFDDEIIKYLITEFKKDSAIDLSNDKMALQRLKEAAEKAKIELSGAQEASINLPFI
FT                   TADANGPKHLQYTLTRAKFEQMVDHLVQKTKEPCLKAIKDAGLKASDINEVILVGGSTR
FT                   IPAIQKIVKEIFGQEPNKGVNPDEAVAIGAAIQGGILTGEAKDMVLLDVTPLSLGIETL
FT                   GGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMASQNRVLGNFILDGIP
FT                   AAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSEEEIERMVKDAESH
FT                   AEEDKKLKEGIEAKNIANSLIYQTEKSLKEYGEKITNQDKEAIENKIKELKDTLEGSDI
FT                   SLLKSKTEELQQASYKIAEMMYKDAQASSPAQNNAQNNAGSESKEADYEVVDEDKK"
FT   gene            complement(551368..551916)
FT                   /gene="grpE"
FT                   /locus_tag="BRE_524"
FT   CDS_pept        complement(551368..551916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="BRE_524"
FT                   /product="chaperone protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_524"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94756"
FT                   /db_xref="GOA:B5RPM2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM2"
FT                   /protein_id="ACH94756.1"
FT                   /translation="MDEKEKCKDPEKIKENENETFQNEDNPNMEKKIIELENEISNLKD
FT                   LYLRKQAEFENFRKRLEKDKENFIKFANENIMKDIITFLDNLERAIDSSKQSKDFDTLL
FT                   SGISMIENEILSSFDKKYNLKKFGKLGDEFDPSQHEAISIEEKEQIINPQIVEVYQKGY
FT                   CYNNRVLRTAKVKVAQSKN"
FT   gene            552280..553848
FT                   /locus_tag="BRE_525"
FT   CDS_pept        552280..553848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_525"
FT                   /product="NH(3)-dependent NAD synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_525"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94757"
FT                   /db_xref="GOA:B5RPM3"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM3"
FT                   /protein_id="ACH94757.1"
FT                   /translation="MLIIYFVKICVAQIKCRIFRFNEILNEFKVNCEYAIQNKVDILVF
FT                   PFIFIEGIEYENLFYRPEYVKKILYCIDFIKGQVDAGLCVVFGHYNFYDGKLFDCISVV
FT                   SDHQYILTTREVNVPVLFSYKGQSIAVLNLDDELLFHKSQYKFHDSFSKIDYLVIPSKS
FT                   YFTCEKNNLRLEFFKDVAIKNNLEIAYANLYGIYDSIVFDGLSFFINKYGKIKQAKEFE
FT                   YDILFNEEFYDLEFDCESKIFDKLLGALVISLREYVALAGFEKVHLGVSGGIDSALVAY
FT                   IACTALGANRVIGIFMPSRFSSKGSVLDAERLANELGFELIHMPIESMFQFSLDYLDGY
FT                   LNTKGVTEENLQARLRGLFLMSYSNANRSLLLNTGNKSEIAVGYCTLYGDSCGGISLIG
FT                   DLFKLDVYNLARYVNKKEGREVIFSNILLKEPSAELRADQKDSDSLPTYEVLDGILNRY
FT                   LLENEPLELLYKSFGKEVVVRVLDLYSGSEYKRRKGPMIVKVSKKAFGSDIFLPISRVA
FT                   LIEDE"
FT   gene            553835..555424
FT                   /locus_tag="BRE_526"
FT   CDS_pept        553835..555424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_526"
FT                   /product="Response regulator receiver (CheY) modulated
FT                   Serine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_526"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94758"
FT                   /db_xref="GOA:B5RPM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM4"
FT                   /protein_id="ACH94758.1"
FT                   /translation="MRMNSNNVINVLNEFGLKIEEIFLLINTYSYALYKETPRYFYDDI
FT                   TNYLELTLDIANKFQGEFADSKDLKLGKFMLRSMKCDLMSYLYLSLELIDNSMHYSGIG
FT                   DAGIAFFKAISCKILSVVSYIEIEFENMVFSSALKNRKDANKGGNQLLIFSCESAYSTK
FT                   LVNYLILKDYIVISANTVDLFSQLLCDNFYDLIILDLNSDENIQMILDLLRNIKSNSLY
FT                   EMVPVIVISQITRKDIIQTFIEEQVDDYFFKSLDLLVLDIRITSFLKKKKVIEQGQKYL
FT                   DLVLHGRECVESELIEAGNYIENLLPKKIRNEFFHSNWIFVPSKRIGGDFFNYYFVNDD
FT                   NLIIYLIDISGHGVDSALLSLNVSSVINSYVMNNNDISPYKVLNYVNTYFVKFRSDMFI
FT                   TLWYGVLNVKTKHLRFASAGAPPAVVLSEKGNVYLKTKGAILGIEEMYPCKESECYLNK
FT                   FSHLLLFSDGVYEIENNQDIIMSIDDFYKILKKNTLNLDSFVLERLYNKMLNLSKYNVF
FT                   RDDFSILEFIIY"
FT   gene            complement(555576..556031)
FT                   /locus_tag="BRE_527"
FT   CDS_pept        complement(555576..556031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_527"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_527"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94759"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM5"
FT                   /protein_id="ACH94759.1"
FT                   /translation="MKIPKNYIPGTNPYKSLPKKPIIESTKKISKKQEQINAEIMNSQE
FT                   KILKLYMRRLQKKEQMMLQTFIVEGHKVGSKIFNNLPKTLKEIITIMNIESFKILLKNT
FT                   KNPIKKLYIKFSSWTLNKLLKSIDNSSIKQDKKTSIKNTQKQKTKNK"
FT   gene            556139..557947
FT                   /locus_tag="BRE_528"
FT   CDS_pept        556139..557947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_528"
FT                   /product="uncharacterized conserved protein"
FT                   /note="2 LEUCINE_ZIPPER motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_528"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94760"
FT                   /db_xref="GOA:B5RPM6"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM6"
FT                   /protein_id="ACH94760.1"
FT                   /translation="MNDMKRYLSLSFFYLLIGILFLFIIILIQFRNLSLNIFLLNDLKF
FT                   FVNNKVEDSHYVLDNLVLNIRGIKINLSKTYPIIIPENSLKLYPISYKVQDNSIYVYFE
FT                   NNIFLLFVFDLNNNFQISSNLSKKFLISYEIESDYKILFDKNIIVNDSTNNYFDVSLGK
FT                   HSKLKEREILISPQEVFQIGNLVAKPQIANEVVSRDIPLNMNFSAVYSLIKKISKKNFD
FT                   SVLMKFRDKVYDAWSSSSNFSIKKGGWRKGNVYSFDEDIFIYYLAESLTRHNYEDIFPK
FT                   LKPLISLNEDSLTYLSSSYYVDAEKIDMFFHYLSVNKTFINSLEPDKILKYLKEDAYLL
FT                   EKIFLSENVSILNESLNILRTPEVILSSGFDLTQAYNILSNYIIFLQFDNDSFILDKLR
FT                   EELIKFISTLFFVTNNGEAYVSENKKDLSWDIEYTLKIAGLLKRLASKLNSNLILEFAC
FT                   NAIYYSLMNSDGNSIPYENYYADIVDNDYIPKFNLFPNLGIGHWIYSSSKIVNFNFSQS
FT                   FYSIEFDRDLNSPGYFFFKGVERPTLVRFRNINWFTDIQFYIYSDGWRYYAGDKTLVLK
FT                   ITPKKLDDTKIFLRFDNIMGFRDIDE"
FT   gene            557937..558731
FT                   /locus_tag="BRE_529"
FT   CDS_pept        557937..558731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_529"
FT                   /product="pantothenate kinase"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_529"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94761"
FT                   /db_xref="GOA:B5RPM7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM7"
FT                   /protein_id="ACH94761.1"
FT                   /translation="MMSKIVDSTQLIVDIGNTSISFALYDVGGMQIFCKLKTKLDLSFR
FT                   ELCNFLKLKFNFKVSKVFVSSVVPVIDKVLIDAIIFLYNVTPLFIGYDLSYDLSFEFYN
FT                   GRKFILGSDVFANLIGAIEYYNINDALIADIGTACTIFAVSRKDGILGGLINGGPFTSL
FT                   TALVENAYLLKDFNLVVPQNLLGLSTIDSVNSGVIYQYKYLIEGVYHDLIRNYDREFKL
FT                   IITGGNSNLILPLISVDFIFNLYLTLEGIRILGNAFKENHLS"
FT   gene            complement(558709..559539)
FT                   /locus_tag="BRE_530"
FT   CDS_pept        complement(558709..559539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_530"
FT                   /product="uncharacterized conserved protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_530"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94762"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM8"
FT                   /protein_id="ACH94762.1"
FT                   /translation="MRMQKNKDKISEILEFIYSKYNKREFVHPDPLEFLYKYTEKEDIE
FT                   LVGLISSSLALGRVERILSAIEYILKPLGKQPSKTLKTFTRKDLNEIYKDFTYRFFTTE
FT                   DIVKLLMSIKTIKEKYLSIENLFHNIYKKNKNFIASLDELITQMENVNKKPFGMILPKP
FT                   SKGSACKRLFLFLRWMIRKDNVDLGIWNKINPSNLIIPMDTHMRDISAKLFNLQNTKNV
FT                   SLKRAIEVTKYFLEQNKDDPVKYDFSLTRFGINKSFNKKELFTNIFNFKTNDFL"
FT   gene            complement(559520..560131)
FT                   /locus_tag="BRE_531"
FT   CDS_pept        complement(559520..560131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_531"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_531"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94763"
FT                   /db_xref="GOA:B5RPM9"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPM9"
FT                   /protein_id="ACH94763.1"
FT                   /translation="MHKKFILLLISQILLTVKSYCIEEIIEINTSTQKEKYIPFLLSKG
FT                   KSQVEDIVKYTLKMNPYLEAEYVKTIAQIYIEEAIIEGINYDIAYAQMLLETGILKFNG
FT                   IVSKEQHNFSGLGATDNFTKGNSFSNMQEGIRAHIQHLKAYASSQDINSNMVDPRFYFV
FT                   KRGSAPTIYDLTGKWATDKLYDKKLKKILLGLLEFENAKK"
FT   gene            complement(560134..561423)
FT                   /locus_tag="BRE_532"
FT   CDS_pept        complement(560134..561423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_532"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_532"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94764"
FT                   /db_xref="GOA:B5RPN0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN0"
FT                   /protein_id="ACH94764.1"
FT                   /translation="MYEQSYETIFLLSFGIFLIINLFNFKKEFSYEDYFIIFPGTFFII
FT                   TLYLIEARPLMLYTGSIFLFFLIITTIKTLKTIILRRQKQRKQNNKLKRIIFTIPFKIM
FT                   IVIPSIIIVFIATIFSYLSFFINYPKDINANYKIGFTKIKDHKNNLNLSVWYPINLTLG
FT                   LKRQNPFFYYDFNPFFINEMNYLPTYENVYKDAPISTNQKLYDSILIILPSYSHDSMFK
FT                   SLVNRLVKKGNIVYLYSPIYKHINIHNFIKNNNTTLLTHISNSMIKYLVEPIKIFSQRK
FT                   DKTSDITEIQNVIELVKSSQKLKFLDSRMNINQLVLITMGNQINIANEIINQNQQIKKY
FT                   INIGGKPQKFKIKTLQLLIKQDENEWQQTESDISSIKIINMNHIGEISDFIFSRSYLSS
FT                   FNLFKNQELTLPRFDFMINEIDQFIEDKGH"
FT   gene            561584..562342
FT                   /gene="phnP"
FT                   /locus_tag="BRE_533"
FT   CDS_pept        561584..562342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="BRE_533"
FT                   /product="phnP protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_533"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94765"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN1"
FT                   /protein_id="ACH94765.1"
FT                   /translation="MLGIFLGTGASSGVPMLNCNCRVCNSDFCKNKRLRSAFLLSLCGL
FT                   NLLIDMGPDIRTQLLRENILKLDLVLYTHEHYDHIMGLDDIKFYTRCVPLPIYARETTM
FT                   HHIKNAFPHNFSSRMSISGKANILPRLAVDFEQIFFKGIKIIPIPLLHGDIISLGYRIN
FT                   NLAYLTDVKSIPEISYSYLEGLDVLVIDALRIKPHPGHLNFDDAILEVKKINPKIAYFT
FT                   HIAHDIMHDEFDYLRRDNIYLAYDGLQIYI"
FT   gene            562354..563118
FT                   /gene="exoA"
FT                   /locus_tag="BRE_534"
FT   CDS_pept        562354..563118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="BRE_534"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_534"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94766"
FT                   /db_xref="GOA:B5RPN2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN2"
FT                   /protein_id="ACH94766.1"
FT                   /translation="MMNLISWNVNGIRAVSNKGFLNFIAEYSPDILCLQETKALKEQLP
FT                   RELIDIEGYYSYFSKSIIKGYSGVAIYSKIEPIKLENMNIEIFDREGRCIIAHYHDFIL
FT                   INAYFPNSQSLRKRLNYKLEFLMSFESIANSFVTSGKNLIVCGDFNIAHTEIDLSNPKT
FT                   SRESAGFYVEETNWMDNFLNRGYVDTFRMFNKEPGNYTWWDYKTRARERNVGWRIDYFV
FT                   INKAFQFKVKDALILNKVMGSDHCPVFLKLKQ"
FT   gene            563142..563903
FT                   /locus_tag="BRE_535"
FT   CDS_pept        563142..563903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_535"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_535"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94767"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN3"
FT                   /protein_id="ACH94767.1"
FT                   /translation="MSRYFVMVLFLCIHNLIFGIKLINLESIDFYRSLEKQDLLFIIHL
FT                   LEREKYLNQKDELFTYIDLANQALIEKGTQVLGGNDKLDDMQLINSLQRDNLDNYNSSK
FT                   FVLQASKALNIFVFFDDIDGFLKTLDGRRVSFSDGNFVILDQVSFKGYNNVASEHSTIE
FT                   IYEKSILNPDFNKLILDKLGFFVYIGELNKKIYFNDIVKLSKGELLFLFYELFPISRLK
FT                   GIKDWYDFGFTSIIREIKKVYNTRINSRKLK"
FT   gene            563900..566725
FT                   /locus_tag="BRE_536"
FT   CDS_pept        563900..566725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_536"
FT                   /product="zinc protease, putative; lipoprotein"
FT                   /EC_number="3.4.99.-"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_536"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94768"
FT                   /db_xref="GOA:B5RPN4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN4"
FT                   /protein_id="ACH94768.1"
FT                   /translation="MRCKRINNITILKVVFFVLSFIILSCSSSKLSLDKNLVNGQLKNG
FT                   LKYYIYKNQIPSKFVHMGILFNVGSLNEEENERGLAHYLEHMAFKGTEDYPGSEDILEI
FT                   LKKFGMKFGADLNAYTTFDKTYYYLDLSDGGQESEVDEALNVLKNWAFQIKFDDLEIDK
FT                   ERNVIIEEKKYRDNYSSRMSKKMFEVVGGNSRYFIRSPIGIEERILSFKSEDFKKFYNK
FT                   WYRPDLTSLIIVGDIDPKDIEEKIKKLFASFKKPLDEPEKVVINLDTVIDKKFVSIDDD
FT                   ETLFPSIEFICKEETKGGIVTVEDLKRYIEKNLLNSLFINRFYELKVIGTNYFSSFNKF
FT                   GSNYKSDNNYILIKNISLTIDPEHFKEAFEGFFYEIERIRKFGFTKGEIDKIKSEMITS
FT                   YTVDKENLKKQKSSIIADHLVGVASSNFHLLDGNEVFDVAIKCLNNISPDTISALASSE
FT                   AFIDNMTVIYKYSKKLHSNLTFEELQKFRDIALNKEIKPYDDVSIQGEFFKKSLQSKNI
FT                   VDEKEFINEISSFTLENGVEVYFKHNENKKNIVDFTAISWGGLLSEDPELIPVLSLAPS
FT                   IVSKSGYGDYSKLQIEKYLSNKLVTLMPSVSERTSRINGGAEAKDLETLFKLIYFTFNE
FT                   AKIDDVVLQTTIDDMSATIKARKNSSNYLFSNAIKKFYNNDDYRLRDIQESDLQNISKD
FT                   ILLDFYKKRFTYADNFKFIFVGDIDLDTIKKFSSKYLGNLNSKKLNEFRDLDYSYKKNT
FT                   KRIVVGKKEDAASSTVYVVYPFTFNYTPEEVLNYSALASLLSEGLVKAIRREQSSVYGI
FT                   DASFDHYFRKHSDSDGFIVVSFTVEPKALDSVLKSVNEYILERQKIDFVDTDFDYIKKN
FT                   IIKNNNIASESNGYWSSVILNSVLWHDSIIDTFSNKFVDDNLNKDTINMLFKKIDFKQG
FT                   TEIVLIPSNDN"
FT   gene            complement(566748..568184)
FT                   /locus_tag="BRE_537"
FT   CDS_pept        complement(566748..568184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_537"
FT                   /product="hypothetical protein"
FT                   /note="ZINC_PROTEASE motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_537"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94769"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN5"
FT                   /protein_id="ACH94769.1"
FT                   /translation="MKRILMMLIFLTRLYAINETNNQKKCIIINNNKKIVYCHNEKIDH
FT                   LILNLKNNKNANIKINTQYKSHSYNIPTIINQDQTMILEIKINNIKSINFNNIEIQKSS
FT                   IQTTKTDLQKFKIFIDKDGYSINFNLNKNMFPIIGFKSKETILNPIITNLYSKKESQKI
FT                   VLSNLIKYTSLENHNDEIKSTKNDNMIQINEIGYINMNDYYEINKPINADLKLIFNYTK
FT                   KNYRRDSFEFFNFIANPNVYIIKFKTLHDQALMLKRMAFFLEKKEFRGRLLSNTELENK
FT                   VGWGGHDYRLQDIITFFNEAQKSNIKLNKEEITLKNLIIANKLAYIENNIIKIKNKSKN
FT                   ITFATYSEDEIMSKTDQMRIFMHEMLHMYFFIDNNFNKEIVNFWNKNISPNNKKSWINF
FT                   LDNIGYDVTFNYLVMNEFYAYTTALPKENIANYLINTNYFSKTEFKEYEQWAIKLEKLL
FT                   WQTKGLIPGELLILFKDNNN"
FT   gene            complement(568243..568315)
FT                   /locus_tag="BRE_538"
FT   tRNA            complement(568243..568315)
FT                   /locus_tag="BRE_538"
FT                   /product="tRNA-Glu"
FT   gene            complement(568323..568395)
FT                   /locus_tag="BRE_539"
FT   tRNA            complement(568323..568395)
FT                   /locus_tag="BRE_539"
FT                   /product="tRNA-Lys"
FT   gene            complement(568487..568560)
FT                   /locus_tag="BRE_540"
FT   tRNA            complement(568487..568560)
FT                   /locus_tag="BRE_540"
FT                   /product="tRNA-Lys"
FT   gene            complement(568609..569256)
FT                   /locus_tag="BRE_541"
FT   CDS_pept        complement(568609..569256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_541"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_541"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94770"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN6"
FT                   /protein_id="ACH94770.1"
FT                   /translation="MTNKHFDSKLRIILFLPLLCLTIKIQAQVKEDSLLLYRQGKFQEA
FT                   IINTQNEIKNNSNNLDARVILIWSLIATGEYKKAELESIKGLEIKKHDSRIIQALGEAY
FT                   FFQGQYKNALKHFQKYIGLDANGARIAKVYILTADSFYKLERYNEADFAYENALRFFPN
FT                   NQNILLKLAKSRINAKNKILAKETLTKLLTLNPNHLEAKNLLQKIEKNNHNS"
FT   gene            complement(569253..569603)
FT                   /locus_tag="BRE_542"
FT   CDS_pept        complement(569253..569603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_542"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_542"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94771"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN7"
FT                   /protein_id="ACH94771.1"
FT                   /translation="MSIDTLEFEENSTQNVIKSNFNFEGYIESSKPIIIDGILKGFINS
FT                   TSSIYLREKAHVEAEIKCNNFLNHGTMKGNVEALETIKIYKTGKLIGNITTKELFIEAG
FT                   ASFNGNCEMEEK"
FT   gene            complement(569692..570387)
FT                   /locus_tag="BRE_543"
FT   CDS_pept        complement(569692..570387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_543"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_543"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94772"
FT                   /db_xref="GOA:B5RPN8"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN8"
FT                   /protein_id="ACH94772.1"
FT                   /translation="MLELTQDKQEIKIKNKFLAHVFGLMSVGLLISAIFAYTTSENAII
FT                   RAIIFTNPMSYIAIILIQFGFVYAISGAINRISSGTATALFLMYSALTGVTLSSIFMIY
FT                   TQGSIFYTFGITSLTFLAMSFYGHTTSTDLTKMGSYFMMGLWGIIIASILNMFFRSSGL
FT                   NFLISILGVILFTGLTAYDVQNISKMDNMLEDGTEIKNRMAVVASLKLYLDFINLFLYL
FT                   LRFLGQRRD"
FT   gene            complement(570400..572481)
FT                   /gene="fus-1"
FT                   /locus_tag="BRE_544"
FT   CDS_pept        complement(570400..572481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fus-1"
FT                   /locus_tag="BRE_544"
FT                   /product="translation elongation factor G"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_544"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94773"
FT                   /db_xref="GOA:B5RPN9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPN9"
FT                   /protein_id="ACH94773.1"
FT                   /translation="MDYKKLRNIGISAHIDSGKTTLTERILFYCNKIYAIHEVKGKDGV
FT                   GATMDSMELEKERGITIASAATHVEWKNHPINIIDTPGHVDFTIEVERSLRVLDGAILV
FT                   LDSVAGVQSQSITVDRQLKRYNVPRLAFVNKCDKTGANPSNVKDQLKDKLGLNSVLMQI
FT                   PIGLEDKHMGVVDLVVMKAYYFEGKDGTEIIEKEIPAELLNEAEEKRKIMLDALSDFND
FT                   ELMELHMEGKNVALETIYNAIRTGTLSLKLCPVFMGSAYKNKGVQLLLDAVNKFLPSPH
FT                   DIQNIALDLNANEKEIKLKTDETLPTVALAFKLEDGQYGQLTYVRIYQGVLKKGQELIN
FT                   SRTSKKFKVGRLIRMHANNTEDIEFGNSGDIVALFGIECASGDTFCDPSINYSMTSMYI
FT                   PEPVISLSIKPKDKKSADNMAKALGRFTKEDPTFKTYVDNESKETIIQGMGELHLEVYI
FT                   ERMKREFKAEVETGMPQVAYRETITEKAEFNYTHKKQSGGAGQFGRVAGFMEPLDTEEQ
FT                   TYEFVNLIKGGVIPTEYIPSCDKGFQKAMEKGTLIGFPIVGVKITINDGQYHIVDSSDI
FT                   AFQLAAIGAFREAYNKAKPTILEPIMKVTLEGPTEFQGNMFGLLNQRRGIILGSSEEGT
FT                   FSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPNATFNELCKKFNEQNNK"
FT   gene            573018..573260
FT                   /locus_tag="BRE_545"
FT   CDS_pept        573018..573260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_545"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_545"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94774"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP0"
FT                   /protein_id="ACH94774.1"
FT                   /translation="MEDISLNTLTISHELSKISQVDYDSALSELSVFFKDGRAYKYFKI
FT                   EPRHFNIISKLVQEKKSVGKYLTEHIFYKYDQERL"
FT   gene            573463..574548
FT                   /locus_tag="BRE_546"
FT   CDS_pept        573463..574548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_546"
FT                   /product="hypothetical protein"
FT                   /note="LEUCINE_ZIPPER and AMIDATION motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_546"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94775"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP1"
FT                   /protein_id="ACH94775.1"
FT                   /translation="MRKKLIFITLLLVSLFSTSYAKVIYFSAGFSTQISLESLSFFGKK
FT                   TGTILDKLMSSELFPILKNIRVNLFNQIKEFESSAHKLHNSFQKSLSLFVQLYKNRKSG
FT                   TGQVENMNDSDLDGLGPLLNSTHDLRSFLIELRKLHLNGTFRKLGESGSHLKELIVDLE
FT                   NTAKQALSLKDSLFAQLNEFGVYNQDDLMKIWNEISTPGTNLNDALRQKLSPLFSSGFQ
FT                   GYFQVGLPIFQSDFYYGFELGFGMNLGRLIVPHLRLLESSYPVKLGMGIMPRLFVKYDI
FT                   YYLAATLFSGFGDRSLVVDPIYVGNLASKNKITNPFSLIETGLRLRLAFLNFESSVLFS
FT                   INDFKYRDLRVGLGFEIPIII"
FT   gene            574652..575203
FT                   /locus_tag="BRE_547"
FT   CDS_pept        574652..575203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_547"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_547"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94776"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP2"
FT                   /protein_id="ACH94776.1"
FT                   /translation="MLGFALMYKGLFFCLLYFVLSCKTFDKDYQTIADEYYKLAKLNEE
FT                   LGNNQTSVELYEQAIKFDSNINAAFGYNFILAYVNLKRYEEAELKLGSLLENDKDNILL
FT                   INLKAYLFFKKDNLEEALKLYLKTLEIAPANQEALFNVFYIYHLNKDMENAKKYILKYQ
FT                   EFKYSVPSNASDIVSSILKD"
FT   gene            575258..575926
FT                   /locus_tag="BRE_548"
FT   CDS_pept        575258..575926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_548"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_548"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94777"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP3"
FT                   /protein_id="ACH94777.1"
FT                   /translation="MNSFRYFGGFNVMKIKFLFLSLWIFVTVNVLSSVDFELNLGFGFD
FT                   FPVSTISNFYKTALDVGRELESTMSILKKAKIIRNFADMVNISKSGLTYGGYVQMGAKF
FT                   DDFCSLGFELGLDFNVFRSINSKGRLHNLLSFVSAIEPKFYTRLDFFIGAVTFFTGPRV
FT                   NIATAIQDSILAEFGIFGWDLGARATCAFLTIEGYYCWNIQNNKFSDFKFGVGLEFGVV
FT                   "
FT   gene            576084..577304
FT                   /gene="prs"
FT                   /locus_tag="BRE_549"
FT   CDS_pept        576084..577304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BRE_549"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_549"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94778"
FT                   /db_xref="GOA:B5RPP4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP4"
FT                   /protein_id="ACH94778.1"
FT                   /translation="MSLLMKKSIGIIACPGGRVFAEKIMAELNTIFLDAENKVIEQISQ
FT                   TSNCSKEDVLKFEGILSSFLEGLEFSNLRFDETMEIPVNFIKFANGEFKSEILKTIRNK
FT                   DIFIVQDVSNIYPVTVNNNEEVVMTVNDHLMNLMTTVDACMQAKANSVSVIVPSYPYSR
FT                   QDKKHSREGLTASLFGRFLEELRVKHILTLDIHSKAIENVFRKSYFENLNASYEIFDAL
FT                   AELIDIRDSNLVVVSPDTGAVNRNKFFASNLKRPLALLYKERDYSKVTHNVTDSNISVT
FT                   KLLGDVEGKNVFMSDDILATGGTFIKAVKLLKSMGAKKIICAVSLPFFNGDAIRYFDKA
FT                   YEEGYFYKIIGTNAVYHDDKLLSKPWYYEANVAHLFAGAIFAIHNRVSLQRILDRSHDI
FT                   QNLISKS"
FT   gene            577309..578673
FT                   /gene="xylB"
FT                   /locus_tag="BRE_550"
FT   CDS_pept        577309..578673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="BRE_550"
FT                   /product="xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_550"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94779"
FT                   /db_xref="GOA:B5RPP5"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP5"
FT                   /protein_id="ACH94779.1"
FT                   /translation="MNVLSIDVGTSTLKSALINSHYGILGCLDINYFDYFNVNFENFDY
FT                   KIWIFALKKIMSHFMYRKIDCISISGISPCLIALDSNLIPLEVLHWNSSKVVKNYKGKS
FT                   TFLPFVLSTFERGIYDKVRYFVSCFEYLIYLLTGNLVTSYPSLSYIPFIWNNIELKEYN
FT                   LDTSKFPPFLRMGEIVGQVTKRASIEFGINSGINVINAGIDYLSVLIGSGAFFSGIVSN
FT                   RMGTSEGFNFVSDTYLLDFSLIYPYFLDNLFIIGRIVPSGYLLQLLKDRLFQKEKSFGE
FT                   FLEKISAIYTPSNIYFYLNKKELFCDYILIDPQIKNNLNEGIVGKLDDPLQIGIAILES
FT                   SYFSFYNRMLNLKSCKRDILDIFVSGTNSDNLFLNKLKANIIGKDLKIFEFKHSEIAGN
FT                   AILAFCCLKEFDNLEDAFKKLVKIKRIVSFNANMHDIYLEKYHNYVSNFNLFVNS"
FT   gene            complement(578656..579360)
FT                   /locus_tag="BRE_551"
FT   CDS_pept        complement(578656..579360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_551"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_551"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94780"
FT                   /db_xref="GOA:B5RPP6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP6"
FT                   /protein_id="ACH94780.1"
FT                   /translation="MRDFNNNNNKGFLVALTSIVTVCAIIFLGIIIFFPNKNLASDIAG
FT                   KNIILQETKNEKSTENENNQDTLSITDKPNEIIIDLTKTNKEDTNFNNNMDKNNKEIIH
FT                   KKEAQIVKPNIPKKTQTQAKTLKPKKINAKASQEIKKKQNYNKLESKYDPQKEYYIQFA
FT                   SLSDPITADNNIQELMKYKINAKIYSATINDKDTYRVRSGPYKTISEAKIDLQKISNSN
FT                   EFKDAYILTINK"
FT   gene            complement(579360..579956)
FT                   /gene="coaE"
FT                   /locus_tag="BRE_552"
FT   CDS_pept        complement(579360..579956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BRE_552"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_552"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94781"
FT                   /db_xref="GOA:B5RPP7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP7"
FT                   /protein_id="ACH94781.1"
FT                   /translation="MGRHSSIIGITGRISTGKDTVSKIISNEYDFYEINADKIGHIILE
FT                   EKKNTIIKTFGNKILNNINEIDRIKLRNIVFYDKEKLQILEKITHPIIHQKIEQIILTN
FT                   KSNKIIINAALLFKLDLAKFCKHIFIIKANDEIIKNRLKLNRNIDDKLIINILKWQKDI
FT                   FFNKNIINSKIINIINNKSYEYLKRKIRAKMREVT"
FT   gene            complement(579935..582703)
FT                   /gene="polA"
FT                   /locus_tag="BRE_553"
FT   CDS_pept        complement(579935..582703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BRE_553"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_553"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94782"
FT                   /db_xref="GOA:B5RPP8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP8"
FT                   /protein_id="ACH94782.1"
FT                   /translation="MKEIYLIDALNIIFRNYHVMKNNPLTNSKGENVSAFIGFFKTLFF
FT                   IIKEKKPENLIVTFDSETQTFRQKQYPSYKATRDAPPDNLIPQIHWIKEGLIKANIPMF
FT                   ELQGYEADDLIASFTKKAEQNNYLTYIISPDKDLLQLISNQTKIFKIENSSFLEMNNDY
FT                   VIKKFGINKSQIKDYLSIVGDPSDNIPGIKGIGQKGAAKLLNEFHTLNGIYENLSLINN
FT                   KYREILLREKENAFLSYKLISLVEDLELPSLETFRLENLKEDIILLFEEYSATTLIKSY
FT                   KSLLKKKNIINTMQKSIFDINKTKANKENTKDLQSTTLYANTLKTIQEENVKYKTILKK
FT                   EELDLLIEQLKKASYIAIDTETTSINVYESNIIGISVSFKEFESYYIPIETKEKNSIGK
FT                   DYIIQKFNELFNSQPKLIGQNYKFDYKVLKRHGFNVISAYFDTMIAAYVIDPNTKVSLD
FT                   FLAAKYLMHKNIKYEEIVPQHSTLKDIPLEIASNYAAEDADITFRLFNILRKKLKEDNL
FT                   ESLMKNIEMPFSNVIIEIEENGIYLDSNYLTQYGHELEQELKTIENEVIQSIGIEFNLN
FT                   SSKQLHTILFEKLNIIVSKNVKQDSTDIKVLETIKDQHESIEKLINYRQLAKLKNTYTD
FT                   NLIEFINEKTNKIHTNFMQTKTATGRISSTAPNLQNIPIKNERGRKIRAAFKPTKGNIF
FT                   ISADYSQIELVILAHLSEDESLIEAFTHKKDIHIQTASKLFKVDEANITPSMRRIAKSI
FT                   NFGIIYRMSAFRLSQELSIKRDEAQNFIDSYFNLYSKIKTFIQNQIDFVKQNGYSETLL
FT                   KRRRYIREINSQNYLERTGAERMAINSIIQGSASDIMKIAMIKVYNEFKNNNLKSKILL
FT                   QVHDEMLIESPEEECEKAQIIIKEMMENAYPLKIPLKTNIETGKSWGDIHQ"
FT   gene            complement(582700..583104)
FT                   /locus_tag="BRE_554"
FT   CDS_pept        complement(582700..583104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_554"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_554"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94783"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPP9"
FT                   /protein_id="ACH94783.1"
FT                   /translation="MSVNTNVILKKYLQDLILELKKLKAILEFENTKITQGIIDILEIT
FT                   NPKKDLIVNSINNYYTTINSWLKTQEQIQEEINKLIKYALSLKKMIYTQYENTYKMLKK
FT                   IFAQKKAIPKIQFFKSSFNHKEPILLDVII"
FT   gene            complement(583094..583516)
FT                   /gene="flaJ"
FT                   /locus_tag="BRE_555"
FT   CDS_pept        complement(583094..583516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaJ"
FT                   /locus_tag="BRE_555"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_555"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94784"
FT                   /db_xref="GOA:B5RPQ0"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ0"
FT                   /protein_id="ACH94784.1"
FT                   /translation="MLRKEDIYKKTQVNTSSSISILVMLYEKAIQDLEVAKEFYKNKDP
FT                   NSTTKADEKVYHAQDIIIELMSTLNFEDGGDISNNLFSIYSFLNKTLESVTLEKNIDNI
FT                   QEVLKHLKNLHTAWKALLKKDNNIIIKKKLGINIVG"
FT   gene            complement(583527..583937)
FT                   /gene="cheY-1"
FT                   /locus_tag="BRE_556"
FT   CDS_pept        complement(583527..583937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-1"
FT                   /locus_tag="BRE_556"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_556"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94785"
FT                   /db_xref="GOA:B5RPQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ1"
FT                   /protein_id="ACH94785.1"
FT                   /translation="MLKLDEGVWKLEENKKALIVDDSIFMRKNLIKILKNLGFNEFLEA
FT                   EDGIQAIQEFKKQETLHLITLDITMMGMDGITALEKINALNKNLERKLNILMVTALGKQ
FT                   ELIAKALQLGAKGYITKPFREEQIAEQIKTLN"
FT   gene            584100..586109
FT                   /gene="lig"
FT                   /locus_tag="BRE_557"
FT   CDS_pept        584100..586109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="BRE_557"
FT                   /product="DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_557"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94786"
FT                   /db_xref="GOA:B5RPQ2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPQ2"
FT                   /protein_id="ACH94786.1"
FT                   /translation="MGKDIKDEILSLRDAIKKWDREYYVDSSPTVGDVTYDKALLRLQY
FT                   LENRYPEYKTLDSPTLKFGSDLLNDFKEIEHSYPILSLDKAYDVKELLLWVEKMSLEGS
FT                   NLGFDMGISAEPKIDGCSIVLYYKDGILEKALTRGDGRFGNNVIENVRTIKNVPLCIGE
FT                   RVELVLRGEIYITKKDFLKINHTLDDSYINARNLTSGILRRINSREVVNFPLDIFVYDI
FT                   LYSSLKLNTNHDAFDKLKHFGFKLNPFCKFFCGKNLGENIINYVKEIEEQRERFEYEID
FT                   GVVLKVNDFRLRDVLGYTSHHPKWSIAYKFESLRAVSKVIDIVVQVGRSGKITPVANIE
FT                   KVLIAGAFITSASLHNQDYIDSIGLNVKDVVAISRRGDVIPAVELVVEKLSVGNFKIPN
FT                   YCPSCKKSLIKEGAHLFCVNIHCPLKIMGHIKYFCSKKCMNIVGLSEKTIEFLFNMNFI
FT                   SSEIDLYTFDFDRLIGLKGFNFKRVNKLKRSIEESKNRPFKKLLLAMGIKDLGINTILL
FT                   LINNNLNSFDAISLLCQDNKNALVKLLDIKGIGERIAFNIIRAFNDKIILDKFNFFKKL
FT                   GFKMQEDSMNCVIDSSFLFGKKFCITGSFDEYSRHVLIDKITKKGAIFHSAVSRYLDFL
FT                   LVGKSPGLKLKKANNLGIKILSLFDIKNLVNLDD"
FT   gene            complement(586112..588400)
FT                   /locus_tag="BRE_558"
FT   CDS_pept        complement(586112..588400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_558"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_558"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94787"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ3"
FT                   /protein_id="ACH94787.1"
FT                   /translation="MMFMGKYKKIVSMIHKIFMLISCTLLFGEQKQYITKDYMFNYSTI
FT                   YIPKEDLNEDFNNQNNEEKTIYFKQNKVSKENDIHTFKKQLNKLSFKDSSQIQIANNRQ
FT                   IRNNIFTKDSDFEQNNMDDDWFIQNIDNLKFRIKNYEKKITNIENLLNDTNIESIKRKN
FT                   EEYAMLIKSLKEKIERIKYLINTKENLLNDPYQDSYQAKNNDYNDYNEQRYEDNQKEYI
FT                   PNESYNYPPTENTYDTYIQEKEYSNSENTILNKLDSKINNNKDSLNNHTQILGNLDNKI
FT                   NNNKDSLNNHTQILGNLDSKINNNKDSLNNHTQILGNLDSKINNNKDSLNNHTQILGNL
FT                   DSKINNNKDSLNNHTQILGNLDSKINNNKDSLNNHIQLLGDLDSKINNNKDSLNNHTQI
FT                   LGDLDSKINNNKDSLNNHTQILGDLDSKINNNKDSLNNHTQLLGDLDSKINNNKDSLNN
FT                   PTQILGDLDSKINNNKDSLNNHTQILGDLDNKINNNKDSLNNHTQILGDLDSKINNNKD
FT                   SINNNIHKLGELDSKINNNGEILLAFHQELTKFKNDHDNSFKNIENNLLSIEKIINSLK
FT                   NKIEKNEELYKENKNIIQQKQDQINILDKRLTNNENDILKLKEGLTKYVKKDSTKHKNR
FT                   KSQQITQGSYPQDIQTTNKNAIIKNAEFKIYPDTHLNNYNFKVQSNEFDFKKSNGYYIE
FT                   IEPTKNLHRAKEIYKLIPKYNVKTHFINPSLKHKEKFFRNLIKVEYTNDINTLYKNLAS
FT                   EFRNVRIIK"
FT   gene            588685..590553
FT                   /locus_tag="BRE_559"
FT   CDS_pept        588685..590553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_559"
FT                   /product="uncharacterized conserved protein"
FT                   /note="amidation motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_559"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94788"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ4"
FT                   /protein_id="ACH94788.1"
FT                   /translation="MKLENMDEVWALPVCCNIKNSIIEDFKVSDEYKNQVFNISYKDNI
FT                   ILKFIDIIDSHEFNLKLFDNHIDFEGQVPLVLYSDNLDTLLEAESNVIFELRPIEQNDI
FT                   CCSLNLQESDEFKIYTSHYEFSDHLNYCSDFILVKVFFSDDNLIIDADLDNIALVKQII
FT                   SDNFCISKDKIIINSINNNCINILFPIVFNAVVQGIVISKKLGLKVNVIYYKRHFLIAE
FT                   SLNLKFSVVNYLSIENRLNKIMLELKINRPLNFLYKFYFNYLNKIFSNLFFDVLVHINL
FT                   ISINSNSIFFCDNYFLFGISAYSFIYSNFYNLAVSLSLEPLNYLLGYVKSEYNIFFKLF
FT                   KEMDLKNSIMRKSSSISLNNEYNVLDVKRKGVGFAFLNLDSNIDFALLDIGNLTISMNL
FT                   YKDKLDVFIPYKIIDINLVNYLKNVLAKAFNLSYNCVNFLVADSFKDDIEFSCSLLKES
FT                   YFIESAVLTMKEELSVVIDDEGRKEYPIIVSRNFVVDIDAKFYVACSLEVDVIIHSFHI
FT                   IFSNVNFFIENGKFDKLRVNSKRVFSIFGLAVDYVFGNITYDVIDSVGLEFIEDGEFIF
FT                   SFRVLFIASVSAIRSSLIQAFDFDICKTPIDLKSILDDWSVRIDTN"
FT   gene            590540..591001
FT                   /locus_tag="BRE_560"
FT   CDS_pept        590540..591001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_560"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94789"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ5"
FT                   /protein_id="ACH94789.1"
FT                   /translation="MILISFNLNGENLSKSIGLSLSTKELLISVFYSGERNLIERMNKR
FT                   FSLVLLDLRPVYSFLVPAFMLNGRSIITVEGLENTTFYNTLTKVLLESDFGFCDSCFSS
FT                   NVLLFYYLLKCKVIIRTDILGYYSTLKCHCLDVNTFLDLYLRLEELEKK"
FT   gene            590998..591858
FT                   /locus_tag="BRE_561"
FT   CDS_pept        590998..591858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_561"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_561"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94790"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ6"
FT                   /protein_id="ACH94790.1"
FT                   /translation="MSSVKVYYPENFNALVSLFQESSKNYIIYNEIDFHKNSEIFMKND
FT                   SDSFFIINNFEKFNKIFLRSNFLEIGPCVTYDAILQFGEKNIPRLFYEFISMLNDRIYL
FT                   NSINIANGFYYKNTIFDLYPLLLSLDAQIEFKNILTKKNYTYNAYSINRDDYIQNRHVL
FT                   FLSKLKFPITNLWNKSFCSRIFDYTFSFNFLDEMNIIFICVLLNVKRNIISDFLMKIFY
FT                   NDKVITLRDFQVLLLNKTLPLSLVEIEDSLRMLDKSIRDVKNFSLEERSLKLIKNFYFD
FT                   ILFNF"
FT   gene            592018..592278
FT                   /gene="ptsH-2"
FT                   /locus_tag="BRE_562"
FT   CDS_pept        592018..592278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH-2"
FT                   /locus_tag="BRE_562"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_562"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94791"
FT                   /db_xref="GOA:B5RPQ7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ7"
FT                   /protein_id="ACH94791.1"
FT                   /translation="MVKKEATIKAVNGLHVRPASTFVKKAKEYASDITIEADRKSVSGK
FT                   SLFRLQTLELSYGKKLMVCAEGDDEERAVNELVELIESFKE"
FT   gene            592279..594015
FT                   /gene="ptsI"
FT                   /locus_tag="BRE_563"
FT   CDS_pept        592279..594015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="BRE_563"
FT                   /product="phosphoenolpyruvate-protein phosphatase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_563"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94792"
FT                   /db_xref="GOA:B5RPQ8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ8"
FT                   /protein_id="ACH94792.1"
FT                   /translation="MWKVNMTLSGKRISKGIGIGEALFIKKDFDKLIDKSKITSSQVDG
FT                   EIKKFNDAKLKAISVLRDLTRKVVSQLGADKEGIFEGQMLIIEDDELSESVINFIKNEN
FT                   CGAAYAVYLSFKELIASVEEYADVYLKERASDFKDIRNRLIANILDKVVDLAEVKRDVV
FT                   LITEELTPSDTMQVDLSYVKGFITTVGGETSHAAILARTMGLPALVMSPLDIDKIKEGE
FT                   QLIIDGLSSIIISSPSSSELDKYSHKILKYNEHEKELFELKNQDAVTKDGIKIFLKANI
FT                   GTPTDIFYVNKYGLDGIGLFRTEFLYMESLKPPTEDEQFEAYKKVVENIEKKGVVTIRT
FT                   LDIGGDKEIPYFNFPKEENPFLGYRALRMYMDYESLIQSQFNAIFRASHYGKIRIMVPM
FT                   LARYEELEIINYFVDKAKENLKSRNLPFDENLEVGCMIEVPSAALLASELADKLDFFSI
FT                   GTNDLTQYTLAVDRGNQKISNLYDKYNPAVLKLIKNVFDAGHSAGIDVSVCGELGGDEA
FT                   GALILIGLGFKSLSMVPSASLRIKYLLRKYTMSDLNELAIKVLNSKSESETLKFLDKYI
FT                   GD"
FT   gene            594019..594588
FT                   /gene="crr"
FT                   /locus_tag="BRE_564"
FT   CDS_pept        594019..594588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crr"
FT                   /locus_tag="BRE_564"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_564"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94793"
FT                   /db_xref="GOA:B5RPQ9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPQ9"
FT                   /protein_id="ACH94793.1"
FT                   /translation="MGFLGFFKKVATLDLIAPVSGKVVSIDKVPDEAFAEKIVGDGIAI
FT                   MPTGNELVAPCDGNIGKIFKTNHAFSLETKEGIEIFVHFGINTLNLNGKGFTRVAEEGM
FT                   SVKQGDVIIRLDLEYLKAHAESIVTPVVIANSDEVSSIEYVFGKLDDDSEYVVSSTTTL
FT                   TEDIETKILQASPVEAGKDIVLRVKK"
FT   gene            complement(594625..596472)
FT                   /gene="htpG"
FT                   /locus_tag="BRE_565"
FT   CDS_pept        complement(594625..596472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="BRE_565"
FT                   /product="heat shock protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_565"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94794"
FT                   /db_xref="GOA:B5RPR0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR0"
FT                   /protein_id="ACH94794.1"
FT                   /translation="MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKFL
FT                   NITDEKFKDIKLDPRIDINFDEKSITIKDNGIGMNREDLISHLGTIAKSGTKEFMNNLK
FT                   KDEKKASSLIGQFGVGFYSAFIVANKVEVITKKALDNIAYIWSSDGKTGYEINETNKDE
FT                   NGTEIILHLNKEGTEYANKWKIQEIIKKYSNHISYPIFIKYREPIMKDGKQEGFEEKED
FT                   KLNDTTAIWTKNKNEISNEEYNEFYKNLAFDYENPLIHIHTKAEGSIEYTNLFYVPSKA
FT                   SYDLYYPNTKPGVKLFINRIFISDSADSLLPNYLRFIKGIIDCQDLPLNVSREILQQNK
FT                   TLAKIKASSVKKILSELEKLSENDPTKFNEFSKEFGRCLKEGVYSDFDNRNKLISLIRF
FT                   KSSNVNGFVSLKEYKDRMPAEQKSIYYITGGKENILKINPIVNAYKDRGYETLIMDDEI
FT                   DEAILNFITEYEGIKLKAINKNETSDELKDQNFKKIEEEFQDILSKIKEILKDHVKDVS
FT                   LSATLVQEPSAIIIDSTDPTYQMQKIMLSMGQEVKETKPILELNPNNKIIQNLKNLDDT
FT                   TLEKISIILLEEAIITSGLPSKNPNQFINIINEILEKNI"
FT   gene            596587..597981
FT                   /gene="gnd"
FT                   /locus_tag="BRE_566"
FT   CDS_pept        596587..597981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="BRE_566"
FT                   /product="phosphogluconate dehydrogenase, decarboxylating
FT                   (gnd)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_566"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94795"
FT                   /db_xref="GOA:B5RPR1"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR1"
FT                   /protein_id="ACH94795.1"
FT                   /translation="MDIGIYGLGVMGSNLALNIADNGFNVYVYNRDNEKTEVFLANNSH
FT                   KKISGVSDIETFIRSLKKPRKIILMVSNSAVDEVIEQILPFVEKFDIIIDGGNSYYKDT
FT                   IRREQELSSRDIYFVGLGISGGERGARFGASFMYGGNKKAYELIEPILNKIAAKTNEGD
FT                   VCSAYLGKDGVGHYVKMVHNGIEYADMQLIGEAYFFMKRAFNLDNLRIAEVFDKWSEGE
FT                   LSSYLIEITSKILKYKENNEYLIDKILDVANQKGTGKWVSIEALHLNVPANLIFESMFA
FT                   RFLSILKHERVIASDILKMDVDFVEFDLSDWILDLYYSLLVAKILAYSQGFMILKNASA
FT                   NYLWDLNLGKISLIWREGCIIKSVFLDKIKLAYDKNPHLINLLFDDYFLDIIKNHHKSL
FT                   RRIVSKASEIGIPLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFERIDSNRGEF
FT                   FHSSWE"
FT   gene            complement(597996..598532)
FT                   /locus_tag="BRE_567"
FT   CDS_pept        complement(597996..598532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_567"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_567"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94796"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR2"
FT                   /protein_id="ACH94796.1"
FT                   /translation="MQKIMIIILTSSMWINSFGKSSYLDRKIGFGGSIGNPIFNYIMSF
FT                   PFIDIEIGYGGTNGIKLPQSILKSKKYDFNVFVLSAIDLIFTISLIEKLSIGTGIGGNI
FT                   HISSNKSNFKSMEAGFGFRIPIAIFYDITENIEIGFKMAPSIEFVSNPQSIAYHYLYSG
FT                   FKINIIGGMFIKYYI"
FT   gene            complement(598656..599174)
FT                   /locus_tag="BRE_568"
FT   CDS_pept        complement(598656..599174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_568"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_568"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94797"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR3"
FT                   /protein_id="ACH94797.1"
FT                   /translation="MKKTIFIFILINYFNSTAKDEYTKNKGYFGIGILGPFPNAIQLNL
FT                   AKNIEIEFGIYNGLKNLFQNFNTLFASIEFNIFSSNSFNKPKPINTSLGIGIYGLWWIS
FT                   KWQKTHEIYNSTNIGIKISLSLILPILKRHFDLFLKVGPGIKIWGIGHDYPKHKWEVFA
FT                   GLGIKLWVA"
FT   gene            complement(599389..599898)
FT                   /locus_tag="BRE_569"
FT   CDS_pept        complement(599389..599898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_569"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_569"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94798"
FT                   /db_xref="InterPro:IPR016489"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR4"
FT                   /protein_id="ACH94798.1"
FT                   /translation="MKQKNIFILILLLLSTSAFANSTARSNFGIGILLPFPIALELNIE
FT                   NFDIDLGIYNGANNLFQNWQTLFLAIDYIFYMHTFKELNQMLNFSIGGGGYGTIWFARW
FT                   NHTHTNSGPISIGARLPLILNLAIFIKKFDVFLKVAPGLGINIWNGGAGFRWEIFAALG
FT                   IRYWFT"
FT   gene            600237..600770
FT                   /gene="cheW-2"
FT                   /locus_tag="BRE_570"
FT   CDS_pept        600237..600770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-2"
FT                   /locus_tag="BRE_570"
FT                   /product="purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_570"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94799"
FT                   /db_xref="GOA:B5RPR5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR5"
FT                   /protein_id="ACH94799.1"
FT                   /translation="MELEVDMQDTLNQYLLFSLDELYAIEIKYVVEVLEYTKISKIPRT
FT                   PDYMAGIINNRGKIVPIIDIRKQFGMEERKVSDDEVKKKEINTSNIIILTLIYEGDELN
FT                   LGILVDHVKEVLELSSSDIDDAPRIGAGFNSKFISGIGKCNDKFVVILDVKNLFNIKEL
FT                   ARFKNTTINDPDDE"
FT   gene            600776..601096
FT                   /locus_tag="BRE_571"
FT   CDS_pept        600776..601096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_571"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_571"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94800"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR6"
FT                   /protein_id="ACH94800.1"
FT                   /translation="MSFMIYKPEGELIVNNIFKVKEDLLNILKNMKEKETLVINLANVE
FT                   KIDITFIQILYASNKYAKDRNLFIKIEYPSDEVLSLLIYGGFLIDIEDIDNLDLGLSLI
FT                   EF"
FT   gene            601120..603261
FT                   /gene="cheA-1"
FT                   /locus_tag="BRE_572"
FT   CDS_pept        601120..603261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA-1"
FT                   /locus_tag="BRE_572"
FT                   /product="chemotaxis histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_572"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94801"
FT                   /db_xref="GOA:B5RPR7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR7"
FT                   /protein_id="ACH94801.1"
FT                   /translation="MNSSDMIDKFKDSFKEESIENISDIEHALLNIEFESGKEVINSIF
FT                   RNFHTIKGSAGMFGFNFTASLVHEIETILDPIKMGVEEFNQSTVDATLMAVDFVRELIE
FT                   GDEAIDEIVYKTREKSLIDAIKKELGIDIGVVKDIVLATNSKVQNSSINLDSQEAELNL
FT                   SLNQNKYEDEALKVETKVYRVLFIPSRGILFHGHKPINFLKKLLNLGNGQVKARVKNIP
FT                   DLELISPDNVYVEWELKLETEESKSTIEDVFTFVDGQSKFVIEEVDASYEITDDSFLLN
FT                   NVTQNVNEMFPEKEQNLLHSKELYNNKMSFKSGEHNVNDDTVKSKVNIASIKVDSKKLD
FT                   HLVNLVGELVTIHSKLAKEAEISNNNVLNSISAEFSLLINELRDYTTGLRTVPIEILFV
FT                   KFQRIVKDLSVQLGKSIHYYSQGGDTVLDKSIIERLNEPLVHLIRNSIDHGIEPDEERI
FT                   KAGKKAHGIIKLSAQQSGDSVIVVIEDDGRGLDKHKIIKRAIEKNIISEAISSTLSDVD
FT                   IYNLIFEPGFSTADVVTNISGRGVGMDVVKKQVESLRGNVVIESEFGKYTRIKLIFPLT
FT                   LAIIEGWFVRVYDQYFIVPLSSVESCLEADKLDSRVYGLESGGNVMDYRGSMISFIRLR
FT                   EFFEISNEKSNSEHVVVVNTNSGKIGIVVDEVLGQHQTVIKTLGKVYSKVEGVSGATIL
FT                   GDGSLALVIDVDNITKIIR"
FT   gene            603323..604474
FT                   /gene="cheB-2"
FT                   /locus_tag="BRE_573"
FT   CDS_pept        603323..604474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB-2"
FT                   /locus_tag="BRE_573"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_573"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94802"
FT                   /db_xref="GOA:B5RPR8"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR8"
FT                   /protein_id="ACH94802.1"
FT                   /translation="MKILVIDIQGLIRQVFVRAFSKDVDVEILNPGSNSLNLINVFLQK
FT                   FPDVVIIDENTAKSHFGNSLNNVLNNILLPVVFIAENEVYPKFGFLDSKKDKIKLIINK
FT                   LNFKLTVNLFRSDYLDLIKSEIKKLVDHKFVASFESKRIKSPDFFEKIESKESERDITN
FT                   ITKSYKVADVINVSPKNGPDVILKYQGVINKNKTGKVIFVGASTGGTEALRVFLKLFKK
FT                   DSPPIVIVQHMPGGFTTSFAKSLNNEFEVDIKEAEDGDILRPGLVIIANGHYHLIVKYA
FT                   NGNYFTHLIDGPPVSRHKPSVNVLFRSAAMYAGENAIGVMLTGMGDDGASCMLEMKNNG
FT                   AYNIAQDQLTSVVFGMPMEAIKIGAVDKVLPLNKISECILRRS"
FT   gene            604453..606246
FT                   /locus_tag="BRE_574"
FT   CDS_pept        604453..606246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_574"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_574"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94803"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPR9"
FT                   /protein_id="ACH94803.1"
FT                   /translation="MYFKEILMENNDKFLDIDSYIGNVLTELETFDNRSRQVYASLSKS
FT                   IPRLIEKLSKDIKDLSFNIGFISNLDVDNDYSLNNFISKVIRVLNDFVSYFNSSTEILE
FT                   SQFSIIRDKVKDIEILEDVIEKMKKSSIDMEIMSINTLTVAMRAGRAGGAFSYITNEIK
FT                   TLTQSMIKQADQLTSKGRDIKVGLDRAKEQVLENNTAENKILEEFKEDLIKNIDEFAGS
FT                   IGEVIAFYDNVLKILNEFKFKFVNAVSYLQFQDRLTQSLHHLNVMYSSIDVFKFRDISE
FT                   IQKLKVLSVFTDSSKMIIRDVISKLDENCMAFEEFIDTSISSIQVINDLKSDNSSYVDI
FT                   SKSVEACSIILLNLLRRIDDVEKNNSNFLNLYYEQIKLVKSLELMFSNISAISSRFQNI
FT                   NIASKIEVVKRIELEDMEGNISEMSKIINNIDLNITKGREFLSQIIFFFEKVVKDCDNR
FT                   FYIEKNYFNKFKKLFIEIKSNIFEIKRLAIDHVLSYEMFPVNFLEIFEEVKLDIHSIKA
FT                   LREDLINIEKILIDIENDINSNLNSELLKHDLKCIEVEDKEFIRRIANRFTLFVHKKYL
FT                   LSLIEDEKDVHSFDEGSVILF"
FT   gene            606283..606657
FT                   /gene="cheY-2"
FT                   /locus_tag="BRE_575"
FT   CDS_pept        606283..606657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-2"
FT                   /locus_tag="BRE_575"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_575"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94804"
FT                   /db_xref="GOA:B5RPS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS0"
FT                   /protein_id="ACH94804.1"
FT                   /translation="MQKRILVIDDNRAIRQSVAYILEQNGFAVAEAQDGLEGVSKFKEA
FT                   VGQSDKDFDLVITDINMPNLDGIGVIKEIRELGSFVPILVLTTESEQSKVDEGRKAGAT
FT                   GWLVKPFNPNTLMQTISKIF"
FT   gene            606700..608043
FT                   /locus_tag="BRE_576"
FT   CDS_pept        606700..608043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_576"
FT                   /product="uncharacterized conserved protein"
FT                   /note="putative peptidase , M20/M25/M40 family"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_576"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94805"
FT                   /db_xref="GOA:B5RPS1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS1"
FT                   /protein_id="ACH94805.1"
FT                   /translation="MSFKLDKQFYFHLGELIKFNSVNAPALKSKPFGEQIDLCRDKVLE
FT                   IARDIGFKVYKDPDGYYGFAEMGQGDELIGILTHIDVVDAGSISKWHSNPFELGFRDGR
FT                   VYARGILDDKGPLMAVLYAFKMLLLEKICFKKRFRVIFGTDEETKWRCIEQYKIKEEIP
FT                   DFSFTPDGDFPIVNAEKGLLQFDVISDEKFFMNLELGIGYNVIPDECSFELGDANKDDF
FT                   RILLDNFDGKIRYKFFENNVLIHGISAHASLPELGVNVAPYALDIIKSLGIRSNFIAFF
FT                   EDRIGFTINGEKLFGKVLEDLQSGKLTLCLTKIKLSKTSNQILSFDMRYPISYKREDLV
FT                   SLIKKTLDLYSLNYSEVSFLDPLYVDSNLKFISSLMEVYQNFTGESDVNPISIGGATYS
FT                   RALKNCVAFGPLFKGSDNTAHQVNEYINENELMDLILIYKNAVEKLNT"
FT   gene            complement(608047..608133)
FT                   /locus_tag="BRE_577"
FT   tRNA            complement(608047..608133)
FT                   /locus_tag="BRE_577"
FT                   /product="tRNA-Leu"
FT   gene            complement(608142..608831)
FT                   /gene="smbA"
FT                   /locus_tag="BRE_578"
FT   CDS_pept        complement(608142..608831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="BRE_578"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_578"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94806"
FT                   /db_xref="GOA:B5RPS2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS2"
FT                   /protein_id="ACH94806.1"
FT                   /translation="MIKIISLGGGIINPNHINTTYIKNLKNLIFQWIKKEHNRKVILIT
FT                   GGGKTAREYQDAYKQINPKFKNHELDEIGIMATKLNATLISKAMQPFCINDIVSNPTED
FT                   FQFKGQILVASGWKSGFSTDYITVKFAEKFNSNEIINLTNIDQIYDKDPKKYNDAKGFK
FT                   NITWNKLQNIVGKDWEPGSHLPFDPIATELALKLGIKAYILNGTDLTNLQKVFDKNDDF
FT                   LGTIVVK"
FT   gene            609048..610112
FT                   /gene="lgtD"
FT                   /locus_tag="BRE_579"
FT   CDS_pept        609048..610112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgtD"
FT                   /locus_tag="BRE_579"
FT                   /product="glycosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_579"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94807"
FT                   /db_xref="GOA:B5RPS3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS3"
FT                   /protein_id="ACH94807.1"
FT                   /translation="MYKYKVSVIICFFNAESTLETMLKNAVNQTLRDKEIILVNDGSYD
FT                   QSLKIAQKFAEKYDFIKVINQKNMGISVARNNGFEKSEGEYIVYWDSDDFIENTMLEVL
FT                   YNRAKADNSDIVCSQFYIYFLARKIKRKSVLPFPNYPITGEEAFKNLLLTVFSSFYKKN
FT                   FVVGTVWDKLIRRDLIVSNNVKFNDVILEDIVFMLHAFLKAKKVSFVNNYFYTNFQRMG
FT                   SASSSISVISKVNMSLKVVENLLKEEGLFEKYFEYYKKFYLQLYYYISFKQVYVINWHI
FT                   KDKLVYKAHKAKLIFVLNEVKNSKEFQNYYGSLKNSRFSELQTLPKMMLKIWNLSSVLY
FT                   VNFSIFMYKAFLKN"
FT   gene            610174..610995
FT                   /locus_tag="BRE_580"
FT   CDS_pept        610174..610995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_580"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_580"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94808"
FT                   /db_xref="GOA:B5RPS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS4"
FT                   /protein_id="ACH94808.1"
FT                   /translation="MKIEFRDIAFSYYKTNVYFNVNLSVEKPQNYLVLGKNGVGKTTLL
FT                   RLISGLLNPSEGEILFNSLKTFPRNPLNLVNLFFVPEEFSLPDISLNDYYKSLCKFYPN
FT                   FKEEDFKEYLLRFELDINLKLSSASYGQKKKSIIAFSIATGVPVLIFDEPTNGLDIASK
FT                   NVFRYILSNLRNTMVFITGHNVRDLSDIVEHLIIIGNNNVLFSDSVSHIKNNYKVKIVD
FT                   KLDGEELYYEKVKDRFKSLYYESGTFDNNNFDIEFFFLYVVNDGLKDFSNV"
FT   gene            610988..611869
FT                   /locus_tag="BRE_581"
FT   CDS_pept        610988..611869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_581"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="LEUCINE_ZIPPER motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_581"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94809"
FT                   /db_xref="GOA:B5RPS5"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS5"
FT                   /protein_id="ACH94809.1"
FT                   /translation="MFSLKRFFLLFNIDFVYHKQFYFYFFMSIFLIFPLIHVLFKSYLD
FT                   LNLVELLVVDDSLSNTVFFLILFCMMYCVSIYNMFSDFKSIHDPLKNVFYLSLPVSTLE
FT                   KYLFVLSKFLFLFPLFVVICCYMGVNITVLLDKKLFLGNQAKSLSFNVFFMFVGNTYFI
FT                   YFVGFSMLLLFRIVFKRFSFFKSVVIISLCYAALIVLFDFMMFFVNNYLFELKNNFDKW
FT                   GEYYFIKYISMSFALCSCFYSYFLLRNVGNLSTKKINSNILVGLMSFFVIFVFCFVTFL
FT                   LLYVIYAHILHA"
FT   gene            612097..613752
FT                   /gene="pyrG"
FT                   /locus_tag="BRE_582"
FT   CDS_pept        612097..613752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="BRE_582"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_582"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94810"
FT                   /db_xref="GOA:B5RPS6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS6"
FT                   /protein_id="ACH94810.1"
FT                   /translation="MWAFVLRIEFIWRVLIMDNLKILVITGGVISGIGKGVTSASIARL
FT                   FKDNLKITPIKCDGYLNTDPGTINPVEHGEVFVLDDGGEVDMDFGHYERFLNQNSKSTW
FT                   NITMGKIYKSILENERRGKYLGRTVQLIPHVTNEIKETILNIAREEHSELLVIEIGGTV
FT                   GDMENILFIETMRQIRYDIGIDNIAFVHLTYIPNPAGINEQKSKPTQQSVKTLNKAGIF
FT                   PDLIIARSSQLLTRQIRDKIAMFCNVDASCIVDNIDVATIYEIPISFYKQGLHKILGSK
FT                   LKINVTPKVDGLEKLVNVIKKNLLSPQKVVNIAICGKYTELGDSYASIFESLTHVSANL
FT                   DILVKTTVIDGINFDEKMMEGVDGIVVPGGFGSRGYEGKIRAIKYARENNIPFLGICLG
FT                   MQLAVIEFARNVCGIFDADTEEVLSEDNTMLNSINPVIHLLSEQKELENKGATMRLGGY
FT                   PVLLKKDTLAFKLYGNDMIIERFRHRYEVNNDYLDLFNKYGLVVSGFSEDFQIVKIIEI
FT                   PKNKFFVACQFHPELITRLESPSKLFVGLVKACL"
FT   gene            613815..614420
FT                   /locus_tag="BRE_583"
FT   CDS_pept        613815..614420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_583"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_583"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94811"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS7"
FT                   /protein_id="ACH94811.1"
FT                   /translation="MVRRYKMNESDVKRAISMKRLVKYFFDELKYRMKIPCLRHNNQYM
FT                   SKKYILLNLLRKIANLPFYDQYEIEEQFFLDILGKGVLADAVLIKRLDYEKCVIVGIIE
FT                   AKADHVDLEYELSRFLIQGDKVNVLFWQPKRMLLKQNEELIILDADDIFKLDNDFYLPL
FT                   VKEKLEDFINVFVKFFSYEDILFEYNKIIGKYSFIRSK"
FT   gene            614529..615704
FT                   /gene="mcp-1"
FT                   /locus_tag="BRE_584"
FT   CDS_pept        614529..615704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-1"
FT                   /locus_tag="BRE_584"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_584"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94812"
FT                   /db_xref="GOA:B5RPS8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS8"
FT                   /protein_id="ACH94812.1"
FT                   /translation="MYKFPFFCKKKSSTSDVKDNSFNDVDNIDDISTCENESSLKEIVR
FT                   SFYHTKSSISNVLVNIEFLYKNLFSGFVNVEKVCISLISKVNDGRIKVNAIFEDIEKNN
FT                   KEKLQKVTDIIMDVQKSLETINSFLGATNMISLNAKLEAARAKEYGKGFSVVADEIKRL
FT                   SDQAKGVMNMISVKEIEQVSTDLISENIKKLQLGIDNLFLNMIEELTSLEESFKYCIGQ
FT                   QGEFSTLINELENIEASVSYLSRNCDSLSVSKAFVYSNDDFLKELEFIISEHMSWISVV
FT                   KAIVDNQKSMAIQSDPMKHGFGLFYQGFAPKELEIREVWENIYSDYLNIHKLVVEIIKI
FT                   FSQGNFNNADLKNARDFFMRAENLSNEIISRLESVKNMVVECENQNINVFC"
FT   gene            615828..619262
FT                   /gene="dnaE"
FT                   /locus_tag="BRE_585"
FT   CDS_pept        615828..619262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="BRE_585"
FT                   /product="DNA polymerase III, subunit alpha"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_585"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94813"
FT                   /db_xref="GOA:B5RPS9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPS9"
FT                   /protein_id="ACH94813.1"
FT                   /translation="MNLKAKFVHLHVHSDFSLLDGAAKIVDIVSKAKEYNMSHIALTDH
FT                   GNLFGAIKFYREAKKAGIKPIIGIEAYMSNTLKYIKKNDEFGKPYYHLILLAKNEQGYK
FT                   NLLKLTSVSYLEGFYYRPRMDRDDLAKYSEGLICMSACIGGIIPQLILSNRFDDAKNEI
FT                   LWFKNTFGDDFYLELQRHGIKQQDIVNEKLIAYSKELDVQLSVSNDSHYVNKEDATAQD
FT                   IIVCIGTGAKRSDSGRFKMETDEFYLKSPEEMCELFKDLPEALANTLKIAEKCNDFEIK
FT                   FPGPIFPEYHIPEEFDTQGQYLEHLTLEGLKFRYANITDNIKERAFYELSTIINMGFEA
FT                   YFLIVWDFIKFAHDNDIPVGPGRGSGAGSIVAYALRITDVDPLKYNLLFERFLNPERVS
FT                   MPDFDIDFCFEGRDEVIKYVTKKYGEDKVAQIITFGTLKPKAVFKDVGRVLDIPFVQSN
FT                   EITKLIPDGPKVSLREVLKDKVLKKYLNKGPVYNELMEAALVLEGMNRHASTHAAGIVI
FT                   ARTSLTDYVPLYKDYKQDTVSTQYTMDLLEDCGLVKMDFLGLKTLTLIKNAEKLIKITD
FT                   PDFSIATISDSDAKTFKMLSEGRSTSVFQFESEGMQQILKDSKPDNIEDLIALNALYRP
FT                   GPMQFIPQFVAAKTGAKRIKYPHPDLTEVLKPTYGVIVYQEQVMEVAKIIGGFSLGKAD
FT                   ILRRAMGKKKEDEMNRMKVDFIKGALEKGYDETLASDIFELLKPFAGYGFNKSHAAAYS
FT                   LIAYQTAYLKANYPASFMAANLTNEINNTEKLSYYIEETKSMGINVLRPDINQSFKDFR
FT                   VVGSDISYGLNGIKNIGELMVDLILNERQENGEYKSFEDFIKRVDKKVINKKFLEASIK
FT                   SGLFDSLGQNRRTLIENLDKLIAFVLENKNAKKQGQNSLFASQNILEETFNYNLFEEYS
FT                   YLELLGFEKELLGFYVSGHPLDPYKSELEFFTNFNVVKDLASRRNTVVKFAGSLNFIRV
FT                   VHLKKNNARMAFGIVENFEGSIEIVVFPESYDRYKHLLIEDDVIGVIGKLTFSRDKFSI
FT                   IVEKILTIKEISINKINNLHIKFTNKGLNDSNLLTSLKNKIFDLEDDTGFSYVYLYLKN
FT                   NGRDLKLKMDLILNFKPDEFKINELKDHKIVEDIWFD"
FT   gene            619274..619846
FT                   /locus_tag="BRE_586"
FT   CDS_pept        619274..619846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_586"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_586"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94814"
FT                   /db_xref="GOA:B5RPT0"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT0"
FT                   /protein_id="ACH94814.1"
FT                   /translation="MITETLIVFLNIYRILILIRILLSWLVSSGISSNAFFKFIYNVTE
FT                   PFLSVFRSIRFFRFGIYDFSPIAALITITITERMLSYGNYKLSTFIVLFIMEAWGILRS
FT                   IFFALIFFFVLRVVFLFLHLFNGTDFMKNVDSLLVLLSFKIKNIVTDKHMSYAVSLIVA
FT                   ASLLLAFIIIFEQAIMAINILSFYLPF"
FT   gene            619856..621919
FT                   /gene="recG"
FT                   /locus_tag="BRE_587"
FT   CDS_pept        619856..621919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="BRE_587"
FT                   /product="DNA recombinase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_587"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94815"
FT                   /db_xref="GOA:B5RPT1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT1"
FT                   /protein_id="ACH94815.1"
FT                   /translation="MFLHEFQYGLQGINGLGSRGIDRLNNIRITNVKELIEYYPKKYED
FT                   RKNMAAFPDPLQVRICELMTIFTVIEHRDFGNTFKRNLKIIGRSENSELFEILLFNRSF
FT                   LERIFKIGQKFYIYARFSYNDYTKMWSCSNFDSEIFSYNPVKFKKIMPVYSLSEGLSSK
FT                   KISSYVKGALAYFVKFGQSDIPKFLINKYSLLSLHEALNEIHFPSSLEMLRRAKKTLVY
FT                   REIFLLQFFSRGKSYRVFLRAEKNLSNDLLKQIISKLSFELTRDQKIAITEIINDLKNN
FT                   KPMNRLLQGDVGSGKTLVAFLSSIPLIEAGYQVAFMVPTDLLARQHYNSLTNILKDFDI
FT                   SVVLLTGSLKKKDRDEVLEKIQSGICSLVIGTHAIFSQGTKFKNLAYVIIDEQHKFGVE
FT                   QREELRNKGEEVDVLLMSATPIPRSLALTLFGDLEVSLIKRGPEGRLPVTTYLAKHGNE
FT                   EKVYEFLKNELGKGHQVYFVYPLISSSEKFNLKDATSMCLNLQNIFVEYSVAMIHSKLE
FT                   SYVKEEIMHNFYLKKIDILVATSVIEVGIDCPNATCMVVEHAERFGLSTLHQIRGRVGR
FT                   SNLKSFFFLLYKEPLTEAGKFRLKTIKENTDGFKIAEEDLKLRGPGNLFGLEQSGYFNL
FT                   RISDFVEHKEIIGLMRAELDIFCSNRDFYDKSDVKLLDSLLVSYLSSVSKGS"
FT   gene            complement(621906..622763)
FT                   /locus_tag="BRE_588"
FT   CDS_pept        complement(621906..622763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_588"
FT                   /product="carboxypeptidase, putative"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_588"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94816"
FT                   /db_xref="GOA:B5RPT2"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT2"
FT                   /protein_id="ACH94816.1"
FT                   /translation="MLNWIMQYNYILMISFNIFSLIFLVSNLINNPSLEANTISKQDFQ
FT                   TLLNIIKTLDQVHQKQIKEQPISFIQELKPLLEAEENNLLILVNKKIPIPKGYNPTDLV
FT                   YLKNFKELKNIGKENLKLRKILINDLIDLINAGKKNGLQIKIISAYRTKEYQNFLFKYN
FT                   VKTYGIKSAQIQSAISNHSQHQLGTTIDFINTDDNLLNTKEGKWLYENSSKYGFSLSYP
FT                   KKHEKETGYKAEPWHYMYIGKQACALQKKYFNNLQYKFLEFWNNNKKELLKLIQKYKIN
FT                   INYP"
FT   gene            623204..624547
FT                   /locus_tag="BRE_589"
FT   CDS_pept        623204..624547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_589"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_589"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94817"
FT                   /db_xref="GOA:B5RPT3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT3"
FT                   /protein_id="ACH94817.1"
FT                   /translation="MHSLIKSKKSSVYRDVFNIAIPTVIEFFLFNIVAFTDNIMVFYLG
FT                   DYPVVGVSLANKLFELFSTIAFAIMGAYNILATRQYSQGDIDSFKNTFFISIAILLFFP
FT                   FLFILVSLFYSYFLLGLLSDDLIAVSYGVSYLNIAVYSFIFAVVKGIIANSLKVVKVTK
FT                   IQIVTSIISVIVNIVFNYMFIFVLNMGVIGAAIATTLVRLLELIFYLFYTVFNVNSHFY
FT                   LKFENLKINPVIFSELIKVFVPIFLNDFIWYIGYFVLSAIFSRIDTAKYAAYSITFSTY
FT                   FIGFNIVHAFCFAVNIVMGHEMNNDKDEIMSVAIYLGKIGLALAALTSIIMFTLSFIAP
FT                   YVFYKLEYASLTGVMLRYYSISVFFTSLAFQYLFGFFRAGASPNFGAVMEGAVTLIYTI
FT                   PIAYFLANYTQTPFELVVFIPTLEDVIKFGISLPYFYSTKWIKSIRTG"
FT   gene            624572..625927
FT                   /gene="murD"
FT                   /locus_tag="BRE_590"
FT   CDS_pept        624572..625927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="BRE_590"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_590"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94818"
FT                   /db_xref="GOA:B5RPT4"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT4"
FT                   /protein_id="ACH94818.1"
FT                   /translation="MCLNEIKGKNFLIMGLGLHGGGLAVAKFLLKHGGNLVITDLRNEI
FT                   ELSPSINYLKQFKNKIRYVLGYHNEDDFKRADVVIKNPGVSFDNQYLKLAKRIESEISL
FT                   FLMFNRNPIIAITGTKGKSTLASLLYRVLVASYPNVKLGGNIGISPLNFLDELDGISPI
FT                   ILELSSWQLHDIKSLSPMISIITNVYCDHQNYYSNFDDYIEDKAKIFINQNSGILIVQD
FT                   QAYYNYFSRFKHNLKIVLFSEIMPVDFKEDIFYFKDGKVYLNDGEIGVLNESKIVLLIS
FT                   KMITVFVANYLHLNLNISSEIVSIFDGIEHRLEFVKEFNGVKYYNDTASTIPDSTVFSI
FT                   KSLKVHGESIHLITGGTDKELNFKIFDDILSFVKTWILLQGSATLKIIEFLKSRNVNYF
FT                   IFSSLKECVCYAKEVAMTNDIVLFSPASASFELFHNEFDRGICFKNLVNSMT"
FT   gene            complement(625924..626973)
FT                   /gene="femA"
FT                   /locus_tag="BRE_591"
FT   CDS_pept        complement(625924..626973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="femA"
FT                   /locus_tag="BRE_591"
FT                   /product="FemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_591"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94819"
FT                   /db_xref="GOA:B5RPT5"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT5"
FT                   /protein_id="ACH94819.1"
FT                   /translation="MDTQKIEIENLNENYLQSKLWAVVKQNFSKQSAWKAIALNNNQFN
FT                   KILVMQRRLFGNFYLSYVAHPEFSNKRIEDINIDKINNQIKKFSENIRQYLHKNTIFVR
FT                   YDLMFYTSRSSKDKYIPLKIKFKNLKKSFDDIQPSNTTILNLNDSIDNIKAKMKKKTRY
FT                   NINLSNKKNIKVIIDDDFKYFDEFYELYKETAQRDKFAIHSKDYIKHLIKAFKEDKHST
FT                   IKLIIALHNEKLISGIIVGIYKDKATYLYGASSNTNRHLMPNYAVQFETIQMLKKLSIT
FT                   EYDFLGIPPTADTKHPLFGLFQFKTGFGGTIIHRIGCYDFVYKKFLYNIYNIVEILRYI
FT                   YYKVIKKRI"
FT   gene            complement(626995..629175)
FT                   /gene="metG"
FT                   /locus_tag="BRE_592"
FT   CDS_pept        complement(626995..629175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BRE_592"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_592"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94820"
FT                   /db_xref="GOA:B5RPT6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPT6"
FT                   /protein_id="ACH94820.1"
FT                   /translation="MQKKNLITAALPYVNNIPHLGNLVQVLSADAFARYSRMMGIETLY
FT                   VCGTDEYGTATETKALIEKTTPEELCNKYHAIHKSIYEWFNIKFDIFGRTTNKYHKETV
FT                   QDLFLKLDKNGYITEKENEQFFCQQDQMFLADRYVTGECPNCGNNTKGDQCENCSNLLV
FT                   TNELLNPRCIICKNIPIIKKTKHLYIDLPKIKNELEHWIQQIDQNTNWNINAIKITNAF
FT                   LRDGLKERTITRDLKWGIPVPKKEYENKVFYVWFDAPIGYISITKEIIKDWESWWKNNE
FT                   DTNLIQFIGKDNILFHTIMFPSIELGSQENWTMLNKLASSEYLNYENLKFSKSAGTGIF
FT                   GNDVITTEIPSDVWRFYIYYNRPEKADFQFMWDDFMERINSELIGNFSNLINRVLTFYK
FT                   KFFGDKIDKIELNENFWQIVNIKYERTINFFKQIELKAALKEILDISRIGNKIFQDKEP
FT                   WKTKNSTPQTTKELLLNLIYLIRDLSILISPFMPHTSDRIRSFFGKSYEISNKFLGTNL
FT                   GLTTIQSTEVLFTKLEKQLIDSLKLKYSGRTNMQDEKNKNSINLFSEQICLKTVKIKTI
FT                   DRNPDAEKLFILKLDDGTPEGKQIVSSIADHYTEEELIGKHIIIVDNLKPAKFRGIRSE
FT                   GMLIATKDENKNFKIIIVEDFKDNPIPGERVILESDTGKELKSPTKISIDKFLQAQIVA
FT                   ENGELKINGINLILEHSKEKVLSKEIPNGKIY"
FT   gene            629287..630357
FT                   /gene="pta"
FT                   /locus_tag="BRE_593"
FT   CDS_pept        629287..630357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="BRE_593"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_593"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94821"
FT                   /db_xref="GOA:B5RPT7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT7"
FT                   /protein_id="ACH94821.1"
FT                   /translation="MLEGLVEYMGFFNFKDYVYARARKNVIDHGDKASIVFPESTDIRI
FT                   LKATINILREGLAGFVVLIGVRDTILGKLRELMGFGDDILDMIKIINPSSFKDFNRYLD
FT                   EYLSLFHDKKLDVSKAKEELLDDIVFSMMMVRLGDVKTCVCGALASSAKVLKSVFKILP
FT                   RFRETKFVSSFMIVDTRNVFAQSETCFGYEGILMFADCAVIINPDSIQLAEIAMHSANS
FT                   FRNIFDQEPKVALLSFSTKGSADSLEVRKVRDALDIVRSKCSDLLIDGELQVDAALVKS
FT                   IAEKKCSDSLVAGIANILIFPNLESGNIGYKLVERLAFARAYGPFLQGLKNPVSDLSRG
FT                   CSVNDIVLTSALMICS"
FT   gene            complement(630340..631164)
FT                   /gene="ksgA"
FT                   /locus_tag="BRE_594"
FT   CDS_pept        complement(630340..631164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BRE_594"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_594"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94822"
FT                   /db_xref="GOA:B5RPT8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT8"
FT                   /protein_id="ACH94822.1"
FT                   /translation="MNINYNSINSIKNVLKNKNIAPRKIWGQNYLINENIRAKIIDALD
FT                   IKKNEKIWEIGPGLGAMTATLLNKANFLTAFEIDPKYSEILNEKFGQLKNFKLIEGDFL
FT                   KTYKQEKKSINKIVSNLPYNIASKVISTLIEDEILIHMVFTVQKELADRMIAREGNKNY
FT                   SSFTILVQSHFNVIKIMDIDKKNFYPIPKVKSTTIKLIPCKENIKNFQIFNKLIRTVFT
FT                   SRRKKLKNTIINFIKNENILKKDFLKNFLDKRPEEISVKEFITIANKLTTYH"
FT   gene            complement(631199..632596)
FT                   /locus_tag="BRE_595"
FT   CDS_pept        complement(631199..632596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_595"
FT                   /product="competence locus E, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_595"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94823"
FT                   /db_xref="GOA:B5RPT9"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPT9"
FT                   /protein_id="ACH94823.1"
FT                   /translation="MINYRYINTRLSNFIILNTKMISHINDLIYLKHTFKKRFLVIFLF
FT                   IISALSLSIRYYLKLNLIYLNIILILIFIIKKNAHLSLTFIINTSLLIIFEISLIFNIL
FT                   ENNYYQITNITIYISKYKNVKIEAIDGFGQNYKFIFKNIENEYNIGDIVKIQNNKIQCI
FT                   KKPLLVKLRKKYNKLINKFLNSISIKYSHFLKAILTNNKSEITTYEKHLFQKAGLSHIL
FT                   VISGLHFYLIYIILNYLLSIIINYKLKYTIIIIILLNYLILTGLSPSALRAFIILKTFI
FT                   IYKLIYGKINLFSTLSISFIINAIIFPYTLSSISFQLSYLSVIGICISIALNKRYNLNK
FT                   IIYPMLTTFLIQILTAPILYINDLNIQPISILSNIIVTPLILIFFIITIFSLLTYATST
FT                   NLFLFFDLINSYIFKTIKNTITIFSKVEVINNSNIGIFLILSTMILSYLIYKLEQEKYY
FT                   RENIKNS"
FT   gene            632595..633320
FT                   /locus_tag="BRE_596"
FT   CDS_pept        632595..633320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_596"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_596"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94824"
FT                   /db_xref="GOA:B5RPU0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU0"
FT                   /protein_id="ACH94824.1"
FT                   /translation="MTLLNKYPVKYAFLEILLSYFIVTRISPFQNVNVDLWNFNKNHYS
FT                   YWLYSFFKIFFIVHFARLTSSYDFREEFCIPKFKFVFVWQAFAIFVKLLVCIFFVLIIL
FT                   CLCFLFFTSESVIPWMEMGSSGFIWEIKSTQSLLLMVVTSLFTGGVEELFFRSFFITKL
FT                   KQMGISLFISSLISSVVFAYGHSYYGFVGFFMSLIFGIIFAGMYLRYKNVYYSIFVHSF
FT                   YNVFVSFLLFLSNYSKELL"
FT   gene            633330..635261
FT                   /locus_tag="BRE_597"
FT   CDS_pept        633330..635261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_597"
FT                   /product="long-chain-fatty-acid CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_597"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94825"
FT                   /db_xref="GOA:B5RPU1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU1"
FT                   /protein_id="ACH94825.1"
FT                   /translation="MLDTVPKRFNEIIGLYGDLDIFIYKENDSRDFKRQIYSDFWKEVK
FT                   SVGSGLLHYGMRKGDKVALISDSRREWIIIDIAVMSLGCIDVPRGNDSSEDELTYIINH
FT                   SESSFIFVENAKQLQKIISKKHDLKFVKYVVVIDDDKLYEDKLGNITIISYRQLLSLGH
FT                   DYLKDYPKMFDLELEKVSGKDVATIIYTSGTTGFPKGVVLRHESFIFQLDRINDYLPSL
FT                   EPGQIMISILPLWHSFERTCEYIVALNGLSIAYSKPVGPILLKDFAALNPHAIISVPRI
FT                   WEGIRAGIIKKVSESFLKKILFNFFLNVGIFYVKFMEKFLGLVPIYRKSNFLISFFMKI
FT                   IYLIGLILIFPFKFLGHILVFKKIKKALGKRFIFGISGGGALVDYVDYFFKAVGIVVLE
FT                   GYGLTETGPVLSVRRLKSPVANTVGPLFPDIEYKVVDHNGNVLPPGEKGELWVKSPQVM
FT                   SGYFKDETMTREVLTRDGWFKTGDLVCATINDEISIVGRSKDTIVLRGGENIEPEPIER
FT                   ALSKSVFIENVVVVGQDQKFLGAIIVPNFEVLEKWAISSGIAFSSHDDLLSNELVNKFY
FT                   SKCILDIVNPKSGFKSFERIVGFVLLKDAFVIGDELTNTLKLKRYYILEKYNKKIMSIF
FT                   NKDDCELL"
FT   gene            complement(635293..637050)
FT                   /gene="argS"
FT                   /locus_tag="BRE_598"
FT   CDS_pept        complement(635293..637050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BRE_598"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_598"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94826"
FT                   /db_xref="GOA:B5RPU2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPU2"
FT                   /protein_id="ACH94826.1"
FT                   /translation="MIKTIKADLENKIQKTIKELALSSNIKLDKINIVMQKPPKSEMGD
FT                   LSILIFEFSKILKLSIPVITQEIIKQIGNEYKTKSMGPYLNIKFNRKEYIQNTIKKVNK
FT                   EKENYGANNSLQNKKTIIEFSSPNTNKPLHVGHLRNDIIGESLSRILKASGSKVTKINL
FT                   INDRGTHICKSMLAYKKFGNNITPEIAQKKGDHLIGDFYVKYNEYASQNSEIAENEIQQ
FT                   LLYQWEQGDEKTVQLWTKLNKWAIDGIKETYNTTNITFDKIYLESEIFKIGREVVINGL
FT                   KEGLCYKREDGAICINIPTETNNIDNQNFKQKVLLRANGTSIYLTQDLGNIVARKNEFD
FT                   FDEMIYVVGSEQIHHFKTLFYVADKLGITNENNLIHLSYGMVNLPEGKMKSREGNIIDA
FT                   DNLIHDLSQSTMLELKKRYENEQNLQKLALNISLGAIHYYLLKTAIHKDILFNKTESLS
FT                   FTGNSGPYIQYVGARINSILDKYNNLNLPNKNTNFDLLINENEWEIIKIISEFEEYIIK
FT                   ASKDRNPSIIANYSYLLAKNFSTYYQDTKIIDKDNLELTHARIDLAKAVLQTIKNCMHL
FT                   LNIPYIQKM"
FT   gene            complement(637043..637621)
FT                   /locus_tag="BRE_599"
FT   CDS_pept        complement(637043..637621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_599"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_599"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94827"
FT                   /db_xref="GOA:B5RPU3"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU3"
FT                   /protein_id="ACH94827.1"
FT                   /translation="MNKTTFYITDKYLKTSLMLFPIFAYTKNFLEGTIISTWISLCILL
FT                   PAVIIKKIEFKNHILKIYLLIIGLVISITYPFMQYVTPILYENLRFSIPILTVIIISFH
FT                   KNEPFKSPSIWQYSKSPIIIFISLSTIISFFREILNTGNLKLFNITFQIIKNYNITKIP
FT                   AYSSNIFLITSLIFLLINILKNIQGQKND"
FT   gene            complement(637637..639853)
FT                   /gene="mcp-2"
FT                   /locus_tag="BRE_600"
FT   CDS_pept        complement(637637..639853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-2"
FT                   /locus_tag="BRE_600"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_600"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94828"
FT                   /db_xref="GOA:B5RPU4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU4"
FT                   /protein_id="ACH94828.1"
FT                   /translation="MKRNHFSSTLFYKFNIVIVIYTIIIAMTIFILLERGYRKIITTEL
FT                   QNFTKFVNNIMIKSFSRDTRNMLIAIDNFAKHHNQNINKQQNEHFKNIITSEQLSSFPS
FT                   YIKILEYTDKNGKILYSNNERRLHTYINLQEMQKDNNIGNHHTLILNQDLTIINNKYYI
FT                   PMIYKLPQKEQHDFYDTNDANIKLEQSERMDHNGYVVLYVDILEHIKQLRNNIFMLLER
FT                   SLLEKDNHHKSSHYFNIYAMNNQGEIFGEKNEDTLKPIKLSINDLFENNTNITNPLLNA
FT                   MTKRKSNYNISNNNNIISITRLTSSSWYLAIQMNHNNIFSNELNNIKLMSASIIILFII
FT                   VFILIMIIIIKKLIISKIEKLNNIIPKVKEGDLTIKINSKGKDSISATINHFGYFIENL
FT                   KNVINSLQGRVKLLKDNGDLLFNEINKAYDTITNSNRYIEKTQGEIEKQVEFISNTTNT
FT                   IENLSKNIASLDNSIETQASSVEESSSAIEEMIGSIQSVTEITQKAAKSTEELKAFSDD
FT                   GRKKQEEIIMQIKDIYKNSTRLQEANALISSIASQTNLLSMNAAIEASHAGEAGKGFAI
FT                   VAEEIKDLAEQVTSQSESVAASINEIMDSINQTVKTSELTNKAFNQIFNSINLVVQVIE
FT                   EINHTMQEQSIGSQEILKALNTMREITYEVKIGSNEMFRGNKEIINTVSGLGEINITVS
FT                   NSMKGLKEEIKKLIEAIESIKTFGTTNSDHITKINTDTNQFKTK"
FT   gene            640009..642249
FT                   /gene="mcp-3"
FT                   /locus_tag="BRE_601"
FT   CDS_pept        640009..642249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp-3"
FT                   /locus_tag="BRE_601"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_601"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94829"
FT                   /db_xref="GOA:B5RPU5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU5"
FT                   /protein_id="ACH94829.1"
FT                   /translation="MKLYFYGLNFGEFFMREDLVSVKLKNMRFFLYLMLFIFICFGFLF
FT                   LGQAYLNYRHEYLNRIEADFKLFSSNVAFKIKNKYDGAVSVLKNLIKDNNVLNVLHKVS
FT                   NNFVSNVDLRFIDLNTSIALFLSSKGFNDISKIFQHIPLEANSLEGVFYIPVGKNVLIS
FT                   NKNFSFLDINNIIEDPIYFVPVKESSVYYSSYKRVRNKLYSLVSMPLINDNHTVLGVIC
FT                   FFVCFDSLFVDIANQLNSYFKLSNKNYEFFMIDRDFQPLLLNLNDLNVNNFSENYANSV
FT                   LSSVIEGVRSDPNIVKKILKHNTSSYFLSTSQIAGQVVQGVIFNMNHVPLKFQSNAIFF
FT                   LGFVFVACLIIFCLCIKFVLPFFSDFKMLIEQKKEREDILKLDSTSEFKYKSFIFSYIN
FT                   TEFDNLFSKTTNIVNNIKFYVQELRGRLNEINIPEESIERVHNSLTTYDGIGDAFSKFE
FT                   KAVMNILKDFESTSNPINEHNKNILDIAAKFEENTNAFYSIDKNLEVFNKVVVSNSASI
FT                   DTVKSKVSELNSVFDSVNKNFSDLLSQTNNLQSANKLLVLISAQTNMLAMNAAIEAAKA
FT                   GDAGKSFAVVAEEIRKLAINSGKYSTTIKDELKKVNNIISVISAEIDSIYKDFIDIQDN
FT                   INNNSMQHERINVTLAKHVREIGEFKEQYLAHDIKIKDTKNMCKEIFNSYFVISGKFHN
FT                   LNSDLSEFEVSKMSLDALETLREHILLINEFKEKIARMRNVVENMNKEFWDV"
FT   gene            complement(642251..643204)
FT                   /gene="murB"
FT                   /locus_tag="BRE_602"
FT   CDS_pept        complement(642251..643204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="BRE_602"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_602"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94830"
FT                   /db_xref="GOA:B5RPU6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU6"
FT                   /protein_id="ACH94830.1"
FT                   /translation="MKKIIIQYKMNNMLENINNFLKKINIQPQTTNLANYTTYKIGGIS
FT                   KLFLIPKTIEDTKHIFKTAIQEKIKIFILGGGSNILINDEEEINFPIIYTKHLNKIEIH
FT                   DNQITAECGTNFNDLCNFALKNELSGLEFIYGLPGTLGGAIWMNARCFGSEISDILDKI
FT                   IFIDENGNFICKKFNKNEFAYKISPFQNKNTAILKATLNLKKGNKKHIEKIMKQNKQIR
FT                   INKGHYLFPSSGSTFKNNKNFLKPTGQIIEECNLKGLQIGGAKVSHYHGNFIINNNNAT
FT                   SREVKTLIDKIKTQVQIKTGFLLEEEILYIGFNQKN"
FT   gene            643358..644815
FT                   /gene="cysS"
FT                   /locus_tag="BRE_603"
FT   CDS_pept        643358..644815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BRE_603"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_603"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94831"
FT                   /db_xref="GOA:B5RPU7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU7"
FT                   /protein_id="ACH94831.1"
FT                   /translation="MMVFMLLKLYNTKTKCLSEVKNLSETKIYACGPTVYNYAHIGNLR
FT                   TYIFEDLLIKSLKLFKYNVNYAMNITDIGHLTGDFDDGEDKVVKAAKERGLTVYDISRF
FT                   FTKAFFDDCKKLNILYPDKVLVASEYILDMIEVVKVLEKNGFTYFVNGNVYFDISRFKN
FT                   YGQMAGINLNDINENSVSRVELDFSKRNKSDFVLWFTNSKFQNQEMKWDSPWGFGYPSW
FT                   HLECATMNLNYFNSTLNIHLGGIDHIRVHHVNEIAIMECYLGKNWCDMFIHGEFLIMEN
FT                   EKMSKSNNDFITIKNLEDEGFSPLDFRYFCLTAHYRTQLKFTFHSLKACKVARENLLSK
FT                   LTSCYSSLSQFDISLLSQDDENIEFILEHKYYDSFLERIAFDLNIPKVLALLWDIVRDN
FT                   NLSSLSKLKLAFKFDEVLSLGLREEILREIDMSRIVIDDVMNSLIEERRLAKLKKDFKR
FT                   ADEIREYCRSKGFILIDTEEGTKVKRG"
FT   gene            644819..646372
FT                   /locus_tag="BRE_604"
FT   CDS_pept        644819..646372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_604"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_604"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94832"
FT                   /db_xref="GOA:B5RPU8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPU8"
FT                   /protein_id="ACH94832.1"
FT                   /translation="MAVFIRGQYFILSLIFLIFFGLFVFSGFLFYLKPVIYEISPMPAS
FT                   HENVIVIKGRNLGDKIGEVNINDHYLVKSSIISWSNERVVFKITNEINSGLVFIKNRQG
FT                   ISNELFLVISRQVPIKLEKDNSPFLFLEENLVVMTNTPVVLRGKNLTSDSGVVEIFIQT
FT                   KHELYKVLSRDILSLSEMEIRFIPPKTLNINGEIFVVVDELKSNKLPFKFNENFFAWNL
FT                   QKGKNFKISHEISFLKNKNDSSNEILDNINFNIFYLSPVENERQKIQFVDNNGTLLNLD
FT                   NLFFKNLKSDKYHFNFEVKTFQLNLDIFDVKALEGIRVSTDANIREFKTYVLDKRDHYL
FT                   SYDSFDLTSINLNVNNKDSAYELAKSIIDALVSYFTLVNNDLALDKSIEMKEISVDNLI
FT                   LLTNLLFFRHNIPLRNAVGFYFDNKSSKLQKHIWCEFFLEHIGFIYFDIINAVLFKDSS
FT                   NYFLNMSENYIHYGYREDYDNDLLLDEYVDLVLFKYKSLTSHDHSLNYKITLEENSNDR
FT                   "
FT   gene            646362..647615
FT                   /gene="glyA"
FT                   /locus_tag="BRE_605"
FT   CDS_pept        646362..647615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="BRE_605"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_605"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94833"
FT                   /db_xref="GOA:B5RPU9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPU9"
FT                   /protein_id="ACH94833.1"
FT                   /translation="MIDNILFDLIEREAKRERENIELIASENFVSSDVRQAVGSVLTNK
FT                   YAEGYPSKRYYGGCSVVDDIENLAISRAMELFGASYANVQPHSGSQANMAAIMSLIKPG
FT                   DKILGMELSHGGHLTHGSKVSFSGMFFDAYSYGVSRDSEMIDYDDVRNIAKACRPNLII
FT                   AGASSYSREIDFKKFREIANEVSAYLLCDIAHTAGLVATGFHNSPIDVAHLTTSTTHKT
FT                   LRGPRGGLILAGKEFNTMINYNNKERTLDLAVNSCVFPGTQGGPLMHVIAGKAVAFKEA
FT                   LNKEFKDYISRVIENTKAMAEYFISEGLRIVSGGTDNHLFLVDLSGLGITGADAEKILE
FT                   SVNITLNKNAIPFDSKNPSVASGIRIGAPAITSRGLNRDDSIKVAHFIIRALKTKSTDE
FT                   LRKIKQEVIGFISSFDMP"
FT   gene            647630..648394
FT                   /gene="dnaJ"
FT                   /locus_tag="BRE_606"
FT   CDS_pept        647630..648394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="BRE_606"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_606"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94834"
FT                   /db_xref="GOA:B5RPV0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV0"
FT                   /protein_id="ACH94834.1"
FT                   /translation="MIVAVYNLFQIIFLLLPFILIFSPFILGIFFIFFILSIIYSILGG
FT                   FRISTTTRDYFYSKSREFEFYKLSFLLMAKLISILGSMTGEQLNYISFIMNSLNLSERD
FT                   KSELYNLFHFSVTQNRNADKILYTLKLGYFQRKDLFVWLVSVLKEINNLARYKSLEGDK
FT                   FILYVSSFLELDFESYDSYKNVDIKVVNPYEVLGLKYDASDDDIKRAYKKLVIQYHPDK
FT                   FENEPVKQKEANEKFIRIQDAYERISKERNLK"
FT   gene            complement(648492..650330)
FT                   /locus_tag="BRE_607"
FT   CDS_pept        complement(648492..650330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_607"
FT                   /product="membrane-associated protein P66"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_607"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94835"
FT                   /db_xref="InterPro:IPR020967"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV1"
FT                   /protein_id="ACH94835.1"
FT                   /translation="MTKTIICLLVIILSHIMAFAEDNETDTNGNNSSNTNTSNNTPELN
FT                   QNLKLPITLTFDNSSQFRFDMDELVPGLENKTNVGIKITPYINTKEVGNNDPLSAYVKV
FT                   ESLCLNASGKSNTPIKFSVENITAQINMYDFYLKMESMTDFNFNQESLFSFAPISKIQS
FT                   QYYGFPNKENATTRTILSRSTAKKIGTLQFGYKLPSQLELILSIGATGTGNRNNKKNDK
FT                   DSEEDKKNKEAIPYNDTYKGILYGAQVKWKPIQNNLTQYNSNISVKNPLELNFGISGAI
FT                   GNSTFNNSSITYGLKDTSVTDSDLVNPTLSNASIITSIGVSYKLGLTKINNKNTYLLLN
FT                   AGSDLGIDPFASDFSILGHISRKANTDEKKQFDPVSNKLQFDIKRTPNFEFSVGTGIGL
FT                   AWNTDEGEEESWEISGSKSYNKRIFGAQDKKSGIGFGINYGKSLYRPTSSNTLIQNIAK
FT                   KSFQTLNAELSTYEDNKKGIIPGLGWIASIGTYDLLRDKPKSDDIIAALTPNTNTTNKT
FT                   NIEFASATQLGGALYLDYAIPLKSMSPNTYIIPYVGAHMLGTLNFQKNTLYLKAGLELE
FT                   NLIKLTNIVIGWDSNNILASKDQNGSVFILFKISIS"
FT   gene            complement(650554..652089)
FT                   /gene="lctP"
FT                   /locus_tag="BRE_608"
FT   CDS_pept        complement(650554..652089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="BRE_608"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_608"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94836"
FT                   /db_xref="GOA:B5RPV2"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV2"
FT                   /protein_id="ACH94836.1"
FT                   /translation="MVNRKRSSHSIMNLYNFIKAVIPIIIIIIGLGIIKKPAYYVIPIC
FT                   LIVTIAIVLFDKNLGISNTSLAILEGTIMGIWPIIIVIVAAIFTYKMAESQNDMQIIKA
FT                   MLSNVSSDRRIIILLVAWGFGNFLEGVAGYGTAVAIPVSILIAMGFEPFFACLLCLIMD
FT                   TSSTAYGSVGIPIISLAQATELDVKMLSYDISLQLIIPTLLIPFILVILVGGGIKSLKG
FT                   GMFILTLLSGASIAISQVYVSKILGPELPAIIGSIPVMAIIIIYAKFFDKENKTCNKIK
FT                   VSKMQGFLACMPYILIVSLIIIVSPLFHSINKYLSNFKTILEIYPGAKPLQFKWLTSPG
FT                   LLIIFATIISYSIRGVPILDQLKTFLLTIKKLALSSFVIICIVSISRLMTHSGMIKDLA
FT                   DGISTLTGTLYPLFSPLIGALGTFLTGSDTVSNVLFGPLQTQIATNIDINPYWLSAANT
FT                   TGATGGKMISPQNITIATTTAGLIGQEGKLLSKTIIYAIGYILISGILVYFLL"
FT   gene            652059..653060
FT                   /gene="dacA"
FT                   /locus_tag="BRE_609"
FT   CDS_pept        652059..653060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BRE_609"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_609"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94837"
FT                   /db_xref="GOA:B5RPV3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV3"
FT                   /protein_id="ACH94837.1"
FT                   /translation="MNVSSFFYLPFNSITNFYAIIYNIYCMKIIFIIMSMFLLFNAYKL
FT                   FSITLLQIEKVVLDAKSVVLLDCDTKCVLYSKNPNLVFPPASLTKLVTIYTALVEAKKQ
FT                   NIDLNAIVPISSSASYYNLPLDSSLMFLEEGHKVTFEELLKGLVVSSGNDAAIAIAEFI
FT                   VGKDLNNFVNLMNDNVFKLKLINTSFVDTSGYSKNNKITALEMALFAKTYIDEFEFMLK
FT                   IHSLKDFIYPKPENLGSTSSSKMLNLKQDNKNILILNYPYADGLKTGYIKTSGLNLVAT
FT                   AKKDDIRLIAVILGVSKGVDNIGEKKRSLIAQKLFEYGFDHYSKFFCIGKNK"
FT   gene            653314..653817
FT                   /locus_tag="BRE_610"
FT   CDS_pept        653314..653817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_610"
FT                   /product="chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_610"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94838"
FT                   /db_xref="GOA:B5RPV4"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV4"
FT                   /protein_id="ACH94838.1"
FT                   /translation="MINFMLNHFNFKLKRDVTIIIPGEAFVSNDRVISTILGSCVSVVL
FT                   YDEFRKLIGLNHYVLVKSDLVVDDLKKGRYGVYAIPMLIDAMIENGASKSNLKAKLFGG
FT                   SNFMAKGTIKVGVENSSFALSELKKCGIPILAKDLGHSKSRKIFVYPEDFRVVVEYPDG
FT                   AKVF"
FT   gene            653996..655417
FT                   /gene="pepD"
FT                   /locus_tag="BRE_611"
FT   CDS_pept        653996..655417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="BRE_611"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_611"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94839"
FT                   /db_xref="GOA:B5RPV5"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV5"
FT                   /protein_id="ACH94839.1"
FT                   /translation="MENIVIHYFKQISQIPRCSKNLKGISNFVKQEAIKFGFSFKEDNV
FT                   GNIVVKIKANECDNVLPVILQAHTDMVCEKNESVVHDFEKDPIKIIEDDGYFFASGTTL
FT                   GADNGIGVAMMLAIMSESSAFKHPALELLFTVDEEIGLIGAIGLDPNLCSGKMLINLDG
FT                   EEEGYFLVGCAGSRLIHIDFKPRYRKSKKKTCVEILFTGLQGGHSGVDIHIDFANSLKL
FT                   IFFALNSLREKISFEIGHISGGCKSNAIPRESKALILIEDEDYSLLERELEMFKCYVHE
FT                   MHNLDVGFEIVLKRVNFCGDVLDDIDQCKLLDMGMAFFHGVQKVENYDEKLVRTSLNFA
FT                   SLLKVGNEYQFVFTIRSLLDIEKEYICCHLKSISKLAGANFKMIYDYSSWQPSKHSKLL
FT                   SHLKNIYKDMYLKEAKTVMVHAGLETGVISEKFGEIDAVTIGPWINYPHTPRERVDIAS
FT                   VVRVYDFLKKSLETL"
FT   gene            655519..655592
FT                   /locus_tag="BRE_612"
FT   tRNA            655519..655592
FT                   /locus_tag="BRE_612"
FT                   /product="tRNA-His"
FT   gene            655611..655684
FT                   /locus_tag="BRE_613"
FT   tRNA            655611..655684
FT                   /locus_tag="BRE_613"
FT                   /product="tRNA-Arg"
FT   gene            655742..655822
FT                   /locus_tag="BRE_614"
FT   tRNA            655742..655822
FT                   /locus_tag="BRE_614"
FT                   /product="tRNA-Leu"
FT   gene            655828..655898
FT                   /locus_tag="BRE_615"
FT   tRNA            655828..655898
FT                   /locus_tag="BRE_615"
FT                   /product="tRNA-Gly"
FT   gene            655947..657293
FT                   /gene="tig"
FT                   /locus_tag="BRE_616"
FT   CDS_pept        655947..657293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="BRE_616"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_616"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94840"
FT                   /db_xref="GOA:B5RPV6"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPV6"
FT                   /protein_id="ACH94840.1"
FT                   /translation="MILTSNVKLMPGSKVEAVIQISKEFVKAKYNEILKDYSSRLKVKG
FT                   FRTGRVPFSIIEGKYSDNIRALAIENLIHKSLEEFFESAIYKPLSYAVPKILDEKLEIN
FT                   FDKDFEFTFVYESYPEFEISDISNFKVEIPEVVISDSDIEDELKLLQFENSIIVEDNGS
FT                   VKVGSIVRVDFVELDDSLNEILATKRQDFVLTVGESDDYYGFGYDIIGMKKDEEKIVEK
FT                   NYGSDYKFSELANTSKRLKIGVKDIKRRDIPELDDAFAKDVKDSLNTLEDLRDYVRENM
FT                   LRVVQEKTNSLKLSKLLSGIAEKVNIDVPSSMFEAELKNVINEFSHQNKINITQLQNSS
FT                   TGLEGVNDVFKENVLNKLKSKLVFQKMVDNDSSEVTELDLENELIKQAQNLKMAPQDVK
FT                   KFYKERNLFGLLKDEIKRQKVKEKILQDLEEIKLEKVSFRDFVNYKTGE"
FT   gene            657293..657892
FT                   /gene="clpP-1"
FT                   /locus_tag="BRE_617"
FT   CDS_pept        657293..657892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP-1"
FT                   /locus_tag="BRE_617"
FT                   /product="ATP-dependent Clp protease proteolytic component"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_617"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94841"
FT                   /db_xref="GOA:B5RPV7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV7"
FT                   /protein_id="ACH94841.1"
FT                   /translation="MIRECMHNLVPTVVEHTGNYERVFDIYSRLLRDRIIFLSGEINDL
FT                   RGDTVIAQLLFLESEDSKKDIYLYINSPGGSITAGLAIYDTMQYIKPDVRTICIGQAAS
FT                   MAAFLLAGGAVGKRESLSYSRIMIHQPWGGIGGQASDISIQANEIIRLKRLIIDIMSEK
FT                   IGVSKEKLALDIERDYFMTPEGALNYGIIDSILVRN"
FT   gene            657915..659204
FT                   /gene="clpX"
FT                   /locus_tag="BRE_618"
FT   CDS_pept        657915..659204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="BRE_618"
FT                   /product="ATP-dependent Clp protease, subunit X"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_618"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94842"
FT                   /db_xref="GOA:B5RPV8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPV8"
FT                   /protein_id="ACH94842.1"
FT                   /translation="MARSKSQKIEGCSFCGRTRAEAEGKIISAKSVAICFECSKICHNL
FT                   FKEESDKPASNKAPRGLPTPKQLKSHLDKYIIGQEDAKKVLSVAVYNHYKRIFKGSKRE
FT                   TGVELEKSNVLLVGPTGSGKTLLAKKLAAEMNVPFAIADATTLTEAGYVGEDVENILLK
FT                   LIHAANGDVSFAERGIIYIDEIDKIAKKGENVSITRDVSGEGVQQSLLKIIEGTIANVP
FT                   PRGGRKHPYEETIAINTHDILFICGGAFVGLENIIKKRINRSFIGFSSSSCKDTGGDNS
FT                   LKYLEMEDLIKFGLIPEFVGRLPVHSYLDKLEKKDLMKILVEPENSIVRQYYHMFKMDN
FT                   VDLLFEKDALDAIAEEAMLKNTGARGLRSILEELLKDVMFEIPSSKQIKKVIVTKDSVL
FT                   NTNVEPLILTGRHVNKPWAKELYEINSKSN"
FT   gene            659149..661587
FT                   /gene="lon-2"
FT                   /locus_tag="BRE_619"
FT   CDS_pept        659149..661587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon-2"
FT                   /locus_tag="BRE_619"
FT                   /product="ATP-dependent protease LA"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_619"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94843"
FT                   /db_xref="GOA:B5RPV9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPV9"
FT                   /protein_id="ACH94843.1"
FT                   /translation="MLISLGQKNFMKSILNLINAKKDDLPIILVKDNVFFPNVSLWVSL
FT                   DDNASINAIYQSMLEDRLILFFCVKDLESISANAKINVDNLYSIGTYSKIIQVIKVTET
FT                   LVKILVDFHDRVVLKSILKKNDYFRARVDFISDKCEINGELFTYAKFLKETYNTYKSYL
FT                   PPATSKDDENINFFDSPAKFVDVIASNVNLEYRVKVELLQELNVKVRIEKLIMNLNIET
FT                   ELLMLKKDIKSKVKSKLDKGQREYFLTEQVKEIQKRLGKDETDYFERLNVKDIPKDIKS
FT                   RIEREISRLARTNANSLDVNIIRNYIELLLELPWNENTVMKNSLKEIEIILKNSHYGMN
FT                   EAKEKIMNFLAVYHINSKVQAPILCLVGPPGTGKTSVALSIAKSLSREFAKISLGGLRD
FT                   ETEIRGHRRSYVGALPGVFINAIKVAGKSNPVILLDEIDKINSTYKGNPEAALLEVLDS
FT                   EQNTRFVDHYLEIPYDLSNVLFVATANSINEISRPLLDRMEIIKIEGYSCVEKLEIAKN
FT                   FLIPNIIKESCLGKVYIRIEDDVILHIIRNYTMESGVRNLKRVLTNLFRTVLRELLYSY
FT                   SKEDIIEGNFYFPSSLIHGNNLLFTHDPDIRGIYKIINMHNFHCYVNCESRFNLMRIDS
FT                   SGFVYGLAWTNYGGAVLPVEAIKFDKKGDIILTGSLGAVMKESAQLAYSVVKTYSSKLN
FT                   LDINEIPEIHLHFPEGAIPKDGPSAGITIATAIASVLSDKKVPLDVAMTGEVTLKGSVL
FT                   SVGGIKEKVLAAYRNGINKIILPRDNEKDYVKLPEDIKDNIDVKYVSYLREVFDYLNII
FT                   "
FT   gene            complement(661797..662423)
FT                   /gene="rpsD"
FT                   /locus_tag="BRE_620"
FT   CDS_pept        complement(661797..662423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="BRE_620"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_620"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94844"
FT                   /db_xref="GOA:B5RPW0"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPW0"
FT                   /protein_id="ACH94844.1"
FT                   /translation="MNRKSIAKGKLVRRFGVNIFEQPKYDKLLKKKTNPPGMHGRSRRT
FT                   KVTEYGKQLIEKQKVKFTYGVSERQLTNVFKEARRQHGVTGDNLLALLERRIDNIVYRA
FT                   GFAISRAHARQIVSHGIIILNGRRVTIPSITLRANDIIQVKEKDSFKKLVRSNIEKTST
FT                   LRKLPDWIEVNADALNVKIIRTPSRDEIPTLANEQMIVEYYSKRA"
FT   gene            complement(662442..662515)
FT                   /locus_tag="BRE_621"
FT   tRNA            complement(662442..662515)
FT                   /locus_tag="BRE_621"
FT                   /product="tRNA-Met"
FT   gene            complement(662571..663839)
FT                   /locus_tag="BRE_622"
FT   CDS_pept        complement(662571..663839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_622"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="2 amidation motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_622"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94845"
FT                   /db_xref="GOA:B5RPW1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW1"
FT                   /protein_id="ACH94845.1"
FT                   /translation="MIKIINSKNINKCTQFNLENLQKNEIYIIYIENNVNAISYLKAKI
FT                   QDKEIQINNFYMDPNFHSEGIEKILIRNLIHYGKKNKIHKILCKINDIKEELKNLGFVN
FT                   NNNEYEKDLTHEIKKDTIIMRIGLISVLAEVASITSKLTVGILFNSFALIADALHVTSD
FT                   FILSTITYFSLKITNKPETIHYPYGYKKMENLIALIIGIAIIISGFTIFINSTGLNQII
FT                   DFHKEPELHMNHEHHSKKNILEIFSNNSFKKSIWIPLIPFIFFLVKIIEHVVKFQIGKR
FT                   YNNYLLLALSSSDKNCIFSHGGTTLSLLLATYVWTGFDKIISICIGFIMIKEGLHVIID
FT                   NANNLLSKQNINLKREIKNTLKNININFRELNFYHQGNEINLYIKLDLKYEDNLEKLIQ
FT                   KVDKIKHTIKECHQEIYETHILI"
FT   gene            663941..664324
FT                   /locus_tag="BRE_623"
FT   CDS_pept        663941..664324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_623"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_623"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94846"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW2"
FT                   /protein_id="ACH94846.1"
FT                   /translation="MEGCLMLQSQLFVKKCKRCISKDEVLMNNVKNVENVFYDFLKVFD
FT                   KKALENMFNYYYENFDFDKGIYDFIDKFIPMIDFLSLEILEHEFNFDEKRIILDIFDAS
FT                   ACTMKSNQLSEFAKAIVSLGILS"
FT   gene            complement(664360..664815)
FT                   /gene="cdd"
FT                   /locus_tag="BRE_624"
FT   CDS_pept        complement(664360..664815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="BRE_624"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_624"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94847"
FT                   /db_xref="GOA:B5RPW3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW3"
FT                   /protein_id="ACH94847.1"
FT                   /translation="MNDNGQDAIIKAFQLAETARNNAYSPYSKFKVGACIKTKDNLFFQ
FT                   GSNIENASFGATRCAEQAAIINMISSVGVQKIDFILVTTIPASVPCAICRQVMSEFFEE
FT                   DTKILITDPNQFNMNKKVFKIYTLNDLLKFPFNKEELSKIFKANKTT"
FT   gene            664949..665908
FT                   /locus_tag="BRE_625"
FT   CDS_pept        664949..665908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_625"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_625"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94848"
FT                   /db_xref="GOA:B5RPW4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW4"
FT                   /protein_id="ACH94848.1"
FT                   /translation="MIDVIEFIKKYDNFIIVGHKDPDFDCIGSSLALASFLRRIGKGII
FT                   LLNEGPFVRKEIIPFKEKFLSKWPNVNLLDYAVIILDCSVFDRIGDEFVFYVKDMPILV
FT                   IDHHSSGDKLDTLGYIDSGAPSTTFLIEKLIRAFGYEVTKEEAWYILVGFCTDTGFFRF
FT                   ISRDDPAPFEMVSRLVSKGLILKDIYNYIESVKSLASIDVLSMMLNNLRTYFDGKVLLT
FT                   VLPFNAKRDNNVSGVNELFYSLLANVENNEILIILKEIEDGSILAGLRSKEYFDVGELA
FT                   KYFGGGGHKHASGFKIKNTALNLLENQIIAYIKDAINS"
FT   gene            complement(665898..667553)
FT                   /locus_tag="BRE_626"
FT   CDS_pept        complement(665898..667553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_626"
FT                   /product="beta-glucosidase, putative"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_626"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94849"
FT                   /db_xref="GOA:B5RPW5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW5"
FT                   /protein_id="ACH94849.1"
FT                   /translation="MKKIIYIIVFLINNNCFCYDFWSTENKEKLIEQIVSQMNDKELLG
FT                   QMFMISYPKEKITNFTLNFIKEKNLGGIKIFGWNAKNLYNLIESINKAQTISQKNRFKI
FT                   PLFIATDQEGGWTQHIKLKTSKTIGNLGITATLSPNDAYFTGYHIANELKQLGININFA
FT                   PITDIYSNEENFIIGPRTYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTVIDS
FT                   HIKMPIINSDFKEIKRNELLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSTKIIK
FT                   EILRQDLKYDNLIITDDLLMNAVRYQNESIYDTIERIIRTETDILLISLNEDIQNNAYN
FT                   QLLNLMQKDNTIKENIIKSNKRILRIKLEYLKEKRNKEELFPKYDNAKEIPTKEAEFFF
FT                   EQNTLRSITKIKLSKKISKHKKTLLISPYNTMIKEGKKIFQNSYGYYYNYYPLNSINIT
FT                   QLKEIKNLIAQYEQVIFNVSTPASLEYIKNLKEYKNKISIIVSLTPQHIKQLNWIENIV
FT                   VVYGTTTLSFKSGFLTLTEDFNPKGQIPLMNLKN"
FT   gene            667774..667847
FT                   /locus_tag="BRE_627"
FT   tRNA            667774..667847
FT                   /locus_tag="BRE_627"
FT                   /product="tRNA-Met"
FT   gene            667864..668409
FT                   /gene="thiJ"
FT                   /locus_tag="BRE_628"
FT   CDS_pept        667864..668409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="BRE_628"
FT                   /product="4-methyl-5(b-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_628"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94850"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW6"
FT                   /protein_id="ACH94850.1"
FT                   /translation="MRVAIILADGFEEIEAVVPMDILRRGNVDLKVVSLNDSKFVSSSR
FT                   GFVFGADEKISNCTADHFDLIILPGGMPGAINLFESKDLDSILRNMNLQGKLIAAICAS
FT                   PVVVLAAKGLLGESKFTCYPGFENDITDGEFVNEDVVISNNFITSKGVGTSFKFVFALL
FT                   KIVKGEGILEDVKNKVLL"
FT   gene            complement(668503..669729)
FT                   /gene="ackA"
FT                   /locus_tag="BRE_629"
FT   CDS_pept        complement(668503..669729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="BRE_629"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_629"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94851"
FT                   /db_xref="GOA:B5RPW7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPW7"
FT                   /protein_id="ACH94851.1"
FT                   /translation="MKNIIILIINTGSSSLKFTLYEYQYQSEQILASGIIEKIKTTQAI
FT                   IKIKFKNKLLELTNLNIKSHKKALKHLIKTLTNKKTKIINYLDQIQGIGHRIVHGGAQF
FT                   KNSVIINQNVLNELKKISHLAPLHNPIAIKVIEQMFILFPNAKQVACFDTSWHQTMNQK
FT                   AFLYATPYSWYKDYHIRKYGFHGLSYAYITKRTAIILNKNIEDLNLIILHLGNGASINA
FT                   VQKGRSYDTSMGLTPLEGLVMGTRSGDIDPTIIPLMSKILKKTTKQIENILNKESGMLG
FT                   ISCKSNDLRDIWIESNNNEYNSKLAVEIMTYRIKKYIGSYLAALDFNIDAIIFTAGIGT
FT                   SDYEIRKLSLQGFEKIGIKIDFQKNNLAIDKNTEYDISSNQSNIKILVIPTNEELTILE
FT                   DTYDLIKNN"
FT   gene            complement(669740..673117)
FT                   /gene="mfd"
FT                   /locus_tag="BRE_630"
FT   CDS_pept        complement(669740..673117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BRE_630"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_630"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94852"
FT                   /db_xref="GOA:B5RPW8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW8"
FT                   /protein_id="ACH94852.1"
FT                   /translation="MNIEKELTTKLKNNQNLQKMQKFIEQNIHFTLTGYEKFFKAFLIH
FT                   KIKKYSNNKVILIVKNENISDEIKNDLTQITDQIYELNYFSPLIYKGIGSKSKVFCDRV
FT                   KFLINFYENNPGIYIVSLKSLLSKIPTKKDLFNNIYKIQTDKIINIENFEKKLIKMGYE
FT                   KTMRVTLPGEFTINNKIIDIHSFNHKEPTRISLNNDKIKQINYFNPLNQLKQKNAIYEF
FT                   NIIPKKEIIWNKENIDKLKNYIKESEYKQFFKQIETKYNARTEEVFYPLLGETLLSQEI
FT                   NENTITINFEIPNLKEEIKQIYKEYDRLYTQAIESDLKIVSPKEIFINPNDLKLKTNIY
FT                   FIKTPINQQTEKPTKEIIEFKIESERRFFSNIILAKQEIQNWIDNGFQVIITAESNSQK
FT                   EKLKYIFQDIPKIKVEVIKISSSLIINEEKIAIITEADIFNKKQKTNKTFESSKTKPID
FT                   SFIEIEKNSHIVHINHGIGIFRQIKRIKTSLIEKDYIEIEYADNEKLFIPIEQTHLIQK
FT                   YIGNETQNIKLDRISSKTWEKKKVYATKKIDKIADQLVSLYAERENITGFQYPQDDEWQ
FT                   LLFESEFPYDETPDQLTAISEIKQDMMSSKVMDRLLCGDVGFGKTEVAMRAAFKAVMGK
FT                   KQVAILSPTTILTEQHFNTFKKRFKNFPIQIAMISRFITKSKEKEILRNLETGNIDIII
FT                   GTHKILSKKITYKDLGLIIIDEEQRFGVKEKEKLKEIKVSVDSLVLSATPIPRSLHMSL
FT                   IKLRDISVLKTPPQNRIKIETYVEEFSEILIKHAIENELSRDGQVFFVHHNIQELDSIK
FT                   AMIEKVVPYARIATIHAKLTGEQIENIMQDFINKSYQVLLATTIIENGIDIENANTIII
FT                   NNANRFGLAQLYQLRGRVGRSSKKAFAYFLYKENSNLNEGAIERLRAISEFSELGAGFQ
FT                   IAMKDMEIRGVGNLLGREQHGEIESIGLDYYLTMLNKAIEKRMGKNSKKNEINIEINYN
FT                   GFIPNSYINNEQHKISIYKKISAIQSEEENNKIRSEIYDRFGPIPNELNSLLILSELKL
FT                   LAQKLNITSLKERNGLLEIEYLDINSIPAEKIMKIIKDNPNILKLNQEYQNSVFLNLGN
FT                   IKETDKINWIYKNLYLLL"
FT   gene            673216..674178
FT                   /locus_tag="BRE_631"
FT   CDS_pept        673216..674178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_631"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_631"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94853"
FT                   /db_xref="GOA:B5RPW9"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPW9"
FT                   /protein_id="ACH94853.1"
FT                   /translation="MEFRKLLFVIFFMIIPSIFFPRDYKGLDFKIKFFNQSIYRVNSNV
FT                   SIEVLLSNSSDDLITLEVGDVNTFGFDFDVTDTTNIKVKRSLEYVKNRSKNIAIPVRTL
FT                   ILRPNERFSVVMSLNQFVQFDKDGVYFVKGVFFPNISDPQKRVESNVITLFLKPKVDNL
FT                   AEEFDFSNLASNREVQNVLKRENLSPDKVIEYLFSALRLGEREKFFLYIDIESLILNDQ
FT                   NKSYLYKQELKSGSNNMIEEYKEYLWNNGNSYISKVPSKFSIVETSYTDSTGRVVSDVY
FT                   FEDGHFYVAKRYTFFLKKYDYYWIIYDYTVQNTGIKEKY"
FT   gene            674114..676213
FT                   /locus_tag="BRE_632"
FT   CDS_pept        674114..676213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_632"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, putative"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_632"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94854"
FT                   /db_xref="GOA:B5RPX0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX0"
FT                   /protein_id="ACH94854.1"
FT                   /translation="MIIIGSFMIILFKILELRRNTRPFILKIKWFWSILYIITFIDLYA
FT                   NFKHEVVKGDTLYSISIKYKVSVKELKIANNLKSENIKIGRILFIPSSSKSKNKLNTKK
FT                   VNTKKYNQKAKVVKYGTDSKIYIVKVGDTIEDISKKYGVKEKELIAWNNLSSKILKVGS
FT                   RLNLDEPDFLKPYLVKRGDSLSKLSVDFDISISDIMRFNFLDSKNLVIGQKLYLKKASS
FT                   NVHFHYVRWGETLGKIAYIYGVTAKHLVRLNGDNAINLKADSILDVSRLVESDLATPSV
FT                   LKLEEKAKNNETFISHKVSVGETLYSIARQYGILLEDLKSWNNLNGNHIVYNQELKIYD
FT                   KSKSSIIDDKVLDGIVGDDDNSKSKVKAIANVVSAKNKKLNLDFSNVLEHRNAFDISSL
FT                   VVLEPKIPIFEFNGIFYYWYKPKKVSQPSEFYSEDWHSPLNAYKKASQLFKSFENLVQS
FT                   RPIKNNSLKNKLIIIDPGHGGLDPGAIVKAKDGLNNEIFVVEDEYVYDIALRLYVYLKE
FT                   HGANVELTILSPDHLIRDSVTANNTFVNVKNEVYNDYDLNKTDTVDSWINGTLEGLKKR
FT                   LSVVNKFVNKYRNIKREDMLYISLHADNSVGAPRCMGFYYHSEDEGGFDTHSKSIIEKM
FT                   TADFKRSPYIKGQNLYMLKNNIVKTKLLVEVRNLAFDEEAWAIRSSKLRNLDSKILADA
FT                   ILKIL"
FT   gene            676289..676360
FT                   /locus_tag="BRE_633"
FT   tRNA            676289..676360
FT                   /locus_tag="BRE_633"
FT                   /product="tRNA-Asn"
FT   gene            complement(676903..678171)
FT                   /gene="pepX"
FT                   /locus_tag="BRE_634"
FT   CDS_pept        complement(676903..678171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepX"
FT                   /locus_tag="BRE_634"
FT                   /product="vacuolar X-prolyl dipeptidyl aminopeptidase I"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_634"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94855"
FT                   /db_xref="GOA:B5RPX1"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX1"
FT                   /protein_id="ACH94855.1"
FT                   /translation="MHDATLDISHFQNLLDKSLTPYHLINYIEQKLLYYLNAKELKLNE
FT                   KWKLETGYYYIKKEGTSLIAFNINTNKIHEPFLISSAHSDSPALKLKIESSKNEGNVFS
FT                   QHIEIYGGPIISTWTDRDLSLAGIVYFMKEGIINSQLITIDNIGTIPNVAIHLNRKANE
FT                   GFTYNTHENIVVITSFKKSIKEIILEKLQISQQDFLSCDLIFTASEPSKIIGSEGEFLA
FT                   SKNLDNKSGCHAIMNAFVHTNNKKNKVAVFFDNEEIGSLTSRGANSTLLTEILERIDYV
FT                   LNLGQEEHMIKLQKSFNISMDGAHGIHPGYICKHDPYYKTSLGKGVAIKSNANFKYATT
FT                   ANGWAKLKALAIKNNIKIQEILMKADTNSGSTIGPIANSKTGIETIDIGTPMWGMHSLR
FT                   ETIAISDHIEAIKLLRAFFENWN"
FT   gene            678275..679000
FT                   /locus_tag="BRE_635"
FT   CDS_pept        678275..679000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_635"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_635"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94856"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX2"
FT                   /protein_id="ACH94856.1"
FT                   /translation="MDKFYNLIFFTLIFIACTASSEIDLQDNASGTISVVFNVNKEFER
FT                   IRRELVTTLVGGDAAKMSLFPVDEIKQYFRDDGEKIGLKLLDIKSNGDSLKLVVKFDSL
FT                   IKVARYYLAKENLPLFKIENKNGKNIIDIDLNLKNVTKVINENKEYINDELAALLPSEE
FT                   IPMSEKEYRDVLMYFLSDFTDNASALIDNSNFKIKIKTSRKIQEQLGFNQINSNTLELN
FT                   LDMIKTVSLQKPIKLRLVY"
FT   gene            complement(679044..680903)
FT                   /gene="fruA-2"
FT                   /locus_tag="BRE_636"
FT   CDS_pept        complement(679044..680903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA-2"
FT                   /locus_tag="BRE_636"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_636"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94857"
FT                   /db_xref="GOA:B5RPX3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX3"
FT                   /protein_id="ACH94857.1"
FT                   /translation="MQDLFSKKLILLNYEAKSKDDIIEKMADMLNENGYLRNKENFIKD
FT                   IKKREEISGTGLEEYIAMPHAKGNFVEKHGIAILRVKDKGFDFGAADLKPSKLFFMIAV
FT                   PENTTGNDHIKTISYLNNIFNNDILRQEIMNTNDKNRFLEIILNTPNSDTIMNKTNLEN
FT                   FILAVTACPTGIAHTYMAADSLKRAANELNVEIKIETNGSSGIENPINEKDIKKAKGII
FT                   IASGKAVNKTRFNGKPLIEVGVKDGIHKAKELIQDIINNKAKIYRSNTSQKTESSITNN
FT                   TSNTEIYKHLMNGVSFMLPFVVSGGIIIAISFMFGIKAFDPTDPNYNKIADILMQIGDG
FT                   NAFFLMIPILAGYISFSIAERPGLAPGMITGLMMSKGNAGFLGGILAGFIAGYVTLTIK
FT                   SISQKIIPKNISSINPVLTYPFFSVLIAGFLTYILLTPIAYLNSSITNMLNSLSGTNMA
FT                   LLGALLGGMMAIDMGGPVNKAAYAFGIAMITAENYIPHASVMAGGMIPPIGIALATSIF
FT                   KNKFSQEEHEAGKVCYVLGACFITEAIIPFAASDPLKVIPACIIGSSIGGFLSALFQVK
FT                   LMAPHGGIFILPIITNPLMWIVSILIGSLITGVLIGFMKRDKK"
FT   gene            681058..681975
FT                   /gene="fruK"
FT                   /locus_tag="BRE_637"
FT   CDS_pept        681058..681975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="BRE_637"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_637"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94858"
FT                   /db_xref="GOA:B5RPX4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX4"
FT                   /protein_id="ACH94858.1"
FT                   /translation="MIYTLTLNPAIDYKIVVEGFQQEHLNHVVESSFLAGGKGINVSNV
FT                   LKNFQMESIAFGFLGGFTGDYIKSYLNLMKIRHNFVNISDNTRINIKMMSYGKETEING
FT                   NSPVILEKDFGSLIVKLKELDVGILVMSGSIPSSLGFRAYNEIVENLSSNLRVIVDTSG
FT                   PALQEIIKIKPFLIKPNINELKELLGINVTSDKDLINVGHKLVEKGVQNIIISMGGEGA
FT                   IFINNQDVYIASVPKIDSLSTIGAGDSVVAGFVYAYHKGHSFGDSFKFAVTSGTATAFK
FT                   GQLCNLDDVKAILSKINLEKISLD"
FT   gene            complement(682047..682120)
FT                   /locus_tag="BRE_638"
FT   tRNA            complement(682047..682120)
FT                   /locus_tag="BRE_638"
FT                   /product="tRNA-Asp"
FT   gene            complement(682168..683994)
FT                   /gene="recD"
FT                   /locus_tag="BRE_639"
FT   CDS_pept        complement(682168..683994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="BRE_639"
FT                   /product="exodeoxyribonuclease V, alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_639"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94859"
FT                   /db_xref="GOA:B5RPX5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX5"
FT                   /protein_id="ACH94859.1"
FT                   /translation="MRNYLVLREFLQEEQKNYLNPELKIYEIIEILNINVEQYYKSHLL
FT                   TKKIQNDKYEELTIFLIFIFNYFSKGHLRANIDLLIQDIQNTINCASLELEEENQHYQK
FT                   STHILQELTKFSKETKIKEMILYLEKNNIIKNYNQNEKITTPLILENNIYIYTQKNFRE
FT                   EEELIKQIDKRLKNNKTEISDDRIQNIMDHLNITNLSKEQINSIKKALKSNFFILSGGP
FT                   GTGKTTTINYILKAIDIHLDCKQNVALVAPTGKASQKLKSSIKESFKNLETQHSTIQKL
FT                   LKMSFINKDDKYDENNPLEFEIIIIDEASMIDANTFLRLLKALKTNTKIIITGDKNQLP
FT                   SIAGGNVYSSLTKIKKINDDSVEILKKNFRSNNEINLLAKAIYKEDMDLIETQFNDSKN
FT                   IILKNLNKINIENELLKHTKKLYNNIPNFNLNSLNDKEIESIIHTLLSNTILCSKNLGK
FT                   FGTQKINEIIKLYLKKLYGNLIGQIILITQNDYKNDLFNGERGILFKENSKIYALFKRE
FT                   NEKYKKINFNLINKYELSFATTIHKSQGSEYQHIQIIIENHPFLTKELLYTAITRARES
FT                   IEIISNKEIIKNVSLKKINRDSKITEYINTLK"
FT   gene            complement(684003..687446)
FT                   /gene="recB"
FT                   /locus_tag="BRE_640"
FT   CDS_pept        complement(684003..687446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="BRE_640"
FT                   /product="exodeoxyribonuclease V, beta chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_640"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94860"
FT                   /db_xref="GOA:B5RPX6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX6"
FT                   /protein_id="ACH94860.1"
FT                   /translation="MKEIIDKIKNNDKILIEASAGTGKTYTLEHIITNLLTTTMYTPNE
FT                   ILVLTFTKKATEEMHTRILKSIEHIYQNAKTDNLLKNIYEQSNKIFISTINKFALYSLN
FT                   NFQIETENFSKYTVKENFTSEIDEIIYEFLRKENSLKKELKIKDDEFEIFKSKFTNTKD
FT                   MIQALRQSYKRHKTEELGDWLEAQTTFKQILQNKERLLCNYNIIIDELEEMSTEEKRAF
FT                   LNKHNQGIKISEIEYSHATDIIHITEILTNNKFLCKIIEANLKKNVTLSPKELSIQTSL
FT                   IQLSNETNTNKENKNTLKRFVILKVEYKILQYIEKELENIINTTNVIDQKHIMTNFKKH
FT                   LESSEHKLLTSIKNRHKIILIDEAQDLDQTQIKIFELLNSCGIKIVFIADPKQIIYTFR
FT                   NADISFYNQGIKDKIKKDARITLLTNYRSNKKLVKPLNIMFERIYNKTHTDKIEQIEFV
FT                   QLQTEPKNDNNKIFINDQEIKAINIIQAEENDNVFQKTALIIKYLLINGKIYDNNQPRQ
FT                   IEKSDIKVLCRTSKEINFIDRELKKNNIKTHKTKEPFFKTKEFNEIFYLVKCLSKKQDF
FT                   KTLNYVLTSKMINLPWELHLNLIQNNKIKNIEEAISDIIYLLENQEITLMQAIDEIISK
FT                   QDLWINLVKDLNNDEFTKFAQSKQNYKENLINENKFEELQNYESSLNFILKTYYKDKNI
FT                   ESLICILEDLILGRDIENIEQYEEQTNNDNQSIEILTIHKSKGLGFNIVFLIGDTQNND
FT                   TLIKKTDIFYKYYLNNKIKYDFLKLKENQQLAKNKILNEEKNIFYVGTTRSKFALFIIN
FT                   QGTIINKMLRSAEINTIDGINLNFNIPNLNNYNQYNQSDINNDQQKAITLIPPPPINKY
FT                   LFRQEYIHSYTSLTSSYNTVNQNITDDETYDNDAIHNKNTLPKGKDIGNILHEIMKDIN
FT                   FNDAKDSLSNFKKNNSMLVQQKIEYFNSKLNTPMIQELLIKMIYNMLNKKINFIDTKLC
FT                   EIQELQKEMEFLIKINTKIYKQMSLFKQYNRLDFMLNNGYIKGIIDLIFKINNKIYILD
FT                   YKTNYLGENLQDYRLSHLTKKMKQENYDLQYKIYTLGIKKILFKNKEEYEKHFGGVIYL
FT                   FTRAFQEDIQTQDQTQNGIYSTIPNFQEIELEQIYLQLKH"
FT   gene            complement(687453..690665)
FT                   /gene="recC"
FT                   /locus_tag="BRE_641"
FT   CDS_pept        complement(687453..690665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="BRE_641"
FT                   /product="exodeoxyribonuclease V, gamma chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_641"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94861"
FT                   /db_xref="GOA:B5RPX7"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX7"
FT                   /protein_id="ACH94861.1"
FT                   /translation="MYKIYKTNKISNIYNKVNELIRNDNLFKKETIILVKNNILSDEIK
FT                   KYLATINGISYNLNIKHNTIKTIYNISIENPNIKKFLENNTLLFYTETETLVLYYILKD
FT                   NQTQNTSQFQSTKNRYAFASKMINLFHKYYSKFLYLIDTWRSNNFLFEDKNKHYYESIQ
FT                   KEIFEQLFVNQINILDLQEKIKKEITNTKQDIETKRIIIIGESREIDRKILHSLQQIFN
FT                   ITIYELVLKDITQIHSNLINELIPIKITKLQPTIQLTKEIDIQSFNEINFLSSLKNNII
FT                   KDTPLSNLDDSFKIIQAKTKKREVEILINNILHSTQNNNININDIVITYLAKDMDMYLP
FT                   YIEELLSKYELAFTILDSQDILKSKSIIALKQLMKLFISNRGTISNFNRKEIIEFLSNI
FT                   KVMNKFNISTNELEYLIKFSDAMNINFGMNKTHKEKLSYDQNFLNSWEDGFNRFLMSLI
FT                   FNDKYECNNCNENINFQDPESIIKLISIIRSLYEDIMYFKDQKYTIHEWAEIIDIFIDK
FT                   YIKLDDENRIDAYISTKIQYLKTFSKDANENLYKDYIIKIKEKKVDFSLFKAIFEDTIT
FT                   QKTHQLNNKSTGILVASCDKIEYLQKSEIHFLGTHELDSNIYFDNMDLLNEYYDYINLE
FT                   QENISNLIKIIFAATQKLYLYYSQSQYLNPDINNPKIINKIINHIKDTGLDIKIETHPN
FT                   ENYDPEYFKCNKANYLINYDTEAFNIAKSLQKGQSSNFKQKRLTLNKQITLDIEHINKA
FT                   ITNPYKYFYEEILNVQIKDTSYINDIKEKQEEQIIDIDNFNYKLMSIISIHEYIKNNTN
FT                   EHILERINNIIENQIQRGIIPINIKKTKIKEEFIRKLLQIKNNIDINFQDFFKMQKADI
FT                   TLNKNIFIDFEDKTLEFKLNGKLKNIYKIDNQYFYIYLEKKDYGQDKIIKKINLYMLGL
FT                   MIKTAITNIKSIKEIKINYETSKLSIENQYTNEEINHLDIENLLKQIAYISSHPTPIYK
FT                   DLIQKSLLKIENINELPIALKTQIKYQQKSISINKNMEFILKDKDITWCPYYNRFRDTH
FT                   DLNIEANLETLLQNFYAKFIKV"
FT   gene            complement(690670..692115)
FT                   /locus_tag="BRE_642"
FT   CDS_pept        complement(690670..692115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_642"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_642"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94862"
FT                   /db_xref="GOA:B5RPX8"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX8"
FT                   /protein_id="ACH94862.1"
FT                   /translation="MNNLSLFTDFYELSMMNAYFTKNINPKAKFEMFFRKTPFNNGYII
FT                   LSGIHTLINILKELHFNKEEIEYLENLNYFDKKFLEYLKTFKLNIKINSIAEGKIVFPH
FT                   EPILIIEGNLIELLLIEGLVLNTINFESLIATKTARIKEAGAQNLAELGLRRAQGINGA
FT                   LSASKAAYIGGANFTSNVLAGYKYNIPIIGTMAHSWVMSFPNEEEAFWEYAKTYPNNVN
FT                   LLIDTYDTLKSGLKNAIKIFKQLQNQGKKNFSVRIDSGDLEYLSKEVRRKLNENELFDV
FT                   KIIISNELDEEIIMYLNSIHAPIDCWGVGTNLVTAKGESNLSGVYKMISIQQNGKFIPK
FT                   MKISNNIDKATLPSQKGVVRIYSNNQMIFDLIFLKEEEEEIKKILNLKKQFTIFHPTQD
FT                   NTFKEIKTYDSFEFLIHTIFENGNILQPDELKLENIRVNVQNDLKKIDHTYKRLINPHI
FT                   YKVSITEKLKNLKNTLAKANNII"
FT   gene            692286..693719
FT                   /gene="zwf"
FT                   /locus_tag="BRE_643"
FT   CDS_pept        692286..693719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="BRE_643"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_643"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94863"
FT                   /db_xref="GOA:B5RPX9"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPX9"
FT                   /protein_id="ACH94863.1"
FT                   /translation="MSGKNVSNFDVVIFGVTGNLARKKLIPSLFNLYKDGYISNFRIIG
FT                   FARKNFTDEEIKNYIKDALWQEEFTALVDNFLQFVIYLSGDFRDKNAYLKLLSLLSNRE
FT                   KIYYLATSPEFYESIIENLKLYLCDDTSYLSKIILEKPFGSDLDTARFLNSLLYSVFKE
FT                   EQIYRIDHYLGKETVQNIFTFRFGNSIFENIWNNRYVDFVQITVAEEVGIDGRAEYYDS
FT                   VGALRDMVQNHILQLLSLIAMEPPIGFNADFIHDEKVKVLKSLRKFNQDTMKDNIIKGQ
FT                   YVCSKVQGVSRKGYRKEANFLCNSDTETYLAMKLFIDNWRWSGVPFYIRTGKALVRKFS
FT                   EIYIQFKKPNFTIFNTGLSNLANALVFRIQPRDGIEIKFNTKKPGYNYEIQEANMEFSY
FT                   HASFNKFFGESYERLLFDAFLGDRTLYARNDEIDSSWEFVSDILDKWGNIENMDYFYGS
FT                   EGPIEANLILEKDHFWRKM"
FT   gene            694644..695969
FT                   /gene="nhaC-2"
FT                   /locus_tag="BRE_644"
FT   CDS_pept        694644..695969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC-2"
FT                   /locus_tag="BRE_644"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_644"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94864"
FT                   /db_xref="GOA:B5RPY0"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY0"
FT                   /protein_id="ACH94864.1"
FT                   /translation="MNTDSHIKPNFFGLVPFLVFIVLYVGTGIVLEIQGVEMAFYQMPP
FT                   IIAMLLAVVTAFLLFKGSFIDKLNEFVEGCAQNDIIFISFIFMISGAFSAVCKEIGSVE
FT                   TVANIGLKYIPANLLVAGIFLICLFLSTATGSFLGTVVAITPIGFEIADKSGIPLPVVA
FT                   GAVLGGGAFGDSMSLISDTTIIASRTQGVKIIDVFRNGVFFTFPASILSTVAFAILGSY
FT                   MSGIGVEFELGDINYFKVIPYLFVMIFAFLGVDVFLVLFFGILIAGFIGIVNGDLTLLL
FT                   MAQKINEGLLDLSEMLIIVIFTGGISYMTINHGGFEWILTKLKYLARCRRSAEFTITFL
FT                   IIMVTGFLSNSGLAILVNGTVTKGISEANSVCPKRCAALLSISSCALIGALPYGMHMIS
FT                   VMNIAKGAISPLDIMPFLFYQVFLGIIIIFSIAFFKLKKISF"
FT   gene            complement(696001..697056)
FT                   /gene="potD"
FT                   /locus_tag="BRE_645"
FT   CDS_pept        complement(696001..697056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="BRE_645"
FT                   /product="spermidine/putrescine ABC transporter, binding
FT                   periplasmic protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_645"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94865"
FT                   /db_xref="GOA:B5RPY1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY1"
FT                   /protein_id="ACH94865.1"
FT                   /translation="MILKKVLILIIILIIVSCSSQKKQNVLNILNWAEYIDENLLAQFE
FT                   KEHNVKINYDCFNNTEEMMAKFNNTKNYYDIIVPSEYLIGDLRDENKIELLDHSKLPNV
FT                   KKNILDELKNLEYDPGNLYSVPIFWGVLGILYHKNKIDINDMNEFDILFNEKYKKEIAM
FT                   LDSPKENIGVALKKLGYSLNEHSIPIIKEAEKLLKNQVSLVVGYFSDIAAKSLMLNGEA
FT                   SIQLTWGGEAIDAMLKDPNLDFYTPNSTNLWFDVLAIPSDAPNKELAYKFINFLYENEA
FT                   SYANFEETKYNSPNKNVLKRLKSEATNKPEMKLYLDDRFVPKNFSKHEVFKRISKKVKE
FT                   EQMRIYVEISS"
FT   gene            complement(697068..697859)
FT                   /gene="potC"
FT                   /locus_tag="BRE_646"
FT   CDS_pept        complement(697068..697859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="BRE_646"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_646"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94866"
FT                   /db_xref="GOA:B5RPY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY2"
FT                   /protein_id="ACH94866.1"
FT                   /translation="MLKILKNTFLFLTLSFIYAPIIILIIYSFNSGDNGFFFEGFSLKW
FT                   YKEVFASKQIKIVIYNTLLVAIISSLISIIIGILGAYSIYKIKNKKIKTILLSINKIPI
FT                   INPDIVTGISLMTFYSLIKIQLGFSTMLMSHIIFSTPYIIIIILPKLYSLSDNIIDAAR
FT                   DLGASETQIFTNIILPEILGSIATGGLIAFTLSVDDFLISFFTTGQGFNNLSILINSLT
FT                   KRGIKPIINAISSILFFVILSLLFIINKYVGIKKLTVDTEI"
FT   gene            complement(697869..698672)
FT                   /gene="potB"
FT                   /locus_tag="BRE_647"
FT   CDS_pept        complement(697869..698672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="BRE_647"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_647"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94867"
FT                   /db_xref="GOA:B5RPY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY3"
FT                   /protein_id="ACH94867.1"
FT                   /translation="MNKIMLKLYSLFLLIFIIFPLVIIITLGFLNERNEFTFANFIRLL
FT                   EPSYLRIFSRSINFALITTIFCILIGYPTAWFISMSKKSTQNNLIIMIILPMWINTLLR
FT                   SYAWIRILGKNGIINNLFIAMGFKPMDLLYNEKAVIIGMIYNFLPFMILPIYIGLSKIK
FT                   YEYIEAARDLGARMWQILIYIKIPLTLSYLATGIIMVFIPSITVFIISDLLGGSKQILL
FT                   GNLIEKQFLFVPDWNTGSAISFILMIVIVIFNLTIIKLMQKTEKI"
FT   gene            complement(698678..699721)
FT                   /gene="potA"
FT                   /locus_tag="BRE_648"
FT   CDS_pept        complement(698678..699721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="BRE_648"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_648"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94868"
FT                   /db_xref="GOA:B5RPY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY4"
FT                   /protein_id="ACH94868.1"
FT                   /translation="MDNYILEIKNLKHYYTDSNNKTLDSINLKIKKNEFITLLGPSGCG
FT                   KTTLIKIIGGFLNQKEGEIYFLSKEISKITPNKREINTVFQNYALFPHMNVFDNISFGL
FT                   RIKKLNKNLIKEKVKTVLSLIGMQKYAYRNINKLSGGQKQRVAIARAIIMEPKLLLLDE
FT                   PLSALDLKMRQEMQRELKKIQRKLGITFIYVTHDQEEALTMSDRIVVMNEGIILQIGTP
FT                   EEIYNEPKTKFVASFIGESNIFEGTYEKEFVVKMFGKTFQCLDKGFKNNESVDLVIRPE
FT                   DVKILPKGQGHLSGVITSAIFQGVHYEMTLEIQKSNWLVQSTKLTKVGEEVDISLGPDD
FT                   IHVMCKE"
FT   gene            complement(699808..700683)
FT                   /locus_tag="BRE_649"
FT   CDS_pept        complement(699808..700683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_649"
FT                   /product="conserved hypothetical GTP-binding protein"
FT                   /note="ATP_GTP_A and AMIDATION motifs (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_649"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94869"
FT                   /db_xref="GOA:B5RPY5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY5"
FT                   /protein_id="ACH94869.1"
FT                   /translation="MKLRYNLKMSNKINWFPGHMKRALELIQINIKKTNIVLEILDARA
FT                   PFSSKNPLIETIIKNSNKDKIILLNKSDLVHEGEILKWKKYFETLGNNVLITNIYKKGI
FT                   KKQIINNIKKIANIKKIKTYKEKIKVLVIGVPNVGKSSIINLLVGKKSTSVANKPGHTK
FT                   NIQILKVNEDINLFDMPGILWHNLENQEIAKKLAILDMIKNEIIDNTELALYLLKEMHI
FT                   KNKTKLIGKYNIISTDTLKILEEFATIRGFINKKYGTDIESASKILIKEYREGKFGKII
FT                   LDLRPDNSNK"
FT   gene            700835..701500
FT                   /locus_tag="BRE_650"
FT   CDS_pept        700835..701500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_650"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_650"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94870"
FT                   /db_xref="GOA:B5RPY6"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY6"
FT                   /protein_id="ACH94870.1"
FT                   /translation="MSCQALEGEPLHSSFIMSKMALAAKMGGAIGIRANGVLDIRQIKS
FT                   EVDLPIIGIIKRVYHNSSVFITPTLKEVDELCDEGVEVIALDATFRNRPDGLLLSEFVN
FT                   KIKEKYPSQLLMADIGSLDEALNADQLGFDFIGTTLHGYTEDTEGFNIADNDFAFLKSL
FT                   LKCNLKAQLIVEGKIDTPLKAKRSFELGVSLVVVGGAITRPMEITKSFVDKINEVITI"
FT   gene            701540..703099
FT                   /gene="ptsG"
FT                   /locus_tag="BRE_651"
FT   CDS_pept        701540..703099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /locus_tag="BRE_651"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_651"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94871"
FT                   /db_xref="GOA:B5RPY7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY7"
FT                   /protein_id="ACH94871.1"
FT                   /translation="MGRFFQNAQKFGRSFMLPIAILPAAGLFLGIGGAFSNPATISTYT
FT                   FLDVFFLQSVFNIMRTAGAIIFVNLPPIFAIGVAVGLAKSDKGTAGLAAFVGYLVLNST
FT                   IGILVEMFGKVEDFSNGAIGLILGIKTLETGVFGGIIVGIMTYCLHNKFNKVEFPRVLG
FT                   FFSGSRFIPIIVSLSSIFLAVLMFIFWPFMQSGISMVGILVDATGYVGTLIYGIFLRML
FT                   GPFGLHHIFYLPFWTTGIGGSEIINGKLVEGTQNIFFAELSSHSTDKFFIGTSRFMSGR
FT                   FITMMFGLPGAALALYRLAKPNQKEKVFGLLLSSALTSFLTGITEPLEFSFLFVAPVLY
FT                   VVHAVFDGCAFMVAHILQITIGQTFSGGFIDFVLFGILQGNARTNWVLVPMVGVCWFWL
FT                   YYFSFTFLISKFDYKTPGREDIVNSHDSFSLSKNEVVREGDVSVQVVMGLGGRDNIVEL
FT                   DCCATRLRVTVKDSIKVSKSILESTGAKGIIIKSSGVQVVYGPGVSVLKNEIEEYLDNE
FT                   EN"
FT   gene            complement(703128..704114)
FT                   /locus_tag="BRE_652"
FT   CDS_pept        complement(703128..704114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_652"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_652"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94872"
FT                   /db_xref="GOA:B5RPY8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY8"
FT                   /protein_id="ACH94872.1"
FT                   /translation="MNIKNAIFIFIFIFLLIIVGPKIKFRNEFDKTQIPNKLEEIDQYL
FT                   LIEESKFNLVENTKKEIIWNKEKEKTQYAVVYIHGFGASKNEIYPIPNNIARALKANIF
FT                   FTRLKGHGIDNKNAFKGVNTKDWLRDIDEAIQIGQSIGEKLILIGTSNGGACVIWALKN
FT                   YQDKIHSAVLISPNIYPKDKRTNLVYYPWGRQIAYLITGGYNEPEIRQNKRIEYSKVNI
FT                   FHSPIRQIDSIIAMMGLVKLININGFNEIKTPLTIAYSPNDPTVDSQEINNFINNYGGY
FT                   KQSIPIILVESPHSHVPVGNHSYRSAQNTSYLTKYAVDFIQNIKKSK"
FT   gene            complement(704127..704645)
FT                   /gene="fur"
FT                   /locus_tag="BRE_653"
FT   CDS_pept        complement(704127..704645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="BRE_653"
FT                   /product="ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_653"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94873"
FT                   /db_xref="GOA:B5RPY9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPY9"
FT                   /protein_id="ACH94873.1"
FT                   /translation="MNNNTIEVHSTLEKVGITNDPILLKSLTTELGMKASHSRNRIILH
FT                   IASNPREYFTAKEIYNKLIKEIPSLSKATVYNTLNILKERNILKDIKTTDQKETRFYLS
FT                   LTSTIAHFKCNKCNQVYPIQLDDIKDILKDKLGEEWKTKSIEIIYSGSCNNCHQESQQE
FT                   EYNTNDDNH"
FT   gene            complement(704737..706431)
FT                   /locus_tag="BRE_654"
FT   CDS_pept        complement(704737..706431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_654"
FT                   /product="serine/threonine kinase, putative"
FT                   /note="AMIDATION motif (Prosite)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_654"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94874"
FT                   /db_xref="GOA:B5RPZ0"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ0"
FT                   /protein_id="ACH94874.1"
FT                   /translation="MIFRKTRNSKIYIVIVSITSFAESKLYSILSNAKYLIESQKLTYK
FT                   IHWTFPTYFFEILKLNSELNEWFFKRLKNNEDIYIPSTYSGSPHEYMLHDEIHVDLYWA
FT                   LKNPFKSGYKDLFQDNPNTFYIYNMEKLRKRVLELYRKLNFNYIEGIRIAKNNKKYLVF
FT                   YKNNCQFLSEIQEPDIRKQNTDSLIYFHEIKDIYDNQVLKNFLLSLKELDTNFYSIKIQ
FT                   NLEGKKINTELLEIPEFNSLKEQALVLQFQNKRLKEYQINEASLKEFLTNKNFENQSQN
FT                   PEPITSKNLEYNMEGNFTLSHEKYYVKFKEGKLNRIKYKEKNSEFLDSCRTYIKTLSKK
FT                   EIIIEPIIESSFSFSNEKIIGIRQYLNFNAKEKSIIDFFLDENLASFFISLKLVWPTTV
FT                   INCNNKKLNINNINYLTEYSSLEIPIFEVERGTNLKITARYNDLDTYEKIIETKKDTQG
FT                   YINGTEFLISKGSDQNSNFFISFLNIEKCIIYTINYKIAKKGFKRWFILNIGGSYNKVK
FT                   IEDLKNYSLSLNLLLLPNNNNFDNKIKINSKIKTLLFYPNIKKNENK"
FT   gene            706652..708286
FT                   /gene="groEL"
FT                   /locus_tag="BRE_655"
FT   CDS_pept        706652..708286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BRE_655"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_655"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94875"
FT                   /db_xref="GOA:B5RPZ1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RPZ1"
FT                   /protein_id="ACH94875.1"
FT                   /translation="MAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRNVLIDKKFGS
FT                   PIVTKDGVSVAREIDLENSFENMGAQLLKEVAIKTNDLAGDGTTTATVLAYAIAREGLK
FT                   NVSSGINPIGIKKGIDHAVALAAEKIRKSAKKITTKEEIAQVASISANNDTSIGEKIAE
FT                   AMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDTYILIC
FT                   EKKISTIKELLPVLEKVVNTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIKAPGFG
FT                   DRRKAMLEDIAILTGGVLVSEELGLTLENVELEQLGQAKSVKVDKDNTTIINTGNREQI
FT                   RERAELIKKQIEETSSEYDKEKLQERLAKLVGGVAVINVGAVTEVELKEKKHRVEDALS
FT                   ATRAAVEEGVVPGGGSTLIEVAMYLDTVDVSKLSYEEKQGFEIVKRSLEEPMRQIISNA
FT                   GFESSIYIHQIKTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAASIAGLLLTT
FT                   ECAITEIKEEKNSAGGNYPMDPGMGMM"
FT   gene            708347..708643
FT                   /locus_tag="BRE_656"
FT   CDS_pept        708347..708643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_656"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_656"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94876"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ2"
FT                   /protein_id="ACH94876.1"
FT                   /translation="MSENEFVFCIGYDGIRAIIDKELLGQHKDKSVEELFNLGFYRSAF
FT                   SKAFYRKDDALIDYLIKRYNNISNSTYSRKEELELLFGVIYPDDIANIKVTYV"
FT   gene            708659..708982
FT                   /gene="yajC"
FT                   /locus_tag="BRE_657"
FT   CDS_pept        708659..708982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="BRE_657"
FT                   /product="preprotein translocase YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_657"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94877"
FT                   /db_xref="GOA:B5RPZ3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ3"
FT                   /protein_id="ACH94877.1"
FT                   /translation="MFLLQDFSHSSSFFRSLLVFVPVIAIFWFLVISPQRKEEKKKKEM
FT                   LKSLKKGDKVLTIGGIFGVVKRVDDSEVLLELSETSEAKFVKSSIEKVIFDEIKDKKLK
FT                   NEK"
FT   gene            709063..710826
FT                   /gene="secD"
FT                   /locus_tag="BRE_658"
FT   CDS_pept        709063..710826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="BRE_658"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_658"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94878"
FT                   /db_xref="GOA:B5RPZ4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ4"
FT                   /protein_id="ACH94878.1"
FT                   /translation="MNKVSKLILILFVTSFAYFLIFPTLKWYFFTKEKDKQISSYSKEA
FT                   LRDYSKSQALSSLVKLKELYRKNPKGQIPDDLKYLIPVAKNNYKTYGREFPKSFNDIEA
FT                   LRGGFLTDSDIEELSLEIYRYYEEIKRNKNKIIQLGLDLSGGVSVTIFLDYLELEQRLG
FT                   RALSVLEKEEAIGRTMQILKERVDTFGLTEPKITREAGGNRIFLDIPGEKDERRVDSLL
FT                   GGKGNLIFYVVDLDATSVLNSKILEAGPLYSIHDIKNSMKLDDSKKIFPWYIKDAYGVD
FT                   DEARVRYYVVDFGLDNSFDGSHIQDAGILSDPKTGKDVVTFTLDSEGSEKFFAFTQKNV
FT                   GKTLAVVMEGKIKSVANINHAIAGGNVSIQGDSFDKKEAQELAFVFKTAAFPIEIKIDD
FT                   LRIIGPTIGEKTIELGIKASLLALVLVFLFMFIYYKTSGFVSGFSLVIYNLFLILAILS
FT                   AFNFTLTLTSIAGLVLTMGMAVDINIIIYERIKEEIRNGRKFERAFEDGFKKAFWGIMD
FT                   SNVTTFIAVLFLTLLGTGTIQGFAWSLSIGIVASLFSSLVFSRFILELIISLNRNKCVS
FT                   ISWSSNYAKGV"
FT   gene            710810..711706
FT                   /gene="secF"
FT                   /locus_tag="BRE_659"
FT   CDS_pept        710810..711706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="BRE_659"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_659"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94879"
FT                   /db_xref="GOA:B5RPZ5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ5"
FT                   /protein_id="ACH94879.1"
FT                   /translation="MQKVFNFLKYGNKAIIASFCMIFLGFIYTFMYHGGYNWGVDFSSG
FT                   LNINFVIDKAGIKDSDIKRVLSLFYKTFDVNEIIANDSKSHFDIIIKSEVTDYSLKKEI
FT                   HSMLLDKLGIEFDANVEILDSYFIDSRFSSVLRTKSVLLVCLTFALILVYVTLRFRLSY
FT                   AVSSIFATMHDILFVIAFLGLFRIEINSSIIVSILTIIGYSLNDTIIIFDRIRENSRNI
FT                   TDSSFLNILNISIHQTLSRTILTSITTFVAVFSIYIFTEGAIKDFSLIFMVGVVVGTFS
FT                   SVFIASPILLSCYKKIK"
FT   gene            711730..712881
FT                   /locus_tag="BRE_660"
FT   CDS_pept        711730..712881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_660"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_660"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94880"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ6"
FT                   /protein_id="ACH94880.1"
FT                   /translation="MKFFDFGSLGFYRFFDFQKHLNFSIFRYSLINYYSYKEQSTLIND
FT                   ANLFKNKIVFLDKIRKDITNITYISSKENDNLSVNKTIFCDTLNNIKSLIKKYYPESEF
FT                   LDFECDVLLDDEDTFDKFLDRLRYLNFKVDLKKKIEEFDRRNKTPYSCIKIATYFIKEE
FT                   FLERLGHSIDFFVNEANNSSLDLINKEIDEYCEKVEQVKVSEYIKDTHKKFVMEYAKER
FT                   ISKIMKEHSLDISKLLVKISLLDIVIHCFESYYLNLLEVLNILLSISNIIEIGLDELPD
FT                   AIFNEWNELIYLRRKEFQKLVLISDYVFQKRIISTINSGAWKFTFFSLSPRQGDVIQFT
FT                   VDINKSLSSLEEGIKEYKLKIDKLNSLKRDWEQSLKNFEQLFV"
FT   gene            complement(712878..713726)
FT                   /gene="dnaJ-2"
FT                   /locus_tag="BRE_661"
FT   CDS_pept        complement(712878..713726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ-2"
FT                   /locus_tag="BRE_661"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_661"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94881"
FT                   /db_xref="GOA:B5RPZ7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ7"
FT                   /protein_id="ACH94881.1"
FT                   /translation="MSKDYYNILGVSKNATTEEIKKAYKKLAIKYHPDKNKENKFAEEK
FT                   FKEINEAYEVLSSPQKKSNYDNFGNADFNNNFNTDSFTKGFKNSGFQHFDNFDLFSNIF
FT                   GEFTKGTIQDKEVTIKISLYDAYMGGKKFILINNEKIEINIPKGTIDTTKLKFNGKGNT
FT                   NPISGKRSNLIIKFEISSYKNFTLKDRNLETQINVYPWEIALGSEKIFETIEGKKIKIK
FT                   IPKNTKNGEILNLKGLGMPALENAIKGDLKVKLIVDVPPIINDEVKIIYEKLKEIYNKK
FT                   F"
FT   gene            713847..714986
FT                   /locus_tag="BRE_662"
FT   CDS_pept        713847..714986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_662"
FT                   /product="HemN-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_662"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94882"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR030933"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ8"
FT                   /protein_id="ACH94882.1"
FT                   /translation="MNFLSLKELSIYIDFSKCFSHIFYEKVFRELSYYLEVLGFPKVKT
FT                   LYIKYNDLRLVDVFELKSFLTSLSAKFNFFDLDEFTFELHPGNITTSVLTVLDNFFVSR
FT                   ISLDIKSFSSKFLEKIGIFGVSIDKVNAAIENIHQFHFDLNIDFDINILYHNKTNLKSD
FT                   LVKVISYAPEHISLSEVLIDKNNCIVDSSSDAYSDYNDIRGEDLWFYAFDFLESHGYLN
FT                   YEISNFALRGYECKHNVRYWELSPYLGLGLQAVSLLFVSENNGLRAVIRKDDNFLYSVE
FT                   SSATFENLSDLDFFIYHFITNLGTKRGLDISILRRRFIYHQNDFYKFIDYLLSLNKSVV
FT                   LSNDILYLEQCERFKLNFYLRLIEEYFIVNSFKVSFKFL"
FT   gene            complement(714973..715659)
FT                   /gene="rpi"
FT                   /locus_tag="BRE_663"
FT   CDS_pept        complement(714973..715659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpi"
FT                   /locus_tag="BRE_663"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_663"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94883"
FT                   /db_xref="GOA:B5RPZ9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5RPZ9"
FT                   /protein_id="ACH94883.1"
FT                   /translation="MEKQKELISKYAIDKYVTSNMFIGIGTGTTVFYAIKHLSYKIKSG
FT                   VLKNLTFYPTSSDTQCLLAKENIAYESKFTKLNKNIDITIDGADEVLLDKKALIKGGGA
FT                   AHLMEKVVAYNSNQLLIIADETKIVTNLGEKTPIPIEIAPNALAFIKAKLEKMNFNPVL
FT                   RTCKSKAGPLITDNNNYILDIKMNIENPKGTEKYFKLFPGILEIGIFNHQNTKIIYYQN
FT                   GQIKET"
FT   gene            715882..716634
FT                   /gene="gpmA"
FT                   /locus_tag="BRE_664"
FT   CDS_pept        715882..716634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="BRE_664"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_664"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94884"
FT                   /db_xref="GOA:B5RQ00"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQ00"
FT                   /protein_id="ACH94884.1"
FT                   /translation="MYKLVLVRHGESKWNKENLFTGWTDVKLSEKGVSEACEGGRILKE
FT                   EGYSFDIAFSSMLVRANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEK
FT                   YGEDKVLIWRRSYNVPPMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYW
FT                   TDKIAKAILEGKRVIVAAHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKNLKP
FT                   VKHYYLGDEDKIKAAMESVANQGKKIDR"
FT   gene            complement(716720..718318)
FT                   /gene="lysS"
FT                   /locus_tag="BRE_665"
FT   CDS_pept        complement(716720..718318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BRE_665"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_665"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94885"
FT                   /db_xref="GOA:B5RQ01"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ01"
FT                   /protein_id="ACH94885.1"
FT                   /translation="MIKLSLNRGNIMKTAHWADFYAKKIITEKGEKEQYTVSSGITPSG
FT                   TVHIGNFREVISVDLVARALQDQGKQVRFIYSWDNYDVFRKVPKNMPDQELLTTYLRQA
FT                   ITRVPDTKTNKSSYARANEIEFEQHLPTVGIEPEFIDQSLKYMSSDYANQIKFALDHKD
FT                   EIATILNKYRITQLADDWYPISIFCTKCNRDTTTIKNYNHCYSIEYYCECGNKESLDLR
FT                   KTWACKLPWRIDWPMRWKYENVDFEPAGKDHHSSGGSFDTAKEIVKIFGGTPPITFQYD
FT                   FISIKGHGGKISSSSGDVVSLKDVLEIYTPEVTRFLFASTKPNTEFAISFDLDVIKIYE
FT                   DYDKFERVYYGIDEIQEKKKETFKRIYELSQPKAPDKEIPYQIGFRHLSVICQIFEGDK
FT                   DKIFTLLNNIKEHQKTKLINKIECAINWIKKFAPEDFKFSLRSTFDNIEVLQDNNKQAV
FT                   IQLLKFLKENFNNITEKDIQDEIYNIARKNNIEPPLFFKQLYNILITKDKGPKLAGFIK
FT                   TIGIEKFEEIVKHYI"
FT   gene            complement(718368..719240)
FT                   /gene="era"
FT                   /locus_tag="BRE_666"
FT   CDS_pept        complement(718368..719240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="BRE_666"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_666"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94886"
FT                   /db_xref="GOA:B5RQ02"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5RQ02"
FT                   /protein_id="ACH94886.1"
FT                   /translation="MKSGFVSIIGRPSTGKSTLLNSICGHQISITSSTPQTTRNKIKGI
FT                   FTDKRGQIIFIDTPGFHLSKKNFNIALMNNVYSAIIETELIIYVIDIQDQPGTEENEIL
FT                   TIIQRSKINFIVAINKIDIHKTKEKEIMTFLEEKKIQKNKIIKISAEKQINIETMKDKI
FT                   YENLNEGPLYYPKEYYTDQKINLRISEIIRGVTIKKLKEELPYSIYTEIEILEDRENKF
FT                   FIKANIIVAGESQKGIIVGKGGKGIKSIGEESRKIISKILEKKCNLFLQVKLRKNWNKN
FT                   AKLIKNLIN"
FT   gene            719337..719684
FT                   /locus_tag="BRE_667"
FT   CDS_pept        719337..719684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_667"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_667"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94887"
FT                   /db_xref="GOA:B5RQ03"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ03"
FT                   /protein_id="ACH94887.1"
FT                   /translation="MRKVNFEVFCEKCGERVELDKAMCLNCHSKLGDLECPSCGYVGII
FT                   SAFENGCSKCNYSPFEKQLKKLSINRGFKRLWSGDSFLRRKFYFGFYVNVMLYLFANFL
FT                   IILLFVYILFF"
FT   gene            719697..720104
FT                   /locus_tag="BRE_668"
FT   CDS_pept        719697..720104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_668"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_668"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94888"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ04"
FT                   /protein_id="ACH94888.1"
FT                   /translation="MGITVFYLFSIFLSFNLGDNVKTVEDNMKRNSIFYYDIEEVEIAS
FT                   VNTQILNFRGKICVKNAYFSFDKYKLYSYTFVFDKKLVSQYSIVLSVKEKFGDASVVTP
FT                   FNYVWDIGDSIIVLNDNILRMTLKSYINGKN"
FT   gene            720101..720535
FT                   /locus_tag="BRE_669"
FT   CDS_pept        720101..720535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_669"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Possible lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_669"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94889"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ05"
FT                   /protein_id="ACH94889.1"
FT                   /translation="MNLKILFALIFFVSCVRHIYDKEIIINDTKFFVTLAIDKVTRAKG
FT                   YMGTRHIGINNGMLFIFDKEKNLSFWMRDTSIPLEIAYINAAGIIKEIYSLIPFSEVSV
FT                   NSKYKVKYALEVPGGTFSKFKIKVGDKVKFNFDVNSLNIE"
FT   gene            complement(720537..721196)
FT                   /locus_tag="BRE_670"
FT   CDS_pept        complement(720537..721196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_670"
FT                   /product="uncharacterized conserved protein"
FT                   /note="Probable lipoprotein (SpLip)"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_670"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94890"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ06"
FT                   /protein_id="ACH94890.1"
FT                   /translation="MVSNNMLKKSILNIEQLKYSIVIAVLTLITFISCKDKNVTYDKRI
FT                   KKILDNNKLEYRIDKENDFIISKTINNANIEIIVRSKLNSYQNSKIREIFGIVETFDVN
FT                   SDKIQEISESLMSDSYNNRVLGSWEIIHDPERGNNSLVYIVKAEENAKEIFLLDAFEEI
FT                   AATISIFKKVIRDDKTDINIKDKSNETFNKIPNDTLQNEDKINDHEEEELQKIKAK"
FT   gene            721242..722201
FT                   /locus_tag="BRE_671"
FT   CDS_pept        721242..722201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_671"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_671"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94891"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ07"
FT                   /protein_id="ACH94891.1"
FT                   /translation="MYFRSNDYSYTVIQSKNSYVQKSTFGISFVILNRGTKIFREDLFE
FT                   FLSNFDFIREIISIEKQSNRTSLQFISENYDKLKFILLSGDLNSGEKVNLAMKESICSF
FT                   VFVLQSDMYLLNPFWIPNIFDEIVKKNVLLVGGEFFDKDEEVVPSIFLPTIDKYQRLKV
FT                   ILINSERDYEKTLITMDYCGLYSKEKFIQLGGFDKRIKNEYFQRLDFGLRAIYFGESIY
FT                   IYRKLRIQYTALNIPEDLTKNKSFLIFLLKNYVPIFIGNGVKFSFLRFIRLCLRYGVNP
FT                   FRFGREFKEIKYETIKNSLRFKGDLKSAIELWENNIID"
FT   gene            722164..723189
FT                   /locus_tag="BRE_672"
FT   CDS_pept        722164..723189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_672"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_672"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94892"
FT                   /db_xref="GOA:B5RQ08"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ08"
FT                   /protein_id="ACH94892.1"
FT                   /translation="MQLNFGKIILLINLVFVFLFVHADEFEYVNILDSFDSNFFKFNFN
FT                   IERDILTIEHEKGHLKLKVGFEYGLSSIGYYIYVDPILLRDGEILITKKALMQIENYFR
FT                   SLQSYSKPRITSIVIDPGHGGHDRGAIVTHKLREHNITFFEKDFTLTYSIHLYKILSNY
FT                   FLDRNILLTRVDDIFVSLQDRSEFANAIKPDFPNNVIFLSIHANNAPNPDARGVEFWYL
FT                   PQNSKREVIRNLKGYDIRGNRYLRELNDILDIKYKYESKKLAEILYETFSDVLCETKIR
FT                   TIREEQWFVIKNSSMPAVLIEIGFLSNIDDAILILDYNYMSKINILVLESLIKFIEFYE
FT                   K"
FT   gene            723170..723718
FT                   /locus_tag="BRE_673"
FT   CDS_pept        723170..723718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_673"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_673"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94893"
FT                   /db_xref="GOA:B5RQ09"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ09"
FT                   /protein_id="ACH94893.1"
FT                   /translation="MNFMKNSGFNMLMKNICVCYDFLRRHCSKYLLEILIVFLLLSFLF
FT                   SSYMIFCNYDNLFFRKVFYFHSEHELISDLRYLKKRKTLKENLDLLVKDFLLGNSKGFY
FT                   LQFGTTNVKLLYSFMSNDVYFINLSKEFYDSFGNGAYKDSEELRVSLFVKSLKETINFN
FT                   YPRDVKEIFIFIEGYILNV"
FT   gene            723795..724844
FT                   /gene="flaA"
FT                   /locus_tag="BRE_674"
FT   CDS_pept        723795..724844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="BRE_674"
FT                   /product="flagellar filament outer layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_674"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94894"
FT                   /db_xref="GOA:B5RQ10"
FT                   /db_xref="InterPro:IPR006714"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ10"
FT                   /protein_id="ACH94894.1"
FT                   /translation="MMDKMKKSVFILFFIIFLIPVFGQETSRKSSGDGSSDGEPGELVL
FT                   DFAELAKDPSSTELDLTDYIDRVYSGASSIMKPEDMVLNLGINNWSVLLTPSARMQAYV
FT                   KNSIVVPAVVKSDSRRYAGETILGIRVLFPSYIQSSAMVLPPFKIPFYAGENGNQFVGR
FT                   GLIDNVRIMKEVKVTVYSLGHDVDLEVLFEDMSGMEYVYPLGSLKFKGWADLVWSNPTY
FT                   LPGISSRTADNSVPNYPLPSSKMRFKAFRVSKFHSSREQNLIFYIKDLRVIYDKLSISL
FT                   DFDVDNESIFKIYETRGVESLRKLKSQEALKKVLKVRESISMPDESFQDLFEKGKKSSN
FT                   DKSGVRTEK"
FT   gene            724915..727506
FT                   /gene="cheA-2"
FT                   /locus_tag="BRE_675"
FT   CDS_pept        724915..727506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA-2"
FT                   /locus_tag="BRE_675"
FT                   /product="chemotaxis histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_675"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94895"
FT                   /db_xref="GOA:B5RQ11"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ11"
FT                   /protein_id="ACH94895.1"
FT                   /translation="MIDADNKELLEIFFEEAQNLVDTLEENIISLEDDPHNMETIDEIF
FT                   RAAHTIKGSSASVDMMELSSFTHVVEDVFDAIRDNRLKICNDLIDLLLNALDVIKSMLD
FT                   TRLNGDVYLQDVSGLKSKLRGFLEYDYQTTSVSVLENKDNDEFLLSSSDINDMREAVGL
FT                   GQKLLKVSVDFDKDNPMATIAGIQMFQALKDLAPILHTVPNYDQLISDQFLKRVDYYLI
FT                   YLDIHKIEEKINLSDVASDYSINEFYIDNELAKANLREQNSVDNTLSKDNTVSNKGGFQ
FT                   LSNDEIIDLRNYIGDSKLFEVKLYFNKNNPMSTISGFQMLQALKSLGEIYKSIPDSEDL
FT                   LSDKFFDLIVYYLISKTSIESISKKVDLSDVVVSFDISEVDLKDIKGMDVSTEVDAYAP
FT                   VKESKKSALNVNLIRIDSKRIDSILNLVSEAVISKSSYNQINSDMTSFIYGFNYFYDYQ
FT                   ENFRNSFLSDLKMIFKDVGLDLENSIETRIVELLEHKLDRSLQDMMNLKDLLFKIHQDS
FT                   RFASNRLSRIITDLHESVLRTRMLPVASIFSRFTRVIRDLSKKLGKVVELSTQGEDTEV
FT                   DKSVIDDLVDPLMHCIRNSMDHGIETMDERISKGKDKAGHIILRAKNEGNVISIEIEDD
FT                   GKGIDPNVIRKKSIEKGLINENTVLSESEMLNLIFEPGFSTASQITDVSGRGVGLDVVK
FT                   NNVKKLNGTIIIDSKINVGTIFKIKLPLTLVIVQGLLVKSGNEIYVIPLNSVLETHRIN
FT                   EDNIRLLENDHEVYNLREEVISVLRLDELFNIKNDHQDLYEKFLIVISINDKKAGIVVD
FT                   SILGEEDFVVKPIKDKYASSPGIVGATTLGNGKVVLIIDVFRLFDLRDMKG"
FT   gene            727512..728909
FT                   /gene="cheW-3"
FT                   /locus_tag="BRE_676"
FT   CDS_pept        727512..728909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-3"
FT                   /locus_tag="BRE_676"
FT                   /product="purine-binding chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_676"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94896"
FT                   /db_xref="GOA:B5RQ12"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ12"
FT                   /protein_id="ACH94896.1"
FT                   /translation="MMEIKEIYLDEHNIGSHLKEKDSVNLDFKVVSFNIGDDSYLVDIM
FT                   QVKEIRKSNNFTYVPNAKKYVVGLDNLRGEIISIIDLRIMFNLKVIKKDFEDVMVLRNN
FT                   DLLIGVIVDKVNNVFSIDSSLIQNPHPILFQETLIHYMRGVVEYGSKLYIVLDVGKIFN
FT                   YDNDIEEKEVLLEESKNTGDKIGTSEHEEQSISFDNNSLELSEASASNHVLSSKDNLDD
FT                   LRVIKENLFKYSFNSSLVSDDFLKKIGVKLDIANINDLAYDNFLSEFYSKSSSQLWNEQ
FT                   YLKEFQEEIVQRHVNNMSDIGTILNVFEIGCGEGKETISFVNVLYESYKNPFKVTAIDN
FT                   DFNKVIGTSNLVFLESEINLSEIYRKNSFEQASGVYKFKPEIMNSILFEYSDAILSEFP
FT                   ENLGIVFLRDILCFLNDDGQVLILNAIAEKSVRGALLILGDNEELKNNDLFIKDKSVKY
FT                   FNLYKRI"
FT   gene            728921..729406
FT                   /gene="cheX"
FT                   /locus_tag="BRE_677"
FT   CDS_pept        728921..729406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX"
FT                   /locus_tag="BRE_677"
FT                   /product="chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_677"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94897"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ13"
FT                   /protein_id="ACH94897.1"
FT                   /translation="MRIDYIEPFLDAASSVLRDMLLVDDIQMGSPGLKSINQKIKGVSV
FT                   IVGLAGSVEGSIIIDMDIDTALFVASKLNFEEYVDFDDEETKEMVAATLTEVGNIIAGN
FT                   FVTTLHSKGFVFDITPPAFIYGENMKISNKGSEALIVPFTLPDNKIIEVNIAIRERV"
FT   gene            729455..729895
FT                   /gene="cheY3"
FT                   /locus_tag="BRE_678"
FT   CDS_pept        729455..729895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY3"
FT                   /locus_tag="BRE_678"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_678"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94898"
FT                   /db_xref="GOA:B5RQ14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ14"
FT                   /protein_id="ACH94898.1"
FT                   /translation="MIQKTTIAMDASNKPRGINYDTGVPFNVLIVDDSVFTVKQLTQIF
FT                   TSEGFNVIDTAADGEEAVVKYKNHYPNVDIVTLDITMPRMDGMTCLDNIIEFDKNAKVI
FT                   MISALGKEQLVKECLIKGAKTFIVKPLDRAKVLQRVMSVFVK"
FT   gene            complement(729908..730423)
FT                   /locus_tag="BRE_679"
FT   CDS_pept        complement(729908..730423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_679"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94899"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ15"
FT                   /protein_id="ACH94899.1"
FT                   /translation="MIKKILLFLIINTSIHSRLITPSIEKRSSESIKKYSAFNLLIEEE
FT                   YYIQYPKSTHEIQIYELTENFIKSILKNKIDDSKITPTYRETNKYLLQSEIIDKDFTKY
FT                   KIFKIKTIDSIFKSSALIYTTKGFYKLELYISDNKDKLEIFNLNPSYFTKNPNEITNEM
FT                   IFYNNNNK"
FT   gene            complement(730420..731469)
FT                   /locus_tag="BRE_680"
FT   CDS_pept        complement(730420..731469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_680"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94900"
FT                   /db_xref="GOA:B5RQ16"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ16"
FT                   /protein_id="ACH94900.1"
FT                   /translation="MVKIFSNFFKAILIASIFTFLMEELSIILFLPYKIRFALIFIGFL
FT                   FDIILILIFLYKILKAFFLKKSQIYIRNNLFFDLIHCLVPLIFYSSHQMQNILNPQEII
FT                   LTPIILSLFKLRFLRLLRFNDLMIEIYYNPKEKNLILIAFARTFSISSLVPFIFFIIFS
FT                   SSGFANTIPEKQEFNIIKNISITTEKNYIKEKYPFILIIKDKEQTIYSKSDDIFFYYSP
FT                   SEYKIIEIDKTKFYIDKYLQRKNDSVIGIFLFTLFISFAIFLTNFYKFFKASFLNPIIL
FT                   MHKVLQDPFEYRKIQIPFHFSEEKVYEMAKTFNNVLLKNKLNTKRKSKLPLEIEQLKKI
FT                   INSNNKENI"
FT   gene            complement(731463..732326)
FT                   /locus_tag="BRE_681"
FT   CDS_pept        complement(731463..732326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BRE_681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_681"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94901"
FT                   /db_xref="UniProtKB/TrEMBL:B5RQ17"
FT                   /protein_id="ACH94901.1"
FT                   /translation="MNLKIYFPHLYHYLFNHESIKGLSVFEKEVEIIKYIEDNKKTIST
FT                   FINENFKFDTDSLIQYVKEKTNIIISPIILSNIESIDLNIVKDLFNKKFNKNNLELIFN
FT                   SIKTNPYLRKEFLYNFNIISSGYITFYINKLFEDKNSYTIYLIKKESNIFDSSKIIKNY
FT                   IKILLLLRILIIKFYLEKEIKLVPQNIENISQLVSKEIEFLDNNTVKIITQSLFKYEHL
FT                   SNMSPIATLISIFSNRTKIPNIKNNRTKGFIGYDESWFSIKQSNSKDYDPRIIKELLEI
FT                   ARKNKW"
FT   gene            complement(732323..733009)
FT                   /gene="gph"
FT                   /locus_tag="BRE_682"
FT   CDS_pept        complement(732323..733009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="BRE_682"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:BRE_682"
FT                   /db_xref="EnsemblGenomes-Tr:ACH94902"
FT                   /db_xref="GOA:B5RQ18"
FT                   /db_xref=