(data stored in SCRATCH3701 zone)

EMBL: CP001011

ID   CP001011; SV 1; circular; genomic DNA; STD; PRO; 2535690 BP.
XX
AC   CP001011;
XX
PR   Project:PRJNA18457;
XX
DT   13-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Xylella fastidiosa M23, complete genome.
XX
KW   .
XX
OS   Xylella fastidiosa M23
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xylella.
XX
RN   [1]
RP   1-2535690
RX   DOI; 10.1128/JB.00651-10.
RX   PUBMED; 20601474.
RA   Chen J., Xie G., Han S., Chertkov O., Sims D., Civerolo E.L.;
RT   "Whole genome sequences of two Xylella fastidiosa strains (M12 and M23)
RT   causing almond leaf scorch disease in California";
RL   J. Bacteriol. 192(17):4534-4534(2010).
XX
RN   [2]
RP   1-2535690
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Brainard J., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Chen J., Richardson P.;
RT   ;
RL   Submitted (19-MAR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 28499d8097663a60962e3fed1cc10b61.
DR   BioSample; SAMN02598408.
DR   EnsemblGenomes-Gn; EBG00001148973.
DR   EnsemblGenomes-Gn; EBG00001148974.
DR   EnsemblGenomes-Gn; EBG00001148975.
DR   EnsemblGenomes-Gn; EBG00001148976.
DR   EnsemblGenomes-Gn; EBG00001148977.
DR   EnsemblGenomes-Gn; EBG00001148978.
DR   EnsemblGenomes-Gn; EBG00001148979.
DR   EnsemblGenomes-Gn; EBG00001148980.
DR   EnsemblGenomes-Gn; EBG00001148981.
DR   EnsemblGenomes-Gn; EBG00001148982.
DR   EnsemblGenomes-Gn; EBG00001148983.
DR   EnsemblGenomes-Gn; EBG00001148984.
DR   EnsemblGenomes-Gn; EBG00001148985.
DR   EnsemblGenomes-Gn; EBG00001148986.
DR   EnsemblGenomes-Gn; EBG00001148987.
DR   EnsemblGenomes-Gn; EBG00001148988.
DR   EnsemblGenomes-Gn; EBG00001148989.
DR   EnsemblGenomes-Gn; EBG00001148990.
DR   EnsemblGenomes-Gn; EBG00001148991.
DR   EnsemblGenomes-Gn; EBG00001148992.
DR   EnsemblGenomes-Gn; EBG00001148993.
DR   EnsemblGenomes-Gn; EBG00001148994.
DR   EnsemblGenomes-Gn; EBG00001148995.
DR   EnsemblGenomes-Gn; EBG00001148996.
DR   EnsemblGenomes-Gn; EBG00001148997.
DR   EnsemblGenomes-Gn; EBG00001148998.
DR   EnsemblGenomes-Gn; EBG00001148999.
DR   EnsemblGenomes-Gn; EBG00001149000.
DR   EnsemblGenomes-Gn; EBG00001149001.
DR   EnsemblGenomes-Gn; EBG00001149002.
DR   EnsemblGenomes-Gn; EBG00001149003.
DR   EnsemblGenomes-Gn; EBG00001149004.
DR   EnsemblGenomes-Gn; EBG00001149005.
DR   EnsemblGenomes-Gn; EBG00001149006.
DR   EnsemblGenomes-Gn; EBG00001149007.
DR   EnsemblGenomes-Gn; EBG00001149008.
DR   EnsemblGenomes-Gn; EBG00001149009.
DR   EnsemblGenomes-Gn; EBG00001149010.
DR   EnsemblGenomes-Gn; EBG00001149011.
DR   EnsemblGenomes-Gn; EBG00001149012.
DR   EnsemblGenomes-Gn; EBG00001149013.
DR   EnsemblGenomes-Gn; EBG00001149014.
DR   EnsemblGenomes-Gn; EBG00001149015.
DR   EnsemblGenomes-Gn; EBG00001149016.
DR   EnsemblGenomes-Gn; EBG00001149017.
DR   EnsemblGenomes-Gn; EBG00001149018.
DR   EnsemblGenomes-Gn; EBG00001149019.
DR   EnsemblGenomes-Gn; EBG00001149020.
DR   EnsemblGenomes-Gn; EBG00001149021.
DR   EnsemblGenomes-Gn; EBG00001149022.
DR   EnsemblGenomes-Gn; EBG00001149023.
DR   EnsemblGenomes-Gn; EBG00001149024.
DR   EnsemblGenomes-Gn; EBG00001149025.
DR   EnsemblGenomes-Gn; EBG00001149026.
DR   EnsemblGenomes-Gn; EBG00001149027.
DR   EnsemblGenomes-Gn; EBG00001149028.
DR   EnsemblGenomes-Gn; EBG00001149029.
DR   EnsemblGenomes-Gn; EBG00001149030.
DR   EnsemblGenomes-Gn; EBG00001149031.
DR   EnsemblGenomes-Gn; EBG00001149032.
DR   EnsemblGenomes-Gn; EBG00001149033.
DR   EnsemblGenomes-Gn; EBG00001149034.
DR   EnsemblGenomes-Gn; EBG00001149035.
DR   EnsemblGenomes-Gn; EBG00001149036.
DR   EnsemblGenomes-Gn; EBG00001149037.
DR   EnsemblGenomes-Gn; EBG00001149038.
DR   EnsemblGenomes-Gn; EBG00001149039.
DR   EnsemblGenomes-Gn; EBG00001149040.
DR   EnsemblGenomes-Gn; EBG00001149041.
DR   EnsemblGenomes-Gn; EBG00001149042.
DR   EnsemblGenomes-Gn; EBG00001149043.
DR   EnsemblGenomes-Gn; EBG00001149044.
DR   EnsemblGenomes-Gn; EBG00001149045.
DR   EnsemblGenomes-Gn; EBG00001149046.
DR   EnsemblGenomes-Gn; EBG00001149047.
DR   EnsemblGenomes-Gn; XfasM23_R0001.
DR   EnsemblGenomes-Gn; XfasM23_R0002.
DR   EnsemblGenomes-Gn; XfasM23_R0003.
DR   EnsemblGenomes-Gn; XfasM23_R0004.
DR   EnsemblGenomes-Gn; XfasM23_R0005.
DR   EnsemblGenomes-Gn; XfasM23_R0006.
DR   EnsemblGenomes-Gn; XfasM23_R0007.
DR   EnsemblGenomes-Gn; XfasM23_R0008.
DR   EnsemblGenomes-Gn; XfasM23_R0009.
DR   EnsemblGenomes-Gn; XfasM23_R0010.
DR   EnsemblGenomes-Gn; XfasM23_R0011.
DR   EnsemblGenomes-Gn; XfasM23_R0012.
DR   EnsemblGenomes-Gn; XfasM23_R0013.
DR   EnsemblGenomes-Gn; XfasM23_R0014.
DR   EnsemblGenomes-Gn; XfasM23_R0015.
DR   EnsemblGenomes-Gn; XfasM23_R0016.
DR   EnsemblGenomes-Gn; XfasM23_R0017.
DR   EnsemblGenomes-Gn; XfasM23_R0018.
DR   EnsemblGenomes-Gn; XfasM23_R0019.
DR   EnsemblGenomes-Gn; XfasM23_R0020.
DR   EnsemblGenomes-Gn; XfasM23_R0021.
DR   EnsemblGenomes-Gn; XfasM23_R0022.
DR   EnsemblGenomes-Gn; XfasM23_R0023.
DR   EnsemblGenomes-Gn; XfasM23_R0024.
DR   EnsemblGenomes-Gn; XfasM23_R0025.
DR   EnsemblGenomes-Gn; XfasM23_R0026.
DR   EnsemblGenomes-Gn; XfasM23_R0027.
DR   EnsemblGenomes-Gn; XfasM23_R0028.
DR   EnsemblGenomes-Gn; XfasM23_R0029.
DR   EnsemblGenomes-Gn; XfasM23_R0030.
DR   EnsemblGenomes-Gn; XfasM23_R0031.
DR   EnsemblGenomes-Gn; XfasM23_R0033.
DR   EnsemblGenomes-Gn; XfasM23_R0034.
DR   EnsemblGenomes-Gn; XfasM23_R0035.
DR   EnsemblGenomes-Gn; XfasM23_R0036.
DR   EnsemblGenomes-Gn; XfasM23_R0037.
DR   EnsemblGenomes-Gn; XfasM23_R0038.
DR   EnsemblGenomes-Gn; XfasM23_R0039.
DR   EnsemblGenomes-Gn; XfasM23_R0040.
DR   EnsemblGenomes-Gn; XfasM23_R0041.
DR   EnsemblGenomes-Gn; XfasM23_R0042.
DR   EnsemblGenomes-Gn; XfasM23_R0043.
DR   EnsemblGenomes-Gn; XfasM23_R0044.
DR   EnsemblGenomes-Gn; XfasM23_R0045.
DR   EnsemblGenomes-Gn; XfasM23_R0046.
DR   EnsemblGenomes-Gn; XfasM23_R0047.
DR   EnsemblGenomes-Gn; XfasM23_R0048.
DR   EnsemblGenomes-Gn; XfasM23_R0049.
DR   EnsemblGenomes-Gn; XfasM23_R0050.
DR   EnsemblGenomes-Gn; XfasM23_R0051.
DR   EnsemblGenomes-Gn; XfasM23_R0052.
DR   EnsemblGenomes-Gn; XfasM23_R0053.
DR   EnsemblGenomes-Gn; XfasM23_R0054.
DR   EnsemblGenomes-Gn; XfasM23_R0055.
DR   EnsemblGenomes-Gn; XfasM23_R0056.
DR   EnsemblGenomes-Gn; XfasM23_R0057.
DR   EnsemblGenomes-Gn; XfasM23_R0058.
DR   EnsemblGenomes-Gn; XfasM23_R0059.
DR   EnsemblGenomes-Gn; XfasM23_R0060.
DR   EnsemblGenomes-Tr; EBT00001565371.
DR   EnsemblGenomes-Tr; EBT00001565372.
DR   EnsemblGenomes-Tr; EBT00001565373.
DR   EnsemblGenomes-Tr; EBT00001565374.
DR   EnsemblGenomes-Tr; EBT00001565375.
DR   EnsemblGenomes-Tr; EBT00001565376.
DR   EnsemblGenomes-Tr; EBT00001565377.
DR   EnsemblGenomes-Tr; EBT00001565378.
DR   EnsemblGenomes-Tr; EBT00001565379.
DR   EnsemblGenomes-Tr; EBT00001565380.
DR   EnsemblGenomes-Tr; EBT00001565381.
DR   EnsemblGenomes-Tr; EBT00001565382.
DR   EnsemblGenomes-Tr; EBT00001565383.
DR   EnsemblGenomes-Tr; EBT00001565385.
DR   EnsemblGenomes-Tr; EBT00001565387.
DR   EnsemblGenomes-Tr; EBT00001565389.
DR   EnsemblGenomes-Tr; EBT00001565390.
DR   EnsemblGenomes-Tr; EBT00001565392.
DR   EnsemblGenomes-Tr; EBT00001565393.
DR   EnsemblGenomes-Tr; EBT00001565395.
DR   EnsemblGenomes-Tr; EBT00001565397.
DR   EnsemblGenomes-Tr; EBT00001565398.
DR   EnsemblGenomes-Tr; EBT00001565399.
DR   EnsemblGenomes-Tr; EBT00001565400.
DR   EnsemblGenomes-Tr; EBT00001565401.
DR   EnsemblGenomes-Tr; EBT00001565403.
DR   EnsemblGenomes-Tr; EBT00001565404.
DR   EnsemblGenomes-Tr; EBT00001565405.
DR   EnsemblGenomes-Tr; EBT00001565406.
DR   EnsemblGenomes-Tr; EBT00001565407.
DR   EnsemblGenomes-Tr; EBT00001565408.
DR   EnsemblGenomes-Tr; EBT00001565409.
DR   EnsemblGenomes-Tr; EBT00001565410.
DR   EnsemblGenomes-Tr; EBT00001565411.
DR   EnsemblGenomes-Tr; EBT00001565412.
DR   EnsemblGenomes-Tr; EBT00001565413.
DR   EnsemblGenomes-Tr; EBT00001565414.
DR   EnsemblGenomes-Tr; EBT00001565415.
DR   EnsemblGenomes-Tr; EBT00001565416.
DR   EnsemblGenomes-Tr; EBT00001565417.
DR   EnsemblGenomes-Tr; EBT00001565418.
DR   EnsemblGenomes-Tr; EBT00001565419.
DR   EnsemblGenomes-Tr; EBT00001565420.
DR   EnsemblGenomes-Tr; EBT00001565421.
DR   EnsemblGenomes-Tr; EBT00001565422.
DR   EnsemblGenomes-Tr; EBT00001565423.
DR   EnsemblGenomes-Tr; EBT00001565424.
DR   EnsemblGenomes-Tr; EBT00001565425.
DR   EnsemblGenomes-Tr; EBT00001565426.
DR   EnsemblGenomes-Tr; EBT00001565427.
DR   EnsemblGenomes-Tr; EBT00001565428.
DR   EnsemblGenomes-Tr; EBT00001565429.
DR   EnsemblGenomes-Tr; EBT00001565430.
DR   EnsemblGenomes-Tr; EBT00001565431.
DR   EnsemblGenomes-Tr; EBT00001565432.
DR   EnsemblGenomes-Tr; EBT00001565433.
DR   EnsemblGenomes-Tr; EBT00001565434.
DR   EnsemblGenomes-Tr; EBT00001565435.
DR   EnsemblGenomes-Tr; EBT00001565436.
DR   EnsemblGenomes-Tr; EBT00001565437.
DR   EnsemblGenomes-Tr; EBT00001565438.
DR   EnsemblGenomes-Tr; EBT00001565439.
DR   EnsemblGenomes-Tr; EBT00001565440.
DR   EnsemblGenomes-Tr; EBT00001565441.
DR   EnsemblGenomes-Tr; EBT00001565442.
DR   EnsemblGenomes-Tr; EBT00001565443.
DR   EnsemblGenomes-Tr; EBT00001565444.
DR   EnsemblGenomes-Tr; EBT00001565445.
DR   EnsemblGenomes-Tr; EBT00001565446.
DR   EnsemblGenomes-Tr; EBT00001565447.
DR   EnsemblGenomes-Tr; EBT00001565448.
DR   EnsemblGenomes-Tr; EBT00001565449.
DR   EnsemblGenomes-Tr; EBT00001565450.
DR   EnsemblGenomes-Tr; EBT00001565451.
DR   EnsemblGenomes-Tr; EBT00001565452.
DR   EnsemblGenomes-Tr; XfasM23_R0001-1.
DR   EnsemblGenomes-Tr; XfasM23_R0002-1.
DR   EnsemblGenomes-Tr; XfasM23_R0003-1.
DR   EnsemblGenomes-Tr; XfasM23_R0004-1.
DR   EnsemblGenomes-Tr; XfasM23_R0005-1.
DR   EnsemblGenomes-Tr; XfasM23_R0006-1.
DR   EnsemblGenomes-Tr; XfasM23_R0007-1.
DR   EnsemblGenomes-Tr; XfasM23_R0008-1.
DR   EnsemblGenomes-Tr; XfasM23_R0009-1.
DR   EnsemblGenomes-Tr; XfasM23_R0010-1.
DR   EnsemblGenomes-Tr; XfasM23_R0011-1.
DR   EnsemblGenomes-Tr; XfasM23_R0012-1.
DR   EnsemblGenomes-Tr; XfasM23_R0013-1.
DR   EnsemblGenomes-Tr; XfasM23_R0014-1.
DR   EnsemblGenomes-Tr; XfasM23_R0015-1.
DR   EnsemblGenomes-Tr; XfasM23_R0016-1.
DR   EnsemblGenomes-Tr; XfasM23_R0017-1.
DR   EnsemblGenomes-Tr; XfasM23_R0018-1.
DR   EnsemblGenomes-Tr; XfasM23_R0019-1.
DR   EnsemblGenomes-Tr; XfasM23_R0020-1.
DR   EnsemblGenomes-Tr; XfasM23_R0021-1.
DR   EnsemblGenomes-Tr; XfasM23_R0022-1.
DR   EnsemblGenomes-Tr; XfasM23_R0023-1.
DR   EnsemblGenomes-Tr; XfasM23_R0024-1.
DR   EnsemblGenomes-Tr; XfasM23_R0025-1.
DR   EnsemblGenomes-Tr; XfasM23_R0026-1.
DR   EnsemblGenomes-Tr; XfasM23_R0027-1.
DR   EnsemblGenomes-Tr; XfasM23_R0028-1.
DR   EnsemblGenomes-Tr; XfasM23_R0029-1.
DR   EnsemblGenomes-Tr; XfasM23_R0030-1.
DR   EnsemblGenomes-Tr; XfasM23_R0031-1.
DR   EnsemblGenomes-Tr; XfasM23_R0033-1.
DR   EnsemblGenomes-Tr; XfasM23_R0034-1.
DR   EnsemblGenomes-Tr; XfasM23_R0035-1.
DR   EnsemblGenomes-Tr; XfasM23_R0036-1.
DR   EnsemblGenomes-Tr; XfasM23_R0037-1.
DR   EnsemblGenomes-Tr; XfasM23_R0038-1.
DR   EnsemblGenomes-Tr; XfasM23_R0039-1.
DR   EnsemblGenomes-Tr; XfasM23_R0040-1.
DR   EnsemblGenomes-Tr; XfasM23_R0041-1.
DR   EnsemblGenomes-Tr; XfasM23_R0042-1.
DR   EnsemblGenomes-Tr; XfasM23_R0043-1.
DR   EnsemblGenomes-Tr; XfasM23_R0044-1.
DR   EnsemblGenomes-Tr; XfasM23_R0045-1.
DR   EnsemblGenomes-Tr; XfasM23_R0046-1.
DR   EnsemblGenomes-Tr; XfasM23_R0047-1.
DR   EnsemblGenomes-Tr; XfasM23_R0048-1.
DR   EnsemblGenomes-Tr; XfasM23_R0049-1.
DR   EnsemblGenomes-Tr; XfasM23_R0050-1.
DR   EnsemblGenomes-Tr; XfasM23_R0051-1.
DR   EnsemblGenomes-Tr; XfasM23_R0052-1.
DR   EnsemblGenomes-Tr; XfasM23_R0053-1.
DR   EnsemblGenomes-Tr; XfasM23_R0054-1.
DR   EnsemblGenomes-Tr; XfasM23_R0055-1.
DR   EnsemblGenomes-Tr; XfasM23_R0056-1.
DR   EnsemblGenomes-Tr; XfasM23_R0057-1.
DR   EnsemblGenomes-Tr; XfasM23_R0058-1.
DR   EnsemblGenomes-Tr; XfasM23_R0059-1.
DR   EnsemblGenomes-Tr; XfasM23_R0060-1.
DR   EuropePMC; PMC2772435; 19749062.
DR   EuropePMC; PMC2788362; 19958473.
DR   EuropePMC; PMC2937377; 20601474.
DR   EuropePMC; PMC2982844; 21103383.
DR   EuropePMC; PMC3080875; 21533033.
DR   EuropePMC; PMC3294468; 22194287.
DR   EuropePMC; PMC3591940; 23315739.
DR   EuropePMC; PMC3843690; 24312333.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02241; Xoo2.
DR   SILVA-LSU; CP001011.
DR   SILVA-SSU; CP001011.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002280
CC   Source DNA and bacteria available from Jianchi Chen
CC   (Jianchi.Chen@ARS.USDA.GOV)
CC   Contacts: Jianchi Chen (Jianchi.Chen@ARS.USDA.GOV)
CC        Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2535690
FT                   /organism="Xylella fastidiosa M23"
FT                   /strain="M23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:405441"
FT   gene            25..1356
FT                   /locus_tag="XfasM23_0001"
FT   CDS_pept        25..1356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: xcc:XCC0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91459"
FT                   /db_xref="GOA:B2I5U6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5U6"
FT                   /protein_id="ACB91459.1"
FT                   /translation="MTTLMESWSRCLERLETEFPPEDVHTWLRPLQADQRGDSVILYAP
FT                   NTFIIELVEERYLGRLRELLSYFSGIREVVLAIGSRPKTTELTVPVDTTGRLSQTVPFN
FT                   GNLDTHYNFDNFVEGRSNQLARAAAWQAAQKPGDRTHNPLLLYGGTGLGKTHLMFAAGN
FT                   VMRQVNPTYKVMYLRSEQFFSAMIRALQDKSMDQFKRQFHQIDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVNGLEPRLKSRLAWGLSVAIDPPDFETRAAI
FT                   VLAKARERGATIPDEVAFLIAKKMHSNVRDLEGALNTLVARANFTGRAVTIEFSQETLR
FT                   DLLRAQQQTIGIPNIQKIVADYYGLQIKDLLSKRRTRSLARPRQLAMALAKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIKLLMETETKLREDWDKLMRKFSE"
FT   gene            1638..2738
FT                   /locus_tag="XfasM23_0002"
FT   CDS_pept        1638..2738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xac:XAC0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91460"
FT                   /db_xref="GOA:B2I5U7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5U7"
FT                   /protein_id="ACB91460.1"
FT                   /translation="MRFRLQRETFLKPLAHVVNVVERRQTRSILANLLIKVNEDQLSLT
FT                   GTDLEVEMISKTKIEDPESGEITIPARKIYEIVRALPDASQLSVYQSDDKITLQAGRSR
FT                   FTLATLPANDFPSIDKIEVTERIIIAEVLLKELIERTAFAMAQQDVRYYLNGLLFDLRD
FT                   TKLRCVATDGHRLALCETELEQAKDLKRQIILPRKGVMELQRLLEGSDRQIELEIARNH
FT                   IRMKSFDVTFTSKLIDGSFPDYEGVIPIGADREVKVAREVLRDALQRAAILSNEKYRGV
FT                   RIEVSPGQLKINAHNPEQEEAQEEIEAQTIVDGLAIGFNVNYLLDALSSLRGDFVNIQL
FT                   RDSNSSALIRESNSEKSLQVVMPLRL"
FT   gene            3044..4138
FT                   /locus_tag="XfasM23_0003"
FT   CDS_pept        3044..4138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: xcb:XC_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91461"
FT                   /db_xref="GOA:B2I5U9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I5U9"
FT                   /protein_id="ACB91461.1"
FT                   /translation="MHITQLVLRHFRCFDVVDFFPLPGLNFFIGENGSGKTSLLEAVHL
FT                   MGYGRSFRGRVRDGLIRHGSENLEIFVDWQETALINARRRRAGLSHYGQEWIGRLDGQK
FT                   IMHLASLCAALAVITFESSSYQLINSNAELRRRFLDWGLFHVEPDFLDLWRRYTHVLKQ
FT                   RNSLLKQKEELAMLEAWDQKLSEVGEQLTFRRFQYLERLKQRVIPLISRITPNLKIHGF
FT                   NFNHGWRRHELPLIDALFISRERDYQYGYTSLGPHRSDWTPQFSSIPGVHFLSRGQGKL
FT                   ITLMCLLAQAQDFFDQRGEWPILALDDLASELDQKHQWRVLEMLAEIPAQVLITGTEIP
FT                   QGLKPFFSVGAMFHVEHGAITRMF"
FT   gene            4467..4637
FT                   /locus_tag="XfasM23_0004"
FT   CDS_pept        4467..4637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91462"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5V0"
FT                   /protein_id="ACB91462.1"
FT                   /translation="MVAPKVPNFDVSLVRKPAFLGFEKYMDRYIFNFRMEISALMRLNF
FT                   EVIDMEPMKNA"
FT   gene            4634..7078
FT                   /locus_tag="XfasM23_0005"
FT   CDS_pept        4634..7078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xcb:XC_0004 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91463"
FT                   /db_xref="GOA:B2I5V1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5V1"
FT                   /protein_id="ACB91463.1"
FT                   /translation="MTEKQNTSLLSNGGIYDSSKITVLRGLDAVRKRPGMYIGDVHDGT
FT                   GLHHMVFEVVDNSVDEALAGHADSILVKIHIDGSVSVSDNGRGIPVDIHKEEGVSAAEV
FT                   ILTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSERLWLDIWRDGYHYQQEYVLGEPQY
FT                   PLKQLEVSAKRGTTLRFKPAKEIFSDVEFHYENLAKRLRELSFLNSGLKVSLIDERGEG
FT                   RRDDFHYEGGIRSFVEHLAQLKTPLHPNVISVTGEHNGIVVDAALQWTDAYQETMYCFT
FT                   NNIPQKDGGTHLAGFRAALTRTLGNYIEQNGVARQAKITFSGDDMREGMIAVLSVKVPE
FT                   PSFSSQTKEKLVSSDVKPAVEATFGLRLEEFLQENPNEARAIAGKIVDAARAREAARKA
FT                   RDLTRRKGVLDIAGLPGKLADCQEKDPAMSELFIVEGDSAGGSAKQGRNRKNQAVLPLR
FT                   GKILNVERARFDRMLSSAEVGTLITALGTGIGKDEYNPDKLRYHRVIIMTDADVDGSHI
FT                   RTLLLTFFYRQMPELIERGHIYIGLPPLYKLKQGKSELYLKDDIALNVYLANSAVEGAQ
FT                   LLPAEGEPPIEGLALEKLLITYIAAKDTIVRHSHRYDSRLLEALLEFTPLDSTCFQSYS
FT                   DSEHLQSLMALLNQSSLGAPRYILKMQFPDEQHSAALLATRYHMGEELTQVLQLSALET
FT                   GELRPLYEAAKLLHGLIRNGAKIVRGTKSQSIECFGDAQAWLLEEAKKGRQIQRFKGLG
FT                   EMNPEQLWDTTVNPDTRRLLQVCIEDGIAADQIFSTLMGDVVEPRRGFIENNALKVTRL
FT                   DI"
FT   gene            7123..7953
FT                   /locus_tag="XfasM23_0006"
FT   CDS_pept        7123..7953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0006"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: xoo:XOO0005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91464"
FT                   /db_xref="GOA:B2I5U8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5U8"
FT                   /protein_id="ACB91464.1"
FT                   /translation="MSNLFLSDSVPTNRVARLSAVLIPFSIDVLVSCITIAFISIGAML
FT                   LWEIASGVMLATQAQQRNQRLDSQSVAILIGQPGVLVQMLVALIAIGGTALLLYFWRLP
FT                   ATVDERHHARLALRRMSTWNCIIGVAVLTFFFSTLSGLFARKLGISIVPSNQALILEGL
FT                   ARWPLFVVLFVVFLVPAYEELLFRRVFLGRFLIAGRPILGITLSGLAFAFLHEIPGLSS
FT                   NGALAIIYLWLIYMILGMAFGWVYWRTGSLWASITTHSFNNIGALIGLYFFGMY"
FT   gene            8018..8833
FT                   /locus_tag="XfasM23_0007"
FT   CDS_pept        8018..8833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0007"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: xoo:XOO0006
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91465"
FT                   /db_xref="GOA:B2I638"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2I638"
FT                   /protein_id="ACB91465.1"
FT                   /translation="MKKLSFFLIATLSLGACSTATSPTGRHQVFSGVSQQQLNQLGEQA
FT                   FVEIKAKEKISGNVRQNAYVRCVVDALVTELPLQWRHVKWETVLFLNEEPNAFALPGGK
FT                   VGVNTGIFRAAKNQEQLAAVLGHEIGHVVSRHHEERITWQLGTQAGLGLLGVLAGTAYG
FT                   DSAATAVNQIGGLTAQAAFLLPGSRTQEREADIVGQRLMAQAGFDPIQAVYLWKNMLAI
FT                   AGQRPPQWLSTHPDPTNRIRQLEQQSAVLASVYAQARDAGRVPHCSPAA"
FT   sig_peptide     8018..8080
FT                   /locus_tag="XfasM23_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.630 at
FT                   residue 21"
FT   gene            8937..10130
FT                   /locus_tag="XfasM23_0008"
FT   CDS_pept        8937..10130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: xom:XOO_0007
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91466"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2I639"
FT                   /protein_id="ACB91466.1"
FT                   /translation="MKRLNYKKDLLSLLIPIFLGGGIAVPAAALQSDNTSLSRYAAKGG
FT                   NSENLYPQATRQEPKIKNSSRLAGNLQKLIDAYNKGQDYLAVRAQADGILANTSANEAD
FT                   KSLAAQLGAQAAYKLEDVVAAQHYLNQAIALNGLDNNNHYQSMLLLAQFQLQEGKYSEG
FT                   LATLDKYLAETKSQRAEDLILKGQALYQAGKYSEAIPVIKQAITASSEPKESWEKLLIS
FT                   TYFEVGQTGEAIAMAEALAAKAPNDKKAQIDLASLYMQADQMGKAAVVLDQLRTVGKLT
FT                   EEREYKQLYSIYANTYNKEKDVINVINEGMSRGILKPDYQTYLALAQSYYYTDHITQAI
FT                   ENWKKAAPLSNDGETYLNLAKVLFQHGRLAEAQQAAQQALSKGIKKPEEAKKMINIK"
FT   sig_peptide     8937..9026
FT                   /locus_tag="XfasM23_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.779 at
FT                   residue 30"
FT   gene            10574..11239
FT                   /locus_tag="XfasM23_0009"
FT   CDS_pept        10574..11239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0009"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: xcb:XC_0008 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91467"
FT                   /db_xref="GOA:B2I640"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2I640"
FT                   /protein_id="ACB91467.1"
FT                   /translation="MSEELIVHRYEQDDVSDALNWPRILGIAFVIALHLAAFMLLLIPA
FT                   GSLKAPPEKQRLAAVTIVDSPPPPPPPPPPQEEKKPAPPIKTLAPPRPAPVPPPPQPPV
FT                   VDVPQPRPSDVVVPPAPPAPPTPPSDISASVDISSKKMNPPKYPPTALRAGIQGEVVLI
FT                   IDVDADGNVTNVSVEKSSRNRDLDRAAIDAASKWKFNPSVINGKKSAGRVRVPVNFSL"
FT   gene            11335..12099
FT                   /locus_tag="XfasM23_0010"
FT   CDS_pept        11335..12099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0010"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   xom:XOO_0009 biopolymer transport ExbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91468"
FT                   /db_xref="GOA:B2I641"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B2I641"
FT                   /protein_id="ACB91468.1"
FT                   /translation="MLQDLFIVATAGGSNPSNALSKMGVWHLIGEMTASPAEFAVSWAV
FT                   LIILVTMSSLSWYWTVINILRALRLKGAGYLVINAFWKAKTPQEAISAMEKQSASEPFS
FT                   KIALDASQAAAHHQRTEGGNAMGLGERLSLSEFVDRALRQAVTRESSKLQSGMTLLATV
FT                   GATAPFVGLLGTVWGIYNALITIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAF
FT                   NFFSKINSSTIAKFDTFAHDLHDFFATGSRVR"
FT   sig_peptide     11335..11394
FT                   /locus_tag="XfasM23_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.694) with cleavage site probability 0.648 at
FT                   residue 20"
FT   gene            12156..12566
FT                   /locus_tag="XfasM23_0011"
FT   CDS_pept        12156..12566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0011"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xcb:XC_0010 biopolymer transport ExbD1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91469"
FT                   /db_xref="GOA:B2I642"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2I642"
FT                   /protein_id="ACB91469.1"
FT                   /translation="MAFSNGNSNGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPQANLVNKNNEEKRSNPITLAVKEDGSLYWNDIQISESELEQRFSLAAQQTPLNLRGD
FT                   RTTKMSKISKIIKVAQGQGIMDIGFIATKEKE"
FT   gene            12573..12983
FT                   /locus_tag="XfasM23_0012"
FT   CDS_pept        12573..12983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0012"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xcb:XC_0011 biopolymer transport ExbD2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91470"
FT                   /db_xref="GOA:B2I643"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2I643"
FT                   /protein_id="ACB91470.1"
FT                   /translation="MAFSSGSNRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPMDHEPPPPIQLKIDASNQIYWNNTLVAVSQLQQRMEEVVQKDPTNQPQL
FT                   QIDANPDSEYEVIAKVLAAAKNADMKKIGFHE"
FT   gene            13701..16088
FT                   /locus_tag="XfasM23_0013"
FT   CDS_pept        13701..16088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0013"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; KEGG: xac:XAC4106 dipeptidyl peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91471"
FT                   /db_xref="GOA:B2I644"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:B2I644"
FT                   /protein_id="ACB91471.1"
FT                   /translation="MAALIMSRLLFLPLFLLASSVFAQTPSAPLTVEQIMANPDWIGPG
FT                   IRTAWWKWNSKEVQYELKRENSPVHEIYRQPLRSNTSQVVSNGLLADVDAPHPVYDQQR
FT                   QRMLFVRHGDIFLRDLRKGVLIQLTRSNQSKDRPQFATDGSVIWRAGNDWYHWIPQGGV
FT                   AQLTDIHVGHDPDATPKNDPLRDRQLERLATLRNDRAERQALKQQEHIWRAADATRATA
FT                   PVYLDEDVSMVDSSLSPDARHLLLVTKAKNIDEGQIGKIPHYVTESGYEEFQDVRTRVG
FT                   RNMPAPHTLWLIDLKDGTARQLSFSSLPGINEDPLAALRKANRKDPFKGERPVRIETNA
FT                   ESNVPAIHWTQDGRNVAVDIRSIDNKDRWIAAVDLKQATLNVRHRLHDGAWINWDFNDF
FT                   GWLPDNRTLWLLSEESGYSHLYTIEETGTPKQRTFGHWEVSAPRLSADGSSVYFVCNPT
FT                   WPGGYEVCKLDLDSGYFDTLTALQGVEDFDLSPDGRQILVLYSGSYLPPQLAVISTNGG
FT                   QARVLTDTRTSTFKAKQWIQPEYLQIPSKHGAGVIWGKYYGPASLQPEKRYPIVMFVHG
FT                   AGYLQNVSARYTSYFREQMFHTLLVQKGYIVLDLDYRASAGHGRDWRTAIYRNMGHPEL
FT                   EDYLDGLYWLIAHKQGDQRRVGIYGGSYGGFMTYMAMFRAPGTFKAGAALRPVGDWMQY
FT                   NHEYTSNILNTPELDPDAYQRSSAINYAEALQGHLLILHGMIDDNVFFKDSVDMVQKLI
FT                   ELRKDNWEIVPYPLERHSFTHPDAWVDEYKRILKLFETQLKQ"
FT   sig_peptide     13701..13772
FT                   /locus_tag="XfasM23_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            16143..16685
FT                   /locus_tag="XfasM23_0014"
FT   CDS_pept        16143..16685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91472"
FT                   /db_xref="GOA:B2I645"
FT                   /db_xref="UniProtKB/TrEMBL:B2I645"
FT                   /protein_id="ACB91472.1"
FT                   /translation="MSIPSSARTFVKVIASISLCLGALSVLTSLLSIVRLELFPDQERG
FT                   TLQGLLGVPIPPRFSWVLRDTLELSLANGALSLLFICVGCGLLYQREWARRGIMALLLI
FT                   VTLVNFSVLPLMGVLFDTVMTLLTPEMIVALETTTLLHQARWTFLGFGVVVAIAVAVLN
FT                   GWMIWRFRAPEIRAQFH"
FT   sig_peptide     16143..16229
FT                   /locus_tag="XfasM23_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.709 at
FT                   residue 29"
FT   gene            16837..17832
FT                   /locus_tag="XfasM23_0015"
FT   CDS_pept        16837..17832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0015"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   xac:XAC4109 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91473"
FT                   /db_xref="GOA:B2I646"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:B2I646"
FT                   /protein_id="ACB91473.1"
FT                   /translation="MTLQTSVHPLCCVSGATFSFLSLQIAMSHFDRVRDYLTALQDRIC
FT                   NVVETIDGQSHFHQDHWQRTEGGGGRTRLLRDGAVFEQAAIGFSDVCGTHLPPSASVRR
FT                   PELAGANWRACGVSLVFHPKNPFVPTTHLNVRYFRAEREGKQVAAWFGGGFDLTPFYPF
FT                   DEDVVHWHTVARDLCAPFGDERYAAHKRWCDEYFVLRHRNETRGVGGLFFDDLDKDFER
FT                   DFDYQRAVGDGFLDAYFPIVTRRHDTPYGDRERAFQLYRRGRYVEFNLLFDRGTLFGLQ
FT                   SGGRAESILISLPPLVRWEYGYHPLPGSAEARLADYLLPRDWLEESRICE"
FT   gene            complement(20625..20701)
FT                   /locus_tag="XfasM23_R0001"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(20625..20701)
FT                   /locus_tag="XfasM23_R0001"
FT                   /product="tRNA-Met"
FT   gene            20736..20909
FT                   /locus_tag="XfasM23_0016"
FT   CDS_pept        20736..20909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91474"
FT                   /db_xref="UniProtKB/TrEMBL:B2I647"
FT                   /protein_id="ACB91474.1"
FT                   /translation="MNSTSLAILTNGVTVFSIFGRYSSVVVHVVIQGSYCPGVIRHESV
FT                   AKVCCTYHDGMS"
FT   gene            complement(21500..22594)
FT                   /locus_tag="XfasM23_0017"
FT   CDS_pept        complement(21500..22594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0017"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: xcb:XC_0548 phospho-2-dehydro-3-heoxyheptonate
FT                   aldolase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91475"
FT                   /db_xref="GOA:B2I648"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2I648"
FT                   /protein_id="ACB91475.1"
FT                   /translation="MPPFTDDLRIRKIEPLTPPNKLLLQLPCDEQASLTVATSRNALHD
FT                   ILHGHNDRLAVVIGPCSIHDPIAAIDYSQRLRPLREMYKDALEIVMRVYFQKPRTTIGW
FT                   KGLVNDPDLDGSFQINKGLHIARNLLRDINHLGLPAGVEFLDTISPQYLADLVAWGAIG
FT                   ARTTESQIHREMASGLSCPIGFKNSTSGDVKIAADAIKAASHPHHFLSVTKTGVAAVVA
FT                   TQGNPDCHVILRGGKVPNYDAINVEAASQTLLKSKLPVRLMIDASHANSGKNPNNQPKV
FT                   IENIVEQLKAGERRIIGVMIESHIVGGRQELVLGNTLNYGQSITDACIDWDTSVAMLEQ
FT                   LAQAVRVRQTLPTTTTANKTSKTQ"
FT   gene            23221..23409
FT                   /locus_tag="XfasM23_0018"
FT   CDS_pept        23221..23409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91476"
FT                   /db_xref="UniProtKB/TrEMBL:B2I649"
FT                   /protein_id="ACB91476.1"
FT                   /translation="MWSNVRKSDSIFHGNIYSDSDQSKCIEVTGLLFEQQLMLQLAQDQ
FT                   ISIQQQSDCAAAHAVLT"
FT   gene            23753..24328
FT                   /locus_tag="XfasM23_0019"
FT   CDS_pept        23753..24328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0019"
FT                   /product="pre-pilin like leader sequence"
FT                   /note="KEGG: xac:XAC2669 pre-pilin like leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91477"
FT                   /db_xref="GOA:B2I650"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B2I650"
FT                   /protein_id="ACB91477.1"
FT                   /translation="MYLNMSQWKLTPHAPSYGFSTVELMVTIAILAILAGLAYPSFMNL
FT                   INGERLTSSANELVASLQLARTEAIRLGSPVTVCRSDDGRTCRTGGPWQRWVTVAKGRN
FT                   NIIRVNDAIPNVTVQGSPRITSLSDQIVFRPDGLARDVSGALLTAQLSLCMPNTRMANN
FT                   LRFVSINGGSRIRVSPGATAPCSQPNDE"
FT   gene            24338..24817
FT                   /locus_tag="XfasM23_0020"
FT   CDS_pept        24338..24817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0020"
FT                   /product="type IV pilus modification protein PilV"
FT                   /note="TIGRFAM: type IV pilus modification protein PilV;
FT                   KEGG: xac:XAC2668 pre-pilin leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91478"
FT                   /db_xref="GOA:B2I651"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:B2I651"
FT                   /protein_id="ACB91478.1"
FT                   /translation="MSIASKKAVAGVSLIEVLISVFILAVGMLGVAAMQVMALRNNDSA
FT                   LQRSHAVIQSYAILEAMRANRSEAIKGSYNTNGMVCTAPQANSLVDVDRRDWISNLKAA
FT                   LGNSERTCGSISCDAANTCTIQVQWDETRASDKRSPAGQLVSSTQTQIFEVRSKL"
FT   gene            24814..25764
FT                   /locus_tag="XfasM23_0021"
FT   CDS_pept        24814..25764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91479"
FT                   /db_xref="GOA:B2I652"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:B2I652"
FT                   /protein_id="ACB91479.1"
FT                   /translation="MNRRFALQRLQRGFNLIELMITLVLGLLVVLAAISMFISSRRLYT
FT                   TTENMSRLQESARVAFELMARDLREAGGNACDNTLPVVNVLRDSATEWSRNWNVPLIGF
FT                   DGGTLTQGVRGTDAIRILSAGTSGGTVKSHDPVNNTMTLYTQAADLHTNGIMMVCDPQQ
FT                   LSIFQASNVAGTTVSYGNGALNSCTHFGRLPSVCNANPPNYQHQANSIITELRAVQWYV
FT                   RTNERGGTSLFQEIRGPNGAIALGEVAESISAMQITYLLRGATSYVSAAQVSEWKNVIA
FT                   VRVALTIQTTDRVGVDNNVVSRTLTSVTSLRNRNL"
FT   sig_peptide     24814..24951
FT                   /locus_tag="XfasM23_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.402 at
FT                   residue 46"
FT   gene            25761..26348
FT                   /locus_tag="XfasM23_0022"
FT   CDS_pept        25761..26348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0022"
FT                   /product="PilX protein"
FT                   /note="KEGG: xac:XAC2666 PilX protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91480"
FT                   /db_xref="GOA:B2I653"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:B2I653"
FT                   /protein_id="ACB91480.1"
FT                   /translation="MRMTHLGPYRQRGISLIVILLLLLVMTLIGLAVLRTTLLQERMSA
FT                   NLRDRSLSFQAAEAALRDAEEFINTENAKGKVAGFNCTAAGSQCPAIPENTYTGNLSSG
FT                   CSSGAENCWVNATGSQAVTRKIGQYYIQYLGERAGVNQEPLGAGSSASQSQYGAAEEIS
FT                   AEKYYRIIARSSDPSSNDERAFVVLQTAVIIN"
FT   sig_peptide     25761..25859
FT                   /locus_tag="XfasM23_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.849 at
FT                   residue 33"
FT   gene            26372..30016
FT                   /locus_tag="XfasM23_0023"
FT   CDS_pept        26372..30016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0023"
FT                   /product="pilus tip-associated protein"
FT                   /note="KEGG: mpt:Mpe_A3408 pilus tip-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91481"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B2I654"
FT                   /protein_id="ACB91481.1"
FT                   /translation="MKKTVFNPALNRAAAILIGTLVGISGVVHASVDISSSPLHGGKDV
FT                   PGNLAILASVEFPTLISVANLADTYTPGVRYVGYFDSNKCYKYHYSSRELDRYFYPVAS
FT                   PRPQANYGCNTTGGVWAGNFLNWAATQTIDPFRSALTGGYRVRDTVSETILEKAVMDRD
FT                   SQENFPRRNVAGRNVLATLVPTQWNNFRIRIDGLGNRMRFTQFSSLWTDPLNTEGQPYD
FT                   SSRHPLNRNDRGVYEVSVRVKVCDPSAGLESNCVAYPRGSYKPEGLIQEYSKRIRYSVF
FT                   GYKNDHSYLIDGGVLRARQKFVGPQTHYPEQGKKTNSHAEWDPQTGILYDNPDPEDAAA
FT                   TTRRVGRTIANSGVINYLNKSGQMDTGRISKIYDPVSELYYTAYRYFKRLGNVPEYSVL
FT                   TGSVNEKYQQADAFPVITDWDDPIRYACQSNVVLGIGDTHTNQDKNLPGNTNTMEEPSK
FT                   PQTVRNDRSIDVVKRMAQIFRMEGMRQQDAMTSAVAPKFNFHRYNSAYIAALAYDAHTK
FT                   DMRPDLEGDQLLTTHWVDVVEAGDYKIPISTNQYWLAAKYGGFQVPAGYDPDKTVNPLS
FT                   EATWWTNGEYVNNDLKANAKRADNFYVAADAEKMVASLKHAFSRIVAEIKGAGTGLSSN
FT                   SARLETGAVTYQAQFFSGTWRGDLIAYHVDKVTGALTPFWNANFPAWEQRVIKFANATT
FT                   LQDFTKKNLGQTALASASAQQINYLRGDRSQEGNVPGKLRIRSGIMGDIVNSQPLYVGA
FT                   PNGRLYTTANFTGASAYAAFAAQQANRVPVVYVGANDGMLHAFDANTGKEIFAFVPRAA
FT                   MPKLLEYTDQNYGHQYYVDGELTAADIYDTKLGWRSVLVGTLGRGGKGLFALDVTDPSN
FT                   IRLLWDKTSADIGGLGNTLSKPMIAQTSDGTWSVLLGNGPNSTADNAQLIVMNLLTGHA
FT                   AQVPVSKTSNNGLSGVFPWSSQSNGITDRVYAGDLLGTLWRFTFSDNAWKVAPLFTATY
FT                   QGKAQPISATPLGAIERSTGRMWIFFGTGRALSSHDMDNKEVQSWYGLIDQGTTIPGRT
FT                   RLSQVQIVDEGVVNGYAVRTVSDPKNIGTDGWYMDLISPKSGKQGERMIVSNMFRGAAL
FT                   IGTTRIPDNSDICKLSGSGFVMAINPFTGGRLGQWFFDLNTGGGSGGALNGNPVSGVGV
FT                   SSAPNSPVFTGNIMQIGADDGTVTSLKTPSSGGLNINRVSWREILRTE"
FT   sig_peptide     26372..26464
FT                   /locus_tag="XfasM23_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            30019..30438
FT                   /locus_tag="XfasM23_0024"
FT   CDS_pept        30019..30438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0024"
FT                   /product="PilE protein"
FT                   /note="KEGG: xac:XAC2664 PilE protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91482"
FT                   /db_xref="GOA:B2I655"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:B2I655"
FT                   /protein_id="ACB91482.1"
FT                   /translation="MFVNDVTSMIKNKKQNGFTLIEVMIVVVIVAILAAVAMTSYQGSI
FT                   LRTRRSAAQACLQQQAQFIERYYTTHMTYLGVETSAPTCDPSANLDNFYRFTVTAQAST
FT                   FMLTADPLGAQAGDHCGRLTLSNTGERTPRVDGCW"
FT   gene            complement(30869..31603)
FT                   /locus_tag="XfasM23_0025"
FT   CDS_pept        complement(30869..31603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0025"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: xac:XAC4276 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91483"
FT                   /db_xref="GOA:B2I656"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I656"
FT                   /protein_id="ACB91483.1"
FT                   /translation="MMNHTPLLLGIRERLIFALDVPSRTQALEWIDQLGDAISFYKIGM
FT                   ELLASGEYFQVLDDLASRGKRVFVDLKFFDIPATVAGVIRRLSQWPISYCTIHGWHAPM
FT                   MQAATEANTSNMHLLAVTVLTSMTREDLAKMGINREPVDVVVERALAAHMAGMSGVIAS
FT                   GQEAAAIRHAIGSGFSIVCPGIRTNHVPHNDQQRTIGIKAAFANGADAIVVGRPIRMAQ
FT                   DPQAAAEAMQTEIMTALTEPST"
FT   gene            32727..33929
FT                   /locus_tag="XfasM23_0026"
FT   CDS_pept        32727..33929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0026"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xcb:XC_0100 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91484"
FT                   /db_xref="GOA:B2I657"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2I657"
FT                   /protein_id="ACB91484.1"
FT                   /translation="MPLFTDVELVPGDPILSLNDAYNADTRTNKVNLGIGIYCDESGCI
FT                   PLLRAVQQVEEQLAKHPKPRGYLPIDGLPAYIKATQQLLFGVDSLLLTAGRVATSQTVG
FT                   GSGALRVAAEVLKQVLPHATVAISRPSWENHRALFTAAGFKIEDYTYFDTLGHAVDFTG
FT                   MVADLAKLQPKTVVLLHGCCHNPTGADLSRDQWKQLVALFQERQLLPCIDLAYQGFNQG
FT                   IDADAYAIRLLAEEGISNYVVANSYSKSFSLYGERVGGLSIVASNTEQAQAIQSQVKRI
FT                   IRTIYSSPPAHGAYLVAGVLNSHELRTLWEQELTQMRERIHGLRAGLVARLKALGAPEF
FT                   DFIQRQAGMFSYSGLSKIQVDRLRDEFGIYAVSSGRICVAALSQHKLEYVAQAVVKVHQ
FT                   G"
FT   gene            complement(34813..35217)
FT                   /locus_tag="XfasM23_0027"
FT   CDS_pept        complement(34813..35217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0027"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: xcb:XC_1009 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91485"
FT                   /db_xref="GOA:B2I658"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I658"
FT                   /protein_id="ACB91485.1"
FT                   /translation="MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLI
FT                   GVMVGGIDFSKLSLTLKAATVDTAGKEVPAVVIGYGDFINTILQFIIIAFAIFIIVKMI
FT                   NKVINKQPLPPETPSEDVLLLREIRDSLKK"
FT   gene            36187..37446
FT                   /locus_tag="XfasM23_0028"
FT   CDS_pept        36187..37446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0028"
FT                   /product="protein of unknown function DUF1504"
FT                   /note="PFAM: protein of unknown function DUF1504; KEGG:
FT                   net:Neut_1315 protein of unknown function DUF1504"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91486"
FT                   /db_xref="GOA:B2I659"
FT                   /db_xref="InterPro:IPR009978"
FT                   /db_xref="UniProtKB/TrEMBL:B2I659"
FT                   /protein_id="ACB91486.1"
FT                   /translation="MTLTAIQLIGALLFAVAILHTFATKFFERLSHTHPTHAGLWHLLG
FT                   EVEVVFGFWALVLVVAMCVTDGAQAAIQYIDSRNFTEPMFVFAIMVVAGTRPILHTVLA
FT                   GVHLLARWVPLPGRMGFYFTVLTFIPLLGSFITEPAAMTLAALMLSQGVFANKIPPYLK
FT                   YATLGVLLVNISIGGTLTAFGAPPVLMVAAKWQWDNSFMLQTFGWKAVLAIFSNALGAT
FT                   LLLRNVLRHLPETQDNAAGEAVPVILRVIHLLLLIGIVWFAHYPVVFIGLFLFFLGVAH
FT                   AYQGYQDRLILREGLLVALFLAGLVILGGQQQWWLQPVLLGMTSDQVFFGAAILTAFTD
FT                   NAALTYLGSLVAGLSDEFKYALVAGAVTGGGLTIMANAPNPAGIAILRVHFKGASVHPL
FT                   GLLLAAVPPTVIAALAFRYL"
FT   gene            37629..38510
FT                   /locus_tag="XfasM23_0029"
FT   CDS_pept        37629..38510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0029"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   xac:XAC2856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91487"
FT                   /db_xref="GOA:B2I660"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2I660"
FT                   /protein_id="ACB91487.1"
FT                   /translation="MNYSHAFHAGNHADVLKHIVLLALLDGLVRKETPFFVLDSHAGRG
FT                   RYLLSAGESRNTREAESGVMRLIARPQRLEVIKRYVDVVQADNVSQTRAASTPMHISRY
FT                   PGSSLLAAQVCRAQDRMVFCELHPKEAAALNALFVHDPRVRVHAGDGYAAVRAFLPPKV
FT                   GTQRIGRGLVFIDPPYEAQDAEYPLVLGALRETLTRWPQAICAVWYPIKQRRRLQPFFR
FT                   KAVGLPVRSVLIAELLVRLDDSPLRLNGSGMLLLNVPWQFDQLLAPALPVLKTQLGESG
FT                   ARTRLEWLKVPQ"
FT   gene            39107..39646
FT                   /locus_tag="XfasM23_0030"
FT   CDS_pept        39107..39646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0030"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   xcv:XCV3017 N-acetyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91488"
FT                   /db_xref="GOA:B2I661"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2I661"
FT                   /protein_id="ACB91488.1"
FT                   /translation="MSVRNRMPPWHENFKLPNGHVLLLRPVRSEDVEPLQGVFALMGPQ
FT                   EIRERFAPSATGSSERFQQLTNPNAKREIVLVAAEQLPPGEAMIAALARASIVPNSRHA
FT                   EYIILVSSFVSGQGLGRQLLRKLVKWARGKYLDHLYGDILERNRPMLELAESLGFQRES
FT                   HPESPDLVRMTLKLYG"
FT   gene            39714..43301
FT                   /locus_tag="XfasM23_0031"
FT   CDS_pept        39714..43301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0031"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: xac:XAC2858 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: helicase domain protein; transcription factor CarD;
FT                   TRCF domain protein; type III restriction protein res
FT                   subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91489"
FT                   /db_xref="GOA:B2I662"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2I662"
FT                   /protein_id="ACB91489.1"
FT                   /translation="MSPSSFPSPLLPRAGQLRAFWRAPVSPTALAWHIACAAQAHRGPL
FT                   LLVTHDNHSAHQIEVDLQTLLAHCSGLPVIGFPDWETLPYDQFSPDPNIVSQRLATLHR
FT                   LPSLARGIVVVPVQTLMQQLAPLSYIVGGSFDFKVGQRLILDAEKQRLERAGYRNVPQV
FT                   MDPGDFTVRGGLLDVYPMGTDVPLRIELLDEEIDSIRTFDPESQRSLNQVDVIHMLPGR
FT                   EVPLDPAVLERVLVRLRERFDLDTRRSALYQDLKAGLAPSGIEYYLPLFFESGRGGKHA
FT                   TATLFDYLSADLLVLTAPGVSNAADAFWGQTMQRYEQRRHDIERPLLPPQELYQSPDAL
FT                   RERLNRLPRIEVWSAEHAHIDKAEVLDEQPLPVATKDVSVGQALRTFLADYAGRVLIAA
FT                   TSPGRREVLLELLATADLQPEVLPDFRSFFLSAAEVSDLGEANRDSGNGVSGSNDADAA
FT                   AFHVIASQGGSLPTFAITVAPLEDGFSLSVPPIAVLTERQLFPERVNPVRRSRRVGREP
FT                   EAIIRDLGELSEGAPIVHEDHGVGRYRKLITMNVSGMPGEFVEIEYAKGDRLYVPVAQL
FT                   HLISRYSGASPETAPLHSLGGEQWSKAKRKAAEKVRDVAAELLEIQARRQARAGLALRI
FT                   DRTMYEPFAAGFPFEETPDQLAAIETTLRDLQSSQPMDRVVCGDVGFGKTEVAVRAAFA
FT                   AASAGKQVAVLVPTTLLAEQHYRNFRDRFADYPIRVEVLSRFKSTKEIKAELQKVSEGT
FT                   MDVIVGTHRLLQPDVKFKDLGLVIVDEEQRFGVRQKEALKSLRANVHLLTLTATPIPRT
FT                   LNMAMAGLRDLSIIATPPLNRLAVQTFITPWDNALLHEAFQRELARGGQLYFLHNDVES
FT                   IGRMQRDLAQLVPEARIGIAHGQMPERELERVMLDFQKQHFNVLLSTTIIESGIDIPNA
FT                   NTIIINRADRFGLAQLHQLRGRVGRSHHRAYAYLVVPDRRSMTADAEKRLEAIASMDEL
FT                   GAGFTLATHDLEIRGAGELLGEDQSGQMAEVGFSLYTELLERAVRSIKQGKLPDLDAGQ
FT                   EERGAEVDLHIPTLIPEDYLPDVHTRLTLYKRISTARDSNALRELNVEMIDRFGVLPET
FT                   AKHLFAIAELKLQATALGISKLELGENGGRIIFGAKPIIDPMAVIQLVQKQSKLYSMEG
FT                   PSKLKLKLPLPEPADRFNAARGLLAALTP"
FT   gene            43923..44369
FT                   /locus_tag="XfasM23_0032"
FT   CDS_pept        43923..44369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0032"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: xcb:XC_0530 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91490"
FT                   /db_xref="GOA:B2I663"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I663"
FT                   /protein_id="ACB91490.1"
FT                   /translation="MAHLLLLHGPNLNLLGTREPEIYGRITLPQIDAALAERAATAGHG
FT                   LSSLQSNAEHVLIERIHATREDGTAFILINPGAFTHTSVALRDALLAVALPFVEIHLSN
FT                   PHTREPFRHHSYLADKALGVVCGFGVDSYRIALEGVIARLGSDV"
FT   gene            44432..44917
FT                   /locus_tag="XfasM23_0033"
FT   CDS_pept        44432..44917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0033"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: xom:XOO_0522 acetyl-CoA
FT                   carboxylase biotin carboxyl carrier protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91491"
FT                   /db_xref="GOA:B2I664"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B2I664"
FT                   /protein_id="ACB91491.1"
FT                   /translation="MDLRKIKKLIDLLEESNLSEIEIKEGEESVRLARTSNAGMNIMAP
FT                   TMPWVPSVANVPAAPAMPMISPTDASTGGIPKDDGALPQGHVLRAPMVGTFYTSPAPDK
FT                   PVFVSVGQTIKQGDTLAIIEAMKMFNPIEADVAGTVVAILGENGQPVEFDQPLFVIR"
FT   gene            44975..46342
FT                   /locus_tag="XfasM23_0034"
FT   CDS_pept        44975..46342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0034"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: xcv:XCV0563
FT                   acetyl-CoA carboxylase biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91492"
FT                   /db_xref="GOA:B2I665"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2I665"
FT                   /protein_id="ACB91492.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAPSAESYLNIPALIAAAEVTDAQAIHPGYGFLSENASFAERVEQSGFIFIG
FT                   PRAETIRLMGDKVQAIHAMKAAGVPCVPGSDGPLGDDIVANVKIAREIGYPVIIKASGG
FT                   GGGRGMRVVHTEAGLEAAIETTQCEAKAAFGNGQVYMEKFLENPRHVEIQVLADGQGNA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEALRNEIGQVCVDACIRIGYRGAGTFEFLFEN
FT                   GRFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGQPLSIKQSDVVLRGHAIECRIN
FT                   AEDAETFLPNPGLITAFHPPGGPGVRMDTHIYSGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMHLALSEMVVDGIKTNIPLQQRIMCDKGFQSGGQNIHYLEKCLAERKNQTIGRT"
FT   gene            complement(46520..48691)
FT                   /locus_tag="XfasM23_0035"
FT   CDS_pept        complement(46520..48691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0035"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: xcb:XC_4115 DNA-dependent helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91493"
FT                   /db_xref="GOA:B2I666"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2I666"
FT                   /protein_id="ACB91493.1"
FT                   /translation="MLDHLNQNQREAVAAAPGHYLILAGAGSGKTRVLTHRIVWLNEVN
FT                   GVPTHSMMAVTFTNKAAGEIQQRIDLQLRHGKRGMWIGTFHSLAHRLLRLHWNDATLPE
FT                   NFQVIDSDDQLRLVKRVIQSLGLNDTLFPPKQAMWWINTQKDEGRRPEHIQPESHDDWI
FT                   ETQRRIYTEYQERCNRAGLVDFSELLLRAHELLRDTPALLTHYRSRFREILIDEFQDTN
FT                   AIQYAFVRVLANDTGHIFAVGDDDQAIYGWRGAKVEHVQHFLKDFPNVQTIRLEQNYRS
FT                   SANILDAANAIIAHNPDRIGKRLWTESGVGESIDLYAAYNEIDEARYIVERARQWVRDG
FT                   GSYGEIAVLYRSNAQSRAFEEVLQSEHIPYRVYGGMRFFERAEIKDALAYLRLLANRSD
FT                   DAAFERVVNTPVRGIGERTLDEVRHLARTQGLALWDAAMACTQSTTLTARARNALASFL
FT                   NLLQQLAVETNQMGLAERIDHMLQRSELRQHWKKEARGSLDAESRQENLDELVSVASRF
FT                   VLPQNDEDTPIMTELDAFLSYACLESGDGQVQAGEEGVQLMTLHSAKGLEFPLVFLVGL
FT                   ENGLFPSARSLDEHGRLEEERRLAYVGITRARHKLILSYAQARRIHGKDNYNVPSRFLR
FT                   EIPQDLLHEVRPTIQVSHQPPLGATQRPAHDERDAAPIKLGVNVIHPTFGCGVVVDYEG
FT                   SGVHTRVQIKFDDAGTKWLVMAYAKLSVV"
FT   gene            49987..51180
FT                   /locus_tag="XfasM23_0036"
FT   CDS_pept        49987..51180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0036"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: globin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: swi:Swit_3173 nitric oxide dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91494"
FT                   /db_xref="GOA:B2I667"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2I667"
FT                   /protein_id="ACB91494.1"
FT                   /translation="MSASFSPHTITLIKSTVPLLAEHGTTIIEAMYHRLFEDPQIEALF
FT                   NQANQKNGTQIHALAGAILAYARNIDNPGVLASAIERISQKHVGYAIHPEHYPHVATAL
FT                   LGAIKQVLGDVATSEVLEAWGEAYWFIANLLKDREAVIREGIMTKNGGWIHWRRFVISK
FT                   RIPESETITSFMLHPEDGGPVVPHQAGQYLTFRFDAAGMPGMKRNYSISCGPNSDHYRI
FT                   TVKREHGTGASAFLHDQAKVGTIIECTPPVGDFFLPSVIERPIVLLSGGVGLTPMVSMM
FT                   EQIAEAYPDAQVWYVHGTQNRETHAMDAHIRALVSRHKHMKATTFYTQRSEADDAEAGF
FT                   ITIDWLRANTPFQKADFYLCGPRPFLRTFVRDLIGAGVPAAQVHYEFFGPMDEEMAA"
FT   gene            53017..53292
FT                   /locus_tag="XfasM23_0037"
FT   CDS_pept        53017..53292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91495"
FT                   /db_xref="GOA:B2I668"
FT                   /db_xref="UniProtKB/TrEMBL:B2I668"
FT                   /protein_id="ACB91495.1"
FT                   /translation="MHWVLLLLAIAAMGVAFFIPQIWLLLVTLFGALGLLLFWTCVQYS
FT                   KEYRHRNHDIRSMVDEVELQRLQELAAVRRLSPVVGGNDDVGGINK"
FT   gene            53289..54071
FT                   /locus_tag="XfasM23_0038"
FT   CDS_pept        53289..54071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0038"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: xcb:XC_0012 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91496"
FT                   /db_xref="GOA:B2I669"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I669"
FT                   /protein_id="ACB91496.1"
FT                   /translation="MSQRTRLSVNVNKIAVLRNSRGHGAPDVIRAASACIDAGAHGITV
FT                   HPRPDARHIRHDDVIRLSALTRARGVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTL
FT                   VPDGDQQITSDHGFDFAREGPGLRPLIDEIKQWGCRVSLFVDVNVTGLADAAIWGVDRI
FT                   ELYTGPYAEMHHAGCSDAVLREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVL
FT                   EVSIGHALISEALYEGLIPTVRRYLDILDSVNPAVSMR"
FT   gene            complement(54566..55600)
FT                   /locus_tag="XfasM23_0039"
FT   CDS_pept        complement(54566..55600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0039"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: xac:XACb0053 partition
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91497"
FT                   /db_xref="GOA:B2I670"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:B2I670"
FT                   /protein_id="ACB91497.1"
FT                   /translation="MSLFGNKIKPTQEHNQLATVAFSGERIEEIDPELIDLEKQMRSKD
FT                   NPGFTIESLMELGNDMKRDGQHEPVILRKNSKKPGRYLMVAGERRWLACKAVDIKLKAV
FT                   IRELTDDQVRRVQRAENIQRENLTQLEIAVALRDDKERLGTLEKVAAEWNKGINWVSER
FT                   INFLEVVETNSLTSQAVTEGITADITAINDLYRLEKVNQTAAKTIIDQAKVDPGINMRK
FT                   TVREKLQNAKSTTNEKNATTDSRMQESKTDFQEGETHLTNISNQEKPTTVASAPLPPDA
FT                   AQLVALAAKQMETLCTEVSALSKILHQRQDVISALGDVLQNVVQAQAALFRTRHVLASL
FT                   ANLK"
FT   gene            complement(56714..57439)
FT                   /locus_tag="XfasM23_0040"
FT   CDS_pept        complement(56714..57439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0040"
FT                   /product="competence protein F"
FT                   /note="KEGG: xcb:XC_0401 competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91498"
FT                   /db_xref="GOA:B2I671"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2I671"
FT                   /protein_id="ACB91498.1"
FT                   /translation="MKDAVNSNHILTDTWCDRLLRWLLPSYCLACNEPGHQGKTLCATC
FT                   QLLLPRMENACLRCAAPLKELEGIHPTCGPCLYDPPPLETAHAAFLYHWPINKLISRFK
FT                   FHQDLECGHLLADNMAMAAQHWPRPQALVPVSLHHGRLLTRGYDQALELARHLGNRLQL
FT                   PCLPALRRVRATIPQSQLNANKRRSNLHNAFIPIHPLPTHVALVDDVMTTGTTLHAAAR
FT                   ALRHTGVTRIDAWICARVP"
FT   gene            57489..58514
FT                   /locus_tag="XfasM23_0041"
FT   CDS_pept        57489..58514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0041"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: xcv:XCV0403 biotin synthase BioB; TIGRFAM:
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91499"
FT                   /db_xref="GOA:B2I672"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I672"
FT                   /protein_id="ACB91499.1"
FT                   /translation="MSSIIRYDWTAEELHALFDLSLPELLYRAASVHRQHFDPAEIQVS
FT                   TLLSVKTGGCPEDCSYCPQAQRYDTGVTAQKLMDVDAVVAKARQAKLAGASRFCMGAAW
FT                   RSPKDRDIPKIASMIREVKALGLETCATLGMLNTCQAQALKDAGLDYYNHNVDTSPDFY
FT                   DSVIHTRQYQDRLDTLAHVRDVGLKTCCGGIVGMGETRQHRVGLLLTLATLPAHPDSVP
FT                   VNLLVQVAGTPLHGTQTLDPFEFVRMIAVARITMPRSMVRLSAGRESMSDELQLLCFMA
FT                   GANSIFYGEKLLTTANPETERDQALFQRLGLRPMHLMENVSNKDQHHGNVHADIACKHV
FT                   V"
FT   gene            58909..59949
FT                   /locus_tag="XfasM23_0042"
FT   CDS_pept        58909..59949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0042"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: xom:XOO_4256 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91500"
FT                   /db_xref="GOA:B2I673"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2I673"
FT                   /protein_id="ACB91500.1"
FT                   /translation="MCFTFRCSFWATIVVALLTACSSAPRSASRLSSVSQSSDISLPPL
FT                   RIGIALGGGAAKGFAHIGVLKMLEANGLAPSVVAGTSAGSVVGALYASGMDSFKIQTKA
FT                   VAMDESNIRDLRFFSGGLVQGQKLQNYVNELVGKRPIEKLNMPFGAIATRLEDGQRTMF
FT                   VRGNVGEAVRASCSIPGVFEPVTIGAYHYVDGGITSPVPVDAVRQLGADFVIAVDISSK
FT                   ATGKNPGGLVGTVNQSISIMGQHLGEAELKRANIVIHPKVLDIGSTDFDQRNAAILEGE
FT                   RATIAVIPEIREKLAQLHQQRIQAARKTANQSAIEAVESYRRCQNTRTRWEKLRGKEKD
FT                   CTKSSL"
FT   sig_peptide     58909..58995
FT                   /locus_tag="XfasM23_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.768 at
FT                   residue 29"
FT   gene            60367..60609
FT                   /locus_tag="XfasM23_0043"
FT   CDS_pept        60367..60609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91501"
FT                   /db_xref="GOA:B2I674"
FT                   /db_xref="UniProtKB/TrEMBL:B2I674"
FT                   /protein_id="ACB91501.1"
FT                   /translation="MSCKEIFKYIVIKQRWLRMFFAKKMGMVISETWCADRYPPIVFIA
FT                   RCVLSYYVGWGCLLRFSVILWPMCYWLGVMIVLVF"
FT   gene            complement(60725..61624)
FT                   /locus_tag="XfasM23_0044"
FT   CDS_pept        complement(60725..61624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0044"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: xcv:XCV0405
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91502"
FT                   /db_xref="GOA:B2I675"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I675"
FT                   /protein_id="ACB91502.1"
FT                   /translation="MAYERFTSAITLLLHWRNRLDPYWKLARGDRPVGFLLLLWPTWWA
FT                   LWLAADGVPPWWTLCVFTTGIWLTRSAGCVINDYTDRWLDPHVERTCTRPLVTGTVSPR
FT                   NALLMFGTLMLIAFGLVLTMNRLTVLLSVAGLFLAMTYPYLKRYTHLPQVYLGIAFGWG
FT                   IPMAFAAIQGKVPTLAWLLYVANILWTTAYDTWYAMVDRDDDIKMGAKSTAILFADLDL
FT                   VVQGVLYTLMLLTLCLVGLRATLSHTYWISLISAVALIGYQFIIARRREPTACFRAFMH
FT                   NNWVGMTIFAGIALATTH"
FT   gene            61736..61812
FT                   /locus_tag="XfasM23_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            61736..61812
FT                   /locus_tag="XfasM23_R0002"
FT                   /product="tRNA-Arg"
FT   gene            65886..67422
FT                   /locus_tag="XfasM23_R0003"
FT   rRNA            65886..67422
FT                   /locus_tag="XfasM23_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            67529..67604
FT                   /locus_tag="XfasM23_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            67529..67604
FT                   /locus_tag="XfasM23_R0004"
FT                   /product="tRNA-Ala"
FT   gene            67618..67694
FT                   /locus_tag="XfasM23_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            67618..67694
FT                   /locus_tag="XfasM23_R0005"
FT                   /product="tRNA-Ile"
FT   gene            67887..70769
FT                   /locus_tag="XfasM23_R0006"
FT   rRNA            67887..70769
FT                   /locus_tag="XfasM23_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            70901..71013
FT                   /locus_tag="XfasM23_R0007"
FT   rRNA            70901..71013
FT                   /locus_tag="XfasM23_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            71119..71934
FT                   /locus_tag="XfasM23_0045"
FT   CDS_pept        71119..71934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0045"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xac:XAC4286 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91503"
FT                   /db_xref="GOA:B2I676"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B2I676"
FT                   /protein_id="ACB91503.1"
FT                   /translation="MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRL
FT                   PGHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPLRPHDHVDIMLNNRRV
FT                   LRFNDPRRFGCLLWQEDGQIHPLLQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQ
FT                   RIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDF
FT                   LSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQG"
FT   gene            complement(72071..72862)
FT                   /locus_tag="XfasM23_0046"
FT   CDS_pept        complement(72071..72862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0046"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   xcb:XC_3049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91504"
FT                   /db_xref="GOA:B2I677"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B2I677"
FT                   /protein_id="ACB91504.1"
FT                   /translation="MLFCELLFNDISRRGEWRIPGLVGLLAHGGYHFLVVLGNAGAVDM
FT                   HFFSVLSMTFFVMSGLTILFSTHVGTVGVVVFPVAGLLLAVYHGYGHSPSPELGWRVEL
FT                   HACLALLGYATLGIAALLAMMLWFRERALRRRNVHHWHGALPPLTELEKLLFRTITFGF
FT                   ILLTFTVFTGFLFVRDFLEQKLLHKSVLSVLSWVIFGGLLIGRWQYGWRGIKAVHWTLT
FT                   AMMFLVLAFFGSKLMIELMLRHQSSSLSPVRHASYGEQGLR"
FT   gene            73003..74370
FT                   /locus_tag="XfasM23_0047"
FT   CDS_pept        73003..74370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0047"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: xcv:XCV1338 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91505"
FT                   /db_xref="GOA:B2I681"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2I681"
FT                   /protein_id="ACB91505.1"
FT                   /translation="MFESLTQRLSGTIERLRGRGRLTEENIREATREVRIALLEADVAL
FT                   SVVQALIERIKIRALGQEVLKSLTPGQALIKVVRDELAAVMGDSASELNLNVPAPAVIL
FT                   LAGLQGAGKTSMVGKLAKYLKEKRKKKVMVVSADVYRPAAIEQLRILSEQVNVLCFPSS
FT                   VEQNPVDIVRAAIADAKKSFVDVLLVDTAGRLAIDQGMMDEIKALHDTLVPVETLFVVD
FT                   SMTGQDAANTAKAFSEALPLTGLILTKTDGDARGGGALSVRYITGRPIKFVGTGEKVDD
FT                   LDVFHPDRAAKRILDMGDVLSLVEQVEQAVDQEKTAKLAAKVAKGKKFNLNDMKEQLEQ
FT                   MQNMGGINSLMDKLPGMGQIPDHLKQQVTGKEVPRMIAIINSMTQKERRNPTLLNGSRR
FT                   VRIAKGSGLQPSDVNKLMKQYQQMEKMMSKLSGGGMKGLMRGMMGAMGGRGRLPFR"
FT   gene            74694..75065
FT                   /locus_tag="XfasM23_0048"
FT   CDS_pept        74694..75065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91506"
FT                   /db_xref="GOA:B2I682"
FT                   /db_xref="UniProtKB/TrEMBL:B2I682"
FT                   /protein_id="ACB91506.1"
FT                   /translation="MTDCSHSTFTTDVIKHQVISLYVLLSELADYLSVSIMATVLLFLA
FT                   GGNYMAVSSQSGIVDHLDRELLFDLPSNICKMAITHVLPLESVPGAMWFHHGDSPAHIP
FT                   LESLAMSTNLVVANDCVAE"
FT   gene            75108..75905
FT                   /locus_tag="XfasM23_0049"
FT   CDS_pept        75108..75905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91507"
FT                   /db_xref="GOA:B2I683"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2I683"
FT                   /protein_id="ACB91507.1"
FT                   /translation="MKLILCNGVQANVTQLAALAAVNYGHFTTLQVRGAAVRGLKLHLC
FT                   RLERATQHLFGSRLDIAALRAQLYNGLAAFCQTDASLRITVYATEFDFRAPLRPVSVDT
FT                   LLVISSPSVLPTVAVRVCSVPFVRSLPDLKHVGTFPQFALRRDALAAGFDDALFVHDDG
FT                   RLLEGTFWNIGFWDGKCVTWPEGPALAGTQQALLRVGLEQLGVPQIVQPLRHADLGRFV
FT                   AAFLCNARGQQPLSAIDDYLYSVSEAPMALLECALATQSWQSL"
FT   gene            complement(76217..77281)
FT                   /locus_tag="XfasM23_0050"
FT   CDS_pept        complement(76217..77281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0050"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: prw:PsycPRwf_1816
FT                   fimbrial protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91508"
FT                   /db_xref="GOA:B2I684"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B2I684"
FT                   /protein_id="ACB91508.1"
FT                   /translation="MSIVNTISVAHISTYQQRTLKIIAACLTMLIAPHVQATCTIKEGI
FT                   VAQNIDFGAGRILIQPSLAIGDRIALLTHNINRVDRYGTCVNNGIMYGAFTRSMTPVSG
FT                   MKNVYATDVAGVGIRLYREAGKVSNFYPHTLNSNNPPGRVTNLSLNEGYFQVELIKTAT
FT                   TTGSGPIASAGPFTTYYADGSGISRPILTSSLSGIGITIVTSTCQVDAGSKNIAVNFGS
FT                   VSSNTFKGLGSKGPERDFTINLICHGGNVTEADQAQISVRIDGTQDSSGQSGVLAITSA
FT                   SDAASNIGIELVDLLTGSERQVVFGQAITLGRTAINASSTLSLPMRARYIQTQTGKVGP
FT                   GAAKGTATFTIEYQ"
FT   gene            complement(77851..78825)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0051"
FT   gene            complement(78879..81584)
FT                   /locus_tag="XfasM23_0052"
FT   CDS_pept        complement(78879..81584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0052"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: prw:PsycPRwf_1817 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91509"
FT                   /db_xref="GOA:B2I685"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B2I685"
FT                   /protein_id="ACB91509.1"
FT                   /translation="MKKQEISQRRKVDSLQLSRVEFVSKSEIDSNRKLMAPELDLTQIR
FT                   GRYFKQRVLVAAIASTCTLMMSRLACAETETDNLGQRMLVAKADNTAPQRVAQTANFNN
FT                   SFLVGQARSVDLGMFSRGNPVIAGLYRADLYVNGQWKGRRDMEFRNTKDDKEAVTCMTL
FT                   AMLDELGIDTSALTDSAADMQACKTIDQWLPDAYARFDVATQRLDVSIPQAAMRRSARG
FT                   YVSPSLWDHGVNAGFIGYAFNWYGGRNANAINSRRRSDSAYLGINSGLNLGDWQFRHNS
FT                   SYSWHSNEGSLWQNISTYAQRAFPNTSSMLTVGDAYTSGELFDSIGFRGISLATDDRML
FT                   PDSLRGYAPIVRGIAQSNARVEIHQNGQLIYSTTVAPGAFVIDDLYPTGYGGDLQVTVY
FT                   ETDGRQQQFSVPYGSVPQMLRAGSQRYSLTAGKIRNNNLSHTPYLLEGTYQRGISNALT
FT                   AYAGSTISQRYIAAIAGAGLSTPVGAFSLDGTVARTKLRNDTFSGTSLRLSYSKLLSPT
FT                   NTNITLAAYRYSTSGFYGLQEAIMAMDYERRGLSTASIYRQRSQLQLTVSQQLGQYGSL
FT                   YLTGSARQYWNQRGNTIQYQGGYNVSYKGVSYGLSALRSQIPSMPSDTQMLFTVSVPLG
FT                   KAYPVIVTSQIGSRDGRYDNSRVSLVGASGKDSALTYGIAASDARNSATMIDGNVQYRS
FT                   RYAALSGSYSHNRNYNQMSLGASGSIVLHSGVATLAPQRGDTMVIIEAPAAKGARVSNI
FT                   SGVRIDSRGYAVVPYVSPYRMNTITLDPEGTDPDVELETSSQLIAPYAGAISKVTFGTR
FT                   KGRALIVNARTPTGKALPFGAQVIDAEGQSVGLVAQGSLIYIRAKDPQGRLTIKWGDQA
FT                   AQQCHLEYQLPANEASTRPSSFTTLEAICR"
FT   gene            complement(81611..82411)
FT                   /locus_tag="XfasM23_0053"
FT   CDS_pept        complement(81611..82411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0053"
FT                   /product="Pili assembly chaperone, N-terminal"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; Pili
FT                   assembly chaperone, C-terminal; KEGG: prw:PsycPRwf_1818
FT                   pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91510"
FT                   /db_xref="GOA:B2I686"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B2I686"
FT                   /protein_id="ACB91510.1"
FT                   /translation="MVPPIMRTQQSKSIWVLALSTCLCAQSAFAGIIIAGTRVVYPAQS
FT                   RDVTVQVTNTGENPALLQTWMDDGDSKQTPDESKAPFLVTPPISRVEPGSGQALRLFFT
FT                   GTTTLPEDRESLFWLNVLEIPPTPLEYSDKNAPTSADKSDSQNYLQLAFRSRIKVFYRP
FT                   SKLKGTANEAPASLSWKVNSNGQLLVSNPTPYHVTLTRTEALDDKGRKETIDKIGVLLT
FT                   PGQEYTFKANKSDGLSSRWKSVSFTYINDYGGIKTLSSNLGSMP"
FT   sig_peptide     complement(82319..82411)
FT                   /locus_tag="XfasM23_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(82483..83037)
FT                   /locus_tag="XfasM23_0054"
FT   CDS_pept        complement(82483..83037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0054"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: prw:PsycPRwf_1819
FT                   fimbrial protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91511"
FT                   /db_xref="GOA:B2I687"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:B2I687"
FT                   /protein_id="ACB91511.1"
FT                   /translation="MKIMKTFALSSIASAAMLFCSSALAADGTITVDGKVTDRTCTING
FT                   GTPNFSVTMPTVSFSSLNGEGKTSARTPFTIELTNCTAGSTVATYFEPGPAVDINTSRL
FT                   INQAPTASAATNVQVQLLGSNGSVIPIKAVGTTGAQDNSQWVAVNASGAASMHYYTEYY
FT                   ATGVSTAGSVVTNIQYTIIYQ"
FT   sig_peptide     complement(82960..83037)
FT                   /locus_tag="XfasM23_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(84645..85133)
FT                   /locus_tag="XfasM23_0055"
FT   CDS_pept        complement(84645..85133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0055"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: xcb:XC_2513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91512"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:B2I688"
FT                   /protein_id="ACB91512.1"
FT                   /translation="MPTDQQIRNLSETLGKQLCMTRERLVTAESCTGGWIAKAITDVPG
FT                   SSAWFECGIVAYSYEAKQALLGVRPETLEIHGAVSRETVVEMVSGALVQSGASIAIAVT
FT                   GIAGPEGGSTGKPIGSVWISWKRRGGYANPQFFKFDGDRDAVRRETVLTALLGLSTLL"
FT   gene            complement(85213..86520)
FT                   /locus_tag="XfasM23_0056"
FT   CDS_pept        complement(85213..86520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0056"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: aav:Aave_1559
FT                   metabolite/H+ symporter, major facilitator superfamily
FT                   (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91513"
FT                   /db_xref="GOA:B2I689"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2I689"
FT                   /protein_id="ACB91513.1"
FT                   /translation="MSDSLSTALSHYTAEEKRHRIFAIIAVSSGNLVEWFDFYVYAFTA
FT                   LYFSSQFFPESNQTAQLLNTAAIFGAGFLMRPIGGWLFGRIADRYGRKRSLLISVMMMC
FT                   GGSMVIATLPTHHMIGAWAAFLLLLARLIQGLSVGGEYGSTATYMSEIALRGRRGFYSS
FT                   FQYVTLIGGQLLAVLTLVVLEALFTEVQMRAWGWRIPFMIGAIAAAVALLLRRTLNETQ
FT                   SEDNRHDTHAGSLSTLFREHRTAFLTVFGYTAGGSLIFYTFTTYMQKFLVNSSGLSKQT
FT                   ASLVMSGALFVYMCIQPLFGLLSDYIGRRNNMLLFGGLGAVCTVPILATLQRIHSPLPA
FT                   FILIVGALSIISFYTSISAIVKAEMFPAKVRALGVGFAYAVGNAIFGGSAEYIALGLKS
FT                   FDLETVFFWYVAAMMAVVFLVSLRLPRQATYLHHDH"
FT   gene            complement(86569..87921)
FT                   /locus_tag="XfasM23_0057"
FT   CDS_pept        complement(86569..87921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0057"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   proten HflX; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   xcb:XC_2514 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91514"
FT                   /db_xref="GOA:B2I690"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B2I690"
FT                   /protein_id="ACB91514.1"
FT                   /translation="MFDRSRKGEYALLIQPLTDHSAEDGALEEFADLTRSAGATVAGSL
FT                   AVRIHRPNPSTLLSSGKLKEIKETADATGADLILINHSLSPVQERNLEKSLERRVIDRT
FT                   GLILDIFAQRACSHEGKLQVELAQLRHLATRLVRGWTHLERQRGGAIGLRGPGETQLET
FT                   DRRLLQKRVEQLQKRLSKVEVQRTQMRRARVRSEVPRIALVGYTNSGKSTLFNALTGAS
FT                   AYTANQLFATLDPKVRRIVLPGSSAMLADTVGFVRHLPHELVAAFRSTLSEAREADLLL
FT                   HVIDAADPLREERIDQVDEVLQAIGAGELPQLLVFNKIDCIEGAEVRQDAQDGIPDQAR
FT                   RERVWLSARHGHGVELLQQILNHRLKIQNVQSELRLPPSEGRLRARLHELKGVREEQTD
FT                   EHGWLLKIDLSLAEIERLAASDYGIPLRALLQDHRDAWTPTLHSKYVSAEY"
FT   gene            complement(87936..88214)
FT                   /locus_tag="XfasM23_0058"
FT   CDS_pept        complement(87936..88214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0058"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: xcb:XC_2515 RNA-binding
FT                   protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91515"
FT                   /db_xref="GOA:B2I691"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I691"
FT                   /protein_id="ACB91515.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVL
FT                   LRNTVSQMVYKHAISTVVPARNVRVGPGGGYVHSGSDTLQINDDEVE"
FT   gene            complement(88318..89271)
FT                   /locus_tag="XfasM23_0059"
FT   CDS_pept        complement(88318..89271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0059"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: xoo:XOO2947 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91516"
FT                   /db_xref="GOA:B2I692"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I692"
FT                   /protein_id="ACB91516.1"
FT                   /translation="MPADTRPAAIVLMGPTASGKSQLAIDIAKRWGGEVISVDSVLVYR
FT                   GLDIGTAKPNAAMRASVPHHLIDICEPWETYSAADFAHDARAAIDMIVRRGALPILTGG
FT                   TGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWAALHTRLAEVDAITAARIHATDPQ
FT                   RIQRALEVYLVSGQSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFRIAQRFKAMLDN
FT                   GLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLYQRSVAATRQL
FT                   AKRQLTWLRGELDALWFDPEHDQSRIEKVMEAFLNR"
FT   gene            complement(89271..90167)
FT                   /locus_tag="XfasM23_0060"
FT   CDS_pept        complement(89271..90167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0060"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: xom:XOO_2800 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91517"
FT                   /db_xref="GOA:B2I693"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B2I693"
FT                   /protein_id="ACB91517.1"
FT                   /translation="MFDTIPTLHCAGRTLRLDSPLVMGILNVTPDSFSDGGLYDSVDAA
FT                   VAHGLRLIAEGADIIDIGGESTRPGAAPVPLEEELLRVVPVIKALAAYDKAVISVDTFK
FT                   PEVMRAAVAAGAGLINDIYALRTPGALKAAAELAVPVILMHMKGEPHSTQTPQYDHVVD
FT                   EVYRFLAERIFAAEIAGIERHRLLIDPGFSFSKTTEHNIALLAALERFTNLGIPLLAGL
FT                   SRKRSLGELTGRQLPIERVYASVAAHLIAVQRGALIVRVHDVAAMVDALKVWQAVSAAA
FT                   APATHTKTTVARSPHDD"
FT   gene            90268..90474
FT                   /locus_tag="XfasM23_0061"
FT   CDS_pept        90268..90474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91518"
FT                   /db_xref="UniProtKB/TrEMBL:B2I694"
FT                   /protein_id="ACB91518.1"
FT                   /translation="MAITVFNILVVCYATGEWIMAQQATGLESNTTVIAGAICGVTVYC
FT                   VSKTQPAQDDSRAGVYDGAVITV"
FT   gene            complement(90476..92413)
FT                   /locus_tag="XfasM23_0062"
FT   CDS_pept        complement(90476..92413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0062"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: xoo:XOO2949 cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase central domain protein; peptidase M41 FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91519"
FT                   /db_xref="GOA:B2I695"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B2I695"
FT                   /protein_id="ACB91519.1"
FT                   /translation="MRMNDLTKNVLLWVVVAVVLMVVFQSFSPRIGGVIGNEPITYTQF
FT                   LNEVDSGRIKSVNYTDESGLTVNAIRFKRTDGSEGLVYGPRDDKLVDVLYSKNIEMTRQ
FT                   KPSTGPGFWSLVLNFLPVILIIGFWVFIMRQMQGGGAKGAMSFGKSRAKLQGDDQIKIT
FT                   FADVAGCDEAKEEVGELVDFLRDPTKFTKLGGKIPRGVLMVGPPGTGKTLLAKAIAGEA
FT                   KVPFFSISGSDFVEMFVGVGASRVRDMFEQAKKHAPCIIFIDEIDAVGRHRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFEGGEGVIVIAATNRPDVLDPALLRPGRFDRQVVVALPDVKGR
FT                   EQILGVHMRKLLLANDVEPLVIARGTPGFSGADLANLCNEAALFAARSNEKEVRMNHFD
FT                   AARDKILMGTERRSMAMSEEEKTLTAYHEAGHAIVGRLVPEHDPVYKVTIIPRGRALGV
FT                   TMYLPEGDKYSINKVAIQSQLCSLYGGRVAEELIFGEDKVTTGASNDIERVTKMARNMV
FT                   TKWGLSDELGPVAYGEEEDEVFLGRSVTQHKNVSDETARKIDEVVRSILDKAYARTKRI
FT                   LADNLDKLHAMSQLLLQYETIDAPQIDAIMEGRAPPPPVGWGKPSDNGSDDDMSKPRPL
FT                   TTIVVPAEQV"
FT   gene            complement(92460..93101)
FT                   /locus_tag="XfasM23_0063"
FT   CDS_pept        complement(92460..93101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0063"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: xac:XAC1731 cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91520"
FT                   /db_xref="GOA:B2I696"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I696"
FT                   /protein_id="ACB91520.1"
FT                   /translation="MSHSKSSQRWLKEHFSDPFVKKAQAEGMRSRAAYKLEEILKRDRI
FT                   LRPNMVVIDLGAAPGGWSQQIRKQMGDSGRVIALDIVKMAPLVGIEFLQGDFRDKAVLS
FT                   QLEIMLKGQPVDLVLSDMAPNKSGIDVMDQPRMMYLAELAMDFADIHVKPGGSFLIKLF
FT                   HGVGSDGYIRQLRHRYKKVAIRKPLASRKRSPEVYILGDGKLTQNEVSCS"
FT   gene            93171..93476
FT                   /locus_tag="XfasM23_0064"
FT   CDS_pept        93171..93476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0064"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   xom:XOO_2803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91521"
FT                   /db_xref="GOA:B2I697"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B2I697"
FT                   /protein_id="ACB91521.1"
FT                   /translation="MTIALTSAQNRFLRGQAHHLKILLQTGDKGLTSAFLSELNDVLER
FT                   HELIKVKVVNDDREMRDMLIATLTAQSGSVLVQRIGHIAILYRCSKGRCQIVLPRA"
FT   gene            93495..93875
FT                   /locus_tag="XfasM23_0065"
FT   CDS_pept        93495..93875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0065"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   xac:XAC1729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91522"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:B2I698"
FT                   /protein_id="ACB91522.1"
FT                   /translation="MLFTQEQPDYIYVLRLADANHARINDRVLYSSFILMPDKLVEDWS
FT                   VAKPEQLQATDLEPVLALAPTLVILSTGNRHIFPPAVVLATCLTRGIGIEIMTNDASAR
FT                   TYNVLASEGRRVALAMILSGER"
FT   gene            complement(94459..96291)
FT                   /locus_tag="XfasM23_0066"
FT   CDS_pept        complement(94459..96291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0066"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: xcv:XCV0357 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91523"
FT                   /db_xref="GOA:B2I699"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I699"
FT                   /protein_id="ACB91523.1"
FT                   /translation="MPEYRSKTSTYGRNMAGARALWRATGMKDDDFQKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIERLGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSV
FT                   EYMANAHCADALVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKTTLADHKLDLV
FT                   DAMVLAADPHASDEEVATVERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVAT
FT                   HSDRKQLFLNAGRTVIELCHRWYGAEDATALPRGIATFAAFENAITLDIAMGGSTNTIL
FT                   HLLAAAQEAEVSFTMQDIDRLSRNVPQLCKVAPNTQKYHIEDVHRAGGIFGILAELARG
FT                   NLLHTDVATVHSKTLGEAIATWDIIGTQDEAVHTFYKAGSAGIPTQVAFSQSTRWPSLD
FT                   TDRTEGCIRDMEHAFSKEGGLAVLYGNIAQDGCVVKTAGVDASIHVFEGSALVYESQEA
FT                   AVKGILSDEVQPGMIVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKQCALFTDGRFSGG
FT                   TSGLSIGHASPEAAAGGAIGLIRDGDRIRIDIPQRAINVLISEEELASRRLEQHAIGWK
FT                   PAQSRTRKVSSALKAYALLATSADKGAVRNKTLL"
FT   gene            97194..97478
FT                   /locus_tag="XfasM23_0067"
FT   CDS_pept        97194..97478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV3596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91524"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A0"
FT                   /protein_id="ACB91524.1"
FT                   /translation="MTPSRAFTNRMTAVLTDKMLSHTLSMISPMSQTATAPANAQKRYT
FT                   VHRRDLPLSCPMPEMALWNSHPRVYLPIEDEPNGEVTCPYCGAVYTLID"
FT   gene            97479..98609
FT                   /locus_tag="XfasM23_0068"
FT   CDS_pept        97479..98609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0068"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   xcb:XC_0824 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91525"
FT                   /db_xref="GOA:B2I6A1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A1"
FT                   /protein_id="ACB91525.1"
FT                   /translation="MFVLPTRRLTVVQLLPALCSGGVERSTLEVAAALVQAGHRAIVVS
FT                   AGGPLVAFLLSIGAEHITLDIGRKSLLTLRHIAALRRLFAQLRPDIVHARSRLPAWLTW
FT                   YALHGLFFSPKPRFVTTVHGLNAPNPYSAVMTYGERVICVSNVVHDYVLRHYRRTDPQR
FT                   LRTIPRGVDLARFRRRPYPDRSARRWARKYVPCLDDNTRLLLMPGRGTRLKGHGDALLL
FT                   LAFLRRVFHYNICLWLPGACQPGRESYLAELEAQARELGVTDCVVFTPPTEHIVEAYAA
FT                   SDLVLQLSRKPEAFGRTVLEALAVGRTVLGWNHGGVGELLTQLQPDGAVSPFDTAVLQR
FT                   RAAMLLMHSPELPPDIPYTLQTMQSATLQVYDELCT"
FT   gene            98590..99921
FT                   /locus_tag="XfasM23_0069"
FT   CDS_pept        98590..99921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0069"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: xcv:XCV3594 lipid
FT                   A core-O-antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91526"
FT                   /db_xref="GOA:B2I6A2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A2"
FT                   /protein_id="ACB91526.1"
FT                   /translation="MTNSAPDIVSISKPALLLDVGRWAPVCVVVFVAFWPLPGLAATVL
FT                   TLSALLASYSLIRYRFRGGTQLLDSPAWALTSILFMAYWLPQVVSLFGALELSESFRKV
FT                   ATDLRYLPFMWLCAIAVGAPERRERTFKGLAVIGLIWTLDALAQAVLRTSPLFWSLNQL
FT                   KQAISGYGFCSTQQMMLADRLSGIFGPCNLKLGQTLATLSPFVLFAMQRRGVALWLLVV
FT                   AVLGIVLLLAGSRASWITYGLILMLSGWRVLGIRRLLGMGALFLPLALAVIAFSPQTRE
FT                   RIDRTAAVFADHGAGVDQALSGRSQIWQAALCMIQAHPLSGVGVRGFRDAYPACNPTPE
FT                   RIPAWGAGPALHAHQIVLEILSETGVIGLLLWIAGAAMAWRAWRYATAAARDRARPAMI
FT                   SLLATVFPFNTHLAFYSSFWGALMLMLAGLYAGALLQNGAIKKT"
FT   gene            complement(100110..101030)
FT                   /locus_tag="XfasM23_0070"
FT   CDS_pept        complement(100110..101030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0070"
FT                   /product="lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis lauroyl (or
FT                   palmitoleoyl) acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: xac:XAC3465 lipid A biosynthesis
FT                   lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91527"
FT                   /db_xref="GOA:B2I6A3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A3"
FT                   /protein_id="ACB91527.1"
FT                   /translation="MSDSTNVTPRPSLLKPAHWPMYVALCGMVLAARLPWGLQRRLGRV
FT                   IGAMALRLVGTRRCAAEINLQLCFPTHNEAWRKKLLHENFDALGVGLFEFARAWWGSID
FT                   VIRAGIHVEGLEHLRQLQREGRGVLLVSGHFMTLEICGRLLCDYVPLAGMYRRHRNPVL
FT                   EWAIKRGRLRYATQMFANEELRATIKHLKCGGFLWYAPDQDMRGKETVFAPFFGMPAAT
FT                   ITATHQLARLTGCAVVPYFHRRQGGNYVLKIAPPLADFPSKDLAADTARINQVIETMID
FT                   EAPDQYLWIHRRFKRQPEGHSRFYN"
FT   gene            101073..102419
FT                   /locus_tag="XfasM23_0071"
FT   CDS_pept        101073..102419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0071"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: xcb:XC_0827
FT                   3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91528"
FT                   /db_xref="GOA:B2I6A4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A4"
FT                   /protein_id="ACB91528.1"
FT                   /translation="MHAVIGFRILVCMRKDPIEWLLRALYSALLYLLLPFTIYHLVWRG
FT                   FRVRQYFNRWNERYASYPAAYARPQVWLHAVSVGEVNAAASLVNALRQQRPDIRWVITT
FT                   ITPTGSERVRALWGDSLEHVYLPYDVPGSVERFLRYFRPQLALILETELWPNLLFGCRS
FT                   HGIPVYILNARLSVRSLRGYRLLKPLIRRALRSVVCVAAQSQEDALRFLRLGARPDQVV
FT                   ALGNLKFDIPTPQDLDVFMAAFRRCVPMARPVWIAASTHEGEEAAIIDIHTRLLRRIPN
FT                   LLLLWAPRHPERFHKVEGLAYEHGWRVSTRKQHTWPDVTTDVFVIDTLGELSAFYGCAQ
FT                   VAFVGGSLQPIGGHNLLEPAAVGTATVTGPYLHNFSEISRRMKGAQALEICADAEAVGA
FT                   MLEHLLADPSKRSQMAQAGLALVANGRGAVARTLVQINPHLPSMISVEK"
FT   gene            102803..104185
FT                   /locus_tag="XfasM23_0072"
FT   CDS_pept        102803..104185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0072"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="KEGG: aau:AAur_0604 hypothetical protein; PFAM:
FT                   coagulation factor 5/8 type domain protein; SMART:
FT                   glycoside hydrolase family 29 (alpha-L-fucosidase)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91529"
FT                   /db_xref="GOA:B2I6A5"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6A5"
FT                   /protein_id="ACB91529.1"
FT                   /translation="MTQSSLFASLRVLIGFCLAALICPVAIAQNVAVMKPSPQQIAWQD
FT                   LEFGVIVHFNPNTWLDQEWGDGSASPKVFNPMHVDPGQWARAAKAAGAKYLILVAKHHD
FT                   GFALWPTAQSEYSVKNSPWMGGKGDVVKLTAAAVRQQGMGFGIYLSPWDRHEPKYANVD
FT                   AYNQFYAAQLVELASHYGPLTEWWLDGAGSAGHEYDFDKYLEQLRTYQPNTMVFADTAL
FT                   FKYGDIRWVGNEAGVIEGENWNVIDRHGDLRWRPVEVDTPLHRLEWFWHPNNERTLKSV
FT                   DELLAIWEKSVGRGGQLVLGIAPDTRGLLPEADVKRLQAMGVAIQACYGAGKNLVPVHL
FT                   KNHQAIVAAVDGDVDTFWSAPHGSHSAMLELHFKQPITFDTSLTMEWLNDGQLVQKYAI
FT                   EVWQKGKWVRVAQAQAIGKMKIDHFGSLTASRVRLNILSSADAAHIREFQLFNIGNSRA
FT                   AH"
FT   sig_peptide     102803..102889
FT                   /locus_tag="XfasM23_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            104401..104661
FT                   /locus_tag="XfasM23_0073"
FT   CDS_pept        104401..104661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0073"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: xcb:XC_3043 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91530"
FT                   /db_xref="GOA:B2I6A6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6A6"
FT                   /protein_id="ACB91530.1"
FT                   /translation="MVKIRLTRGGAKKRPFYQIIVTDSRNKRDGRNIERVGHYNPVAQG
FT                   AESRVVLNMARVEHWVRNGAQLTDKVRSLLKEVSKTQATAA"
FT   gene            104705..105217
FT                   /locus_tag="XfasM23_0074"
FT   CDS_pept        104705..105217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0074"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: xac:XAC1293
FT                   16S rRNA-processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91531"
FT                   /db_xref="GOA:B2I6A7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6A7"
FT                   /protein_id="ACB91531.1"
FT                   /translation="MKDNERRILLGRVVGGFGLRGEIKIESWTEPRDAIFRYQPWLLRS
FT                   PTGTESMLNGARGYETGKRLIATFPGINDRNGVEAICGTEIYVPRSALPPPHPDEYYWV
FT                   DLEGLQVHTLEGVVLGSVSHLFSNGANDVIVIHGERERLIPFVQPDYVKSVDFEAERIV
FT                   VDWDPEF"
FT   gene            105327..106112
FT                   /locus_tag="XfasM23_0075"
FT   CDS_pept        105327..106112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0075"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: xom:XOO_1221 tRNA
FT                   (guanine-N(1)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91532"
FT                   /db_xref="GOA:B2I6A8"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6A8"
FT                   /protein_id="ACB91532.1"
FT                   /translation="MRIDVISLFPEFIKQSVGFGVIGRAQERGLLDLHNWNPRDYAQGN
FT                   YRRVDDRPFGGGPGMVMLIEPLRACLEAVRAADPQPAPLIYLSPQGVLLNQSRARKLAM
FT                   LPRMILLCGRYEGIDERFIAHEVNMELSIGDYVLSGGELGAAVVVDAVTRLQEGVLNDA
FT                   ESAKQDSFEAADSLFDYPHYTHPSNHAFGNVPEVLRSGNHVAITRWRRQQSLLRTWLRR
FT                   PDLIDEARLSKADRLLLDEIKRTHPMDTDRKASASWRGA"
FT   gene            106277..106687
FT                   /locus_tag="XfasM23_0076"
FT   CDS_pept        106277..106687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0076"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: xcb:XC_3040 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91533"
FT                   /db_xref="GOA:B2I6A9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6A9"
FT                   /protein_id="ACB91533.1"
FT                   /translation="MSKLNKSIIAEFESAQITRQVPQFSQGDTIVVNVKVKEGNRERLQ
FT                   AYEGVVIATKNAGLNSAFTVRKISHGYGVERVFQTHSPIIESIEIKRRGKVRAAKLYYL
FT                   RGLEGKAARIKEDLAATAHEKLARKTVTAKAG"
FT   gene            106708..106971
FT                   /locus_tag="XfasM23_0077"
FT   CDS_pept        106708..106971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91534"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B0"
FT                   /protein_id="ACB91534.1"
FT                   /translation="MQLPLHHLQPFLTRKSFIQRFRVSLWEERCSLRSGLVSPELHVSA
FT                   GVASAGVGLLRFKLAEFPHRLSSDKMQCVFLALKNEFLYRTQ"
FT   gene            107111..107890
FT                   /locus_tag="XfasM23_0078"
FT   CDS_pept        107111..107890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0078"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: xcb:XC_2856 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91535"
FT                   /db_xref="GOA:B2I6B1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B1"
FT                   /protein_id="ACB91535.1"
FT                   /translation="MVAVNLKTKEEIEQMRIAGRLAATVLDVVAPYVKPGVTTAELDQI
FT                   CHNYIVTVQGAIPANLGYRGFPKTICTSVNNVICHGIPSDAKVLKDGDIINIDVTVIKD
FT                   GWHGDTSRMYYVGNPSVMARRLVETTYEAMWRGIRAVKPGATLGDIGHAIQTYAENERF
FT                   SVVREYCGHGIGKVYHDNPQVLHYGRPGEGLVLESGMTFTIEPMINEGTRHHKVLPDGW
FT                   TVVTKDRKLSAQWEHMIAVTEDGVDVLTLSPNDIGST"
FT   gene            108561..109463
FT                   /locus_tag="XfasM23_0079"
FT   CDS_pept        108561..109463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0079"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: xcb:XC_2854
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91536"
FT                   /db_xref="GOA:B2I6B2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B2"
FT                   /protein_id="ACB91536.1"
FT                   /translation="MTTQPHLKETPPQQVDNKASPPVVDKTLVSAIEDAFARYSTLTVE
FT                   EIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEWLKKAVLLYFRVHDTTIVDAQP
FT                   APFWDKVESRFSGYDAVKFRAAGVRVVPGAIARRGSYFGKDVVLMPSFTNIGAYVGEGT
FT                   MIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPAIIEDHCFIGARSEVVEGVIVG
FT                   HHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSGQLPAKDGTHSLYCAVIVKQV
FT                   DEKTRAKTSINELLRGLAD"
FT   gene            109478..109834
FT                   /locus_tag="XfasM23_0080"
FT   CDS_pept        109478..109834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0080"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   xom:XOO_1878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91537"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B3"
FT                   /protein_id="ACB91537.1"
FT                   /translation="MTTLYGLKNCDTCKKANKWLDRFSIAYVFVDYCENIPSPETLVTW
FT                   SKEAGSFDALINKSSTTWRQLPSNRKTPCSEAEWKLLLREYPHLIRRPVVLTSDGIFSQ
FT                   GFSDNGFKKRFGID"
FT   gene            109990..111123
FT                   /locus_tag="XfasM23_0081"
FT   CDS_pept        109990..111123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0081"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: xcv:XCV1489 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91538"
FT                   /db_xref="GOA:B2I6B4"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6B4"
FT                   /protein_id="ACB91538.1"
FT                   /translation="MSDVLDLACDLISRPSMTPDDAGCQEMIAKRLERAGFICEHLRYA
FT                   AVSNLWATHGRGAPVLVLLGHTDVVPPGPVEAWTSDPFMPDMRNGILYGRGAADMKGSV
FT                   AAFVIAAERFLAAYPQHPGTLAILLTSDEEGQAIDGVRKVAETLRQRGQGIDWCLTGEP
FT                   SSSKRLGDLLRVGRRGSLSATLHVKGVQGHVAYPHQARNPIHLALPAFAALTARHWDDG
FT                   YESFPSTSLQISNIHAGTGANNVIPGALEVAFNLRYNPHWIAPRLESEIVALLDQHGLD
FT                   YTLHWHRSGEPFYTPEGKLRRIAREVLERFSGAPPEESTGGGTSDARFIAPLGAQCIEV
FT                   GPVNASIHQVDEHVCLSDLEALPDLYQLLIERLLAEH"
FT   gene            111525..113216
FT                   /locus_tag="XfasM23_0082"
FT   CDS_pept        111525..113216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0082"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: xac:XAC1433 asparagine
FT                   synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91539"
FT                   /db_xref="GOA:B2I6B5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR024286"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B5"
FT                   /protein_id="ACB91539.1"
FT                   /translation="MCSIFGIFNLQPSDNLQILRHQALECSQRQRHRGPDWSGVYVDVG
FT                   AILVHERLAIVDPAGGAQPLFSEDGTLALAVNGEIYNHAVLKGTLQQPYAFQTHSDCEV
FT                   INALYREETPTSFLNRLNGIFAFALWDKTTGRGLIARDPMGVVPLYWGHDQDGRLRVAS
FT                   EMKALVEHCPDVAQFPPGHWYDTTTGTLVKYYERPWKNYSAVEGVQVSLQELREAFERA
FT                   VHRQLMTDVPYGVLLSGGLDSSLVAAVAARYARHRIETNDQSEAWWPRLHSFAIGLKDS
FT                   PDLSAANVAAEALNTVHHGFEYTFQEGLDVLPEVIRHIETYDVTTIRASTPMFLLARRI
FT                   KAMGVKMVLSGEGSDEIFGGYLYFHKAPNAREFHEELVRKLNALYYYDCLRANKAMMAW
FT                   GVEPRVPFLDREFLDVAMRMDAQHKMVDKTSNGPQRMEKGILRAAFDGYLPPSILWRQK
FT                   EQFSDGVGYGWIDGLKAHAETQVSDHALATAETRFQVNPPQTKEAYYYRSIFERFFPSP
FT                   AAAETVPGGKSIACSSPAAIAWDASFATMADPSGRAVSGVHQQALL"
FT   gene            complement(113274..114302)
FT                   /locus_tag="XfasM23_0083"
FT   CDS_pept        complement(113274..114302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0083"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   xcv:XCV1491 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91540"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6B6"
FT                   /protein_id="ACB91540.1"
FT                   /translation="MSQRILSICTLILALLLIATHAKANMQPTCSAWVAPGQDLQQAID
FT                   TLRSDAHPAVLCLNKGEYRVDKLLHIGRDGVHIRGSGPNTVIRLNKDVQQPLIVIGDYQ
FT                   NQQPAKQIGDVVIERMHLIGTTNVEHEFMPERPYLSNSVVVLRAAHNVSLLDLKVSQCR
FT                   SACLLSEYDSHRLNIERNDVSGATWDGVSFNRSTHVRLVNNVIHDNVAAGITTEHLEDS
FT                   EIRGNRLERNGSQGLYLADARRNVFKHNQFISNKKSGVLLTCSIRYRTPEVLCWDNSMS
FT                   QANVFEYNIFQKSPYIYTIGVDRAANCKGSDFEPNMWRNNKADTSGFNPPPDVYGTCVQ
FT                   TQ"
FT   sig_peptide     complement(114228..114302)
FT                   /locus_tag="XfasM23_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.861 at
FT                   residue 25"
FT   gene            115348..116379
FT                   /locus_tag="XfasM23_0084"
FT   CDS_pept        115348..116379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0084"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   mjl:Mjls_0489 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91541"
FT                   /db_xref="GOA:B2I678"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2I678"
FT                   /protein_id="ACB91541.1"
FT                   /translation="MKINSNLFDCLLPIVAAPMAGGPTTVALAQAVSGVGGFPFLAGGY
FT                   KSVEALATEIAVLRASGGNFGVNLFVPSPDMVDAEAFRIYAAKLQSEALPYGLRLDPLP
FT                   VMGDDDGWPDKLALLLNDPVPVVSFTFGLPAVRDIAALRCAGSRVLASVTLPAEAQAAM
FT                   EAGVDGLVVQGPDAGGHSATYDPGRPFTPLKTVSLVRRVCAVSSLPVIAAGGVDGPVMV
FT                   RALLQAGAAAVAIGTLLLRTKESGATQVHKDALANPAYTETVITHAFTGRPARTLRNGF
FT                   VNRYHASAPLGYPAIHHLTRPLRQAAASAGDADVLHLWAGTGYRQAMDGSAVDVIQYLA
FT                   AGL"
FT   sig_peptide     115348..115437
FT                   /locus_tag="XfasM23_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.887 at
FT                   residue 30"
FT   gene            116852..117487
FT                   /locus_tag="XfasM23_0085"
FT   CDS_pept        116852..117487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0085"
FT                   /product="transcriptional repressor, LexA family"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: xom:XOO_2794 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA-binding domain protein; peptidase
FT                   S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91542"
FT                   /db_xref="GOA:B2I679"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I679"
FT                   /protein_id="ACB91542.1"
FT                   /translation="MSLSDIQQAILSLITNNINADGVSPSQTEIARAFGFKGVRAVQHH
FT                   LDVLEQQGMIRRIPGQARGIRLKHLTEVDEVALALQSKDVLRLPVLGRVAAGQPIGADI
FT                   GEDHVVLLDRVFFSPAPDYLLRVQGDSMRDEGIFDGDLIGVHRTQDAHSGQIVVARIDD
FT                   EITVKLLKISKDRIRLLPRNPDFAPIEVRSDQDFAIEGLYCGLLRPNR"
FT   gene            117669..118712
FT                   /locus_tag="XfasM23_0086"
FT   CDS_pept        117669..118712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0086"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: xcv:XCV1773 recombinase A; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91543"
FT                   /db_xref="GOA:B2I680"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I680"
FT                   /protein_id="ACB91543.1"
FT                   /translation="MDENKKRALSVALSQIEKQFGKGSVMRMGDRVIEAVEAIPTGSLM
FT                   LDLALGIGGLPKGRVVEIYGPESSGKTTLTLQAIAQCQKRGGTAAFIDAEHALDPIYAG
FT                   KLGVNVDDLLLSQPDTGEQALEIADMLVRSGSIDIMVIDSVAALTPRAEIEGEMGDQLP
FT                   GLQARLMSQALRKLTGNIKRSNTLVIFINQLRMKIGIMMPGQSPETTTGGNALKFYASV
FT                   RLDIRRIGAIKKGDEIIGNQTKIKVVKNKLAPPFKQVVTEILYGEGISREGELIEMGVE
FT                   AKLVEKAGAWYSYGGERIGQGKDNARGYLRENPHFAAKLEADLREKFEPTELSREEGDE
FT                   DTLEDAM"
FT   gene            119200..121854
FT                   /locus_tag="XfasM23_0087"
FT   CDS_pept        119200..121854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0087"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: xcb:XC_2507 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: alanyl-tRNA synthetase class
FT                   IIc; phosphoesterase DHHA1; Threonyl/alanyl tRNA synthetase
FT                   SAD"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91544"
FT                   /db_xref="GOA:B2I6K2"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6K2"
FT                   /protein_id="ACB91544.1"
FT                   /translation="MNIPTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPSNDPTLLFTN
FT                   SGMVQFKDVFLGAEKRSEVRVADVQCCLRAGGKHNDLDSVGYTARHHTFFEMLGNWSFG
FT                   DYFKKEAIMWAWELLTQVWELPPERLLVTVYHTDDESYALWRDMVGVPEDRIVRIGDNK
FT                   GAPFASDNFWQMADTGPCGPCTEIFYDHGEHIPGGPPGSPGEDGDRFIEIWNLVFMQFD
FT                   RQSDGTLVPLPTPCVDTGMGLERLAAILQHVHTNYEIDLFQTLILKAAELTAVADVQNK
FT                   SLCVIADHSRACAFLIVDGVLPSNEGRGYVLRRIIRRALRHGWMLGVRQPFFNNMVPTL
FT                   IAVMGDAYPKLQAAAESVMRTLLAEEERFAETLDVGMKIFNEVAAKVANGVIPGSDAFR
FT                   LYDTYGFPVDLTADIARERGMRVDMAGFEAAMTQQRKTARAAGKFGRGVQLSAERAATL
FT                   SPTVFLGYEQLQADDLRVVALLSDGGLTDSASVGDEVIVLTDRTPFYAESGGQVGDIGT
FT                   LMASDGVRLEVTDTQKLMGQFHGHVARIVQGGVKVGDVLSGSVAVARRKMVALNHSATH
FT                   LLHCALRSVFGTHVVQKGSLVAPDRLRFDFSHFEPISAAQMTLIERMVNDEVRANHLVM
FT                   IEQMGMQAALDAGAMALFGEKYGEHVRVVTMGTSVELCGGTHITRTGDIGLFKIISECG
FT                   VSSGVRRIEAVTGESALNHVLAEEHRLYEVAGLIGSNANNVVNHIRQLTDRQKTLEREL
FT                   EKLKGKLISGTITDLLSMAVNVADVKVVAARLDGLDGKALREALDRLKLQLSDAVIVLA
FT                   GVTGGKVALVTAVNGPRAMGKVKADTLLSHVATQINGRGGGRVDFAQGGGEDGPSLRSA
FT                   LDGVATWVKQHLN"
FT   gene            121993..122208
FT                   /locus_tag="XfasM23_0088"
FT   CDS_pept        121993..122208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0088"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="PFAM: carbon storage regulator; KEGG: xom:XOO_2790
FT                   carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91545"
FT                   /db_xref="GOA:B2I6K3"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6K3"
FT                   /protein_id="ACB91545.1"
FT                   /translation="MLILTRRSGETLMIGDQVTVTVLGVKGNQVRVGINAPKHVAVHRE
FT                   EIYHRIQRGDELACSSGTRGDSGSSI"
FT   gene            122288..122380
FT                   /locus_tag="XfasM23_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            122288..122380
FT                   /locus_tag="XfasM23_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(123323..125347)
FT                   /locus_tag="XfasM23_0089"
FT   CDS_pept        complement(123323..125347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0089"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: xcb:XC_3653 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91546"
FT                   /db_xref="GOA:B2I6K4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6K4"
FT                   /protein_id="ACB91546.1"
FT                   /translation="MSNPLLDFSDLPRFDAILPEHVGPAIEQLLAEAEAAVAHAEQVTP
FT                   VTWENFVVPLDDATERLYRAWGQVAHLEAVVNTPALREAYNVTLPKVTRFSSTLGQNLA
FT                   LYAQYKALACAPEWDRDNAVRCKVVDNALRDFRLGGAELDAAGKARLAEIKQELSALSA
FT                   TFSQNVLDATEAWSYTTEDAALLSGLPTETVATARAAAEKKGVSGWTFTLQMPCYLSVQ
FT                   SDADNRALRERSYHASAIRASEFGDAALDNSPHIHQILTLRSELAALLGFSCYAAYSVA
FT                   TKMAEDPAEVLSFLHDLAGRAKPHAQRDRRELETFAREALGLETLEAWDIAYASEKLKQ
FT                   ARYNFSEQEVKQYFTEPKVLAGLFEVIRSLYGLRIEEDAAPVWHPDVRFYRLIDTNGQR
FT                   VGQFYLDLYAREGKRGGAWMDDCRNRRDKGDGVQTPVVYLVCNFGRGNDGVLPTFRHQE
FT                   VITLFHEMGHGLHQLLTRIGELGVAGINGVEWDAVELPSQFMENFCWEWERVQAMTAHV
FT                   ETGAPLPRSLFDRMVCARNFQSGMFTVRQLEFALFDMLLHSDFDPAQDSVLGLLERVRD
FT                   EVAVNRLPDWNRFPHQFRHIFAGGYAAGYYSYKWAEVLSADAYAAFEEAPDQFAEIGAR
FT                   FLDEILSRGGSRSAAENFQAFRKRAPRIDALLKRNGMTE"
FT   gene            complement(125407..126564)
FT                   /locus_tag="XfasM23_0090"
FT   CDS_pept        complement(125407..126564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0090"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: xac:XAC3628 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91547"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6K5"
FT                   /protein_id="ACB91547.1"
FT                   /translation="MQGGYGRIDAFYHCCSFMSQREWVASSICKIEADFNRSVDTHLIP
FT                   LQLPGFPDIDFYLKDESIHPTGSLKHRLARSLFLYALVNGWLSPGRPVIEASSGSTAVS
FT                   EAYFARLLGLPFIAVIPTSTSPEKVAAIEFHGGRCHAVERACDLHDAAHQLARETGGHF
FT                   MDQFTYAERATDWRANNNIAESIFKQMADEPHPIPAWIVCSPGTGGTAATLGRYVRYRR
FT                   HVTRILCADPEISVFFDHYRAACKGSDHRNSVTDTGGSRMEGIGRPRLEPSFIHNCIDA
FT                   MIKVPDALSLAAMRYISARLGRRVGGSTGTNMVGVLQTAARMRAEGMKGSIVTILCDGG
FT                   ERYAHSYYSPAWYAAHGIDVSDSDAVIAAVVAGDTLPLLPCAALE"
FT   gene            126867..127409
FT                   /locus_tag="XfasM23_0091"
FT   CDS_pept        126867..127409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_3654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91548"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6K6"
FT                   /protein_id="ACB91548.1"
FT                   /translation="MPLRWQHRLIEQEPRVLGIATWRTCKNALSVASAGINLGVSSPYT
FT                   DATSRLRCTPLPSLLLRLLISLCLIAQQSVSAWASVTMPPRIALPSMPVAVVDRPCHHT
FT                   GVSGVQSAAHLSHAIPTPSTPCSKIGHCDCLQHSNALPVTLLILPVVLLERMPPLAGIL
FT                   TSRGLPAPYRPMRPPIA"
FT   gene            127509..129329
FT                   /locus_tag="XfasM23_0092"
FT   CDS_pept        127509..129329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0092"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 1; multicopper oxidase type
FT                   2; multicopper oxidase type 3; KEGG: xcb:XC_3656 copper
FT                   resistance protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91549"
FT                   /db_xref="GOA:B2I6K7"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6K7"
FT                   /protein_id="ACB91549.1"
FT                   /translation="MNTVTFPSQGGIDRRRFLKGLALGGVVAGTGLWRLPVHAANPELP
FT                   PLQRRTTPLELRIGQSSVNFTGRMRPAITVNNSLPGPVLRWRQGDTVQIHVTNTLPDVM
FT                   TSIHWHGIVLPSNMDGVPGMSFDGIAPGEHYLYRFQLHQSGTYWYHSHAMFQEQAGLYG
FT                   ALIIDPLEPPPYRADREHILLFSDWTDLDPAALFRRLKKMSSYDNTYQRTVRDFFHDIH
FT                   RDGLRTTLADRRMWGRMRMTPTDLSDVNAHTYTYLLNGTTPAGHWTGLFRPGEKVLLRL
FT                   INGSAMTYFDVRIPGLKLTVVAVDGQYVHPVTVDELRIALAETYDVLIQPHGQDAFAIF
FT                   AQDMGRTGYACGTLAVRPGLHAPLPALDPRPRLTMQDMGHGMTHDQHGSRVSEMADIPG
FT                   MTHPGRLGDHASHANQPPAQPPHGLHSLPADRTAPQHPASEQNNPLVDMHVDAPQPRLN
FT                   DPGIGLRDNGRHVLTYADLHSLFDDPDGREPGREIELHLTGNMEKFAWSFDGIPFASAQ
FT                   PLRLNYGERVRIVLVNDTMMAHPIHLHGLWSDLEDANAAFQVRKHTIDMPPGTRRSYRV
FT                   RADALGRWAYHCHMLYHMESGMMREVQVRP"
FT   sig_peptide     127509..127628
FT                   /locus_tag="XfasM23_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.950 at
FT                   residue 40"
FT   gene            129326..130270
FT                   /locus_tag="XfasM23_0093"
FT   CDS_pept        129326..130270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0093"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   xac:XAC3631 copper resistance protein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91550"
FT                   /db_xref="GOA:B2I6K8"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6K8"
FT                   /protein_id="ACB91550.1"
FT                   /translation="MNTRTWFVLFCVALPLVPLQAQPRPQTEQTSPALSEHTQMDHTQM
FT                   DHTQMDHTGMDHTGMDHTGMDHTGMDHAIHGATTRSAGDVALPPPTTAALAAAFPPLRH
FT                   RAAHAPPLVSLVRIDRLETWNADPGRGHAWATQAWIGSDIQRLWLRSQGECYGGRCQSV
FT                   AVDMLYGHDISPWWDALIGARRDVQPDGRTWAALGVQGVTPYKFESAAFLYLSGAAMRL
FT                   MVETKYDLLLSQRLILQPNLQATAGLTRDRDLGAGPQTLQVGVRMRYQITRRVAPYVGW
FT                   EREYGYGGNGRQARGRGTSDDEKRWVAGIRCWF"
FT   sig_peptide     129326..129391
FT                   /locus_tag="XfasM23_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            complement(130527..133511)
FT                   /locus_tag="XfasM23_0094"
FT   CDS_pept        complement(130527..133511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0094"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: xcv:XCV3684
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91551"
FT                   /db_xref="GOA:B2I6K9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6K9"
FT                   /protein_id="ACB91551.1"
FT                   /translation="MSQFTSSYDPTSFEARLYAEWEAAGHFKPSGVGQPYTILLPPPNV
FT                   TGTLHMGHAFQQTLMDALVRYHRMCGDDTLWQVGTDHAGIATEMVVSRNMALEGRGETR
FT                   DSLGREGFINKVWEWKQQSGDTIERQMRRLGVSADWSRSTFTMDAQPSAAVTEAFVRWY
FT                   EEGLIYRGQRLVNWDPVLKTAISDLEVENVQEEGMLWSIRYPLSDGVTYEHIEHDAAGN
FT                   ETLRETRDSLIVATTRPETLLGDTAVMVHPEDRRYTALIGKTVTLPLTGRQIEVISDTY
FT                   VEPTFGTGVVKVTPAHDFNDYQVGLRHRLPMIQVLDDAACIVSKTSIQSGIASGATSDT
FT                   TDTPSDSDASNASNQHDTLIMPAHLAGLDRYEARKQILADLDAQGLLVAATPHTLQVPR
FT                   GDRTGQVIEPYLTAQWFVRMETLAARGLELVERGAVRFVPPNWINTYRHWMENIQDWCI
FT                   SRQLWWGHRIPAWFDTQGCVYVGRSEAEVRAKHALGPEVTLTQDNDVLETWFSSQLWPF
FT                   STLGWPDPMAMAERGFERYLPSSVLVTGFDIIFFWVARMIMATDHFTGNVPFHDVYITG
FT                   LIRDAQGQKMSKSKGNVLDPLDIIDGITLDDLVAKRTTGLMQPKLAEKIAKATRKEFPD
FT                   GIAPHGADALRFTIAALATHGRDIKFDLGRAEGYKNFCNKLWNATRFVLMNTAGDTAHS
FT                   PAQHQAGQDGQDVPRTPQPRTDAEQWILSRLAAVTAEAHAQFAAYRFDLLAQALYEFAW
FT                   NEFCDWFVELAKPALNGDDTQAAASTRHTLLYVLETLLRLLHPLIPFITEELWCQVAPR
FT                   LGIQATTLMLRPYPQPQQLETTAFANAAADVEWLKIMVSALRRIRSTLNVPPSRRISLL
FT                   LQGGQEVDRRRITHFAIALHFLLKLEHIDWLSATTAAPPSATAIVGSLKLLVPLEGLID
FT                   VDAERARLDKEIKRVESEIDKSNGKLSNAVFVQNAPTAVVEQERSRLREWTTQLNGLRE
FT                   RRTTL"
FT   gene            complement(133564..133758)
FT                   /locus_tag="XfasM23_0095"
FT   CDS_pept        complement(133564..133758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91552"
FT                   /db_xref="GOA:B2I6L0"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L0"
FT                   /protein_id="ACB91552.1"
FT                   /translation="MRLLIALLLPCLLFFTIGRPLAGVTCLILQITLIGWAPAAIWAVY
FT                   ALNQYETDQKIKNLTRRQD"
FT   sig_peptide     complement(133690..133758)
FT                   /locus_tag="XfasM23_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.797 at
FT                   residue 23"
FT   gene            complement(133821..134246)
FT                   /locus_tag="XfasM23_0096"
FT   CDS_pept        complement(133821..134246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0096"
FT                   /product="DNA polymerase III chi subunit HolC"
FT                   /note="PFAM: DNA polymerase III chi subunit HolC; KEGG:
FT                   xcb:XC_3586 DNA polymerase III subunit chi"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91553"
FT                   /db_xref="GOA:B2I6L1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L1"
FT                   /protein_id="ACB91553.1"
FT                   /translation="MARADFYLIAKPRFLEKPLQLVCELVRKAYDTHQPTLILARDQAQ
FT                   AEALDDLLWAFDPDAYIPHQIAGSDEDDDITPVLIATPDSDTPSRPLVINLRDAPWDGP
FT                   CERVLEVVPADPAAREPLRERWKHYKARGLHMNKHDM"
FT   gene            complement(134246..134677)
FT                   /locus_tag="XfasM23_0097"
FT   CDS_pept        complement(134246..134677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91554"
FT                   /db_xref="GOA:B2I6L2"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L2"
FT                   /protein_id="ACB91554.1"
FT                   /translation="MHIYGMGSPLLGLLLTFIVKRISAWLKIRKAQKEQTKKQIIKKAL
FT                   DEIETIASQPFNPLPFTKEAVECFMYFVCSFTMINIALINASNTNLVIQIINYLLHFTA
FT                   SAFLGLSLGALIELRRQLKIKLDPQKATERLRAMLEKLD"
FT   gene            complement(134692..136167)
FT                   /locus_tag="XfasM23_0098"
FT   CDS_pept        complement(134692..136167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0098"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcv:XCV3681 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91555"
FT                   /db_xref="GOA:B2I6L3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6L3"
FT                   /protein_id="ACB91555.1"
FT                   /translation="MALQFQLNQTTPQTVTTDCVIVGIYADKTLSPTAKTLDAASGGRI
FT                   TALTARGDLTGKSGTSALLHDLNGVTAPRVLVVGLGEADKFGAGQYIKAVGNAVRALKD
FT                   APVTHALLTLSELPVKDRNAAWNIHQAVIAADHAAYRYTATLGTSRKKAEESGLITLAI
FT                   HGQETSGLTLGQAIAEGVEYARALGNLPPNICTPAYLAETTAHFAATHPGATCEILDES
FT                   NMEALGMGALLAVARGSANRPRLIVLKWNGGGDARPYVLVGKGITFDTGGVNLKTQGGI
FT                   EEMKYDMCGGAAVIGTFVAAVKVRLPLNLIVIVPAVENAIDGNAYRPSDVITSMSGKTI
FT                   EVGNTDAEGRLILCDALTYAERFKPEALIDVATLTGACMIALGRAATGLMTHHDDLANE
FT                   LLTAGEHVHDRAWRLPLWDEYQGLLDSTFADVYNIGGRWGGAITAGCFLSRFTEGQRWA
FT                   HLDIAGSASNEGKRGMATGRPVGLLTQWLVDRC"
FT   gene            136277..137362
FT                   /locus_tag="XfasM23_0099"
FT   CDS_pept        136277..137362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0099"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   xcb:XC_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91556"
FT                   /db_xref="GOA:B2I6L4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L4"
FT                   /protein_id="ACB91556.1"
FT                   /translation="MPKLDRYLLSDFTQSFIATLIVLMLVGVGGVLVDILGSIADGHFP
FT                   AKLLLSQLGLRFISYLPLLLPLALMLGLLMSLGRLYRDSEMAVITSIGVGPGRMLPSIL
FT                   GLVLPVVVLIGVCSLWLAPWANRTANDLLEQANRSIIMAGLEAGTFTPMPDGGVVYLSS
FT                   LSSDGTKLNAVFMQSQKDDRIAVVTAKRGEMYVQGDKGRYLRLEDGQRVDGPADGAALN
FT                   YRVLTFARNDALLPELSVVYDSNHPDILPTFNLIGDPRREAQAQLHARLAPPLLALAFA
FT                   LLVLPLSRSAPRQQRYGAVMMCFLVYMVGTNLMIVGTQWIANGKISPVWGLWWLTLPLL
FT                   LVAVCLYARGGCWMPWPRRSR"
FT   gene            137359..138465
FT                   /locus_tag="XfasM23_0100"
FT   CDS_pept        137359..138465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0100"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   xcb:XC_3583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91557"
FT                   /db_xref="GOA:B2I6L5"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L5"
FT                   /protein_id="ACB91557.1"
FT                   /translation="MKLFPCLHDRYVARAVVATVLLTWLVLLGLDVVNGFASEVRDIGK
FT                   GSYSFGHAIAYIAYTVPRRAYTLFPTAAVIGMLLGLGQLAATSELTALRALGVSRTRLS
FT                   LSVMMMIGMGTGLMVLTGETLGPWAQAQADILKASAKYKSDMTGARYSGFWAREGEVFL
FT                   NARSGEEKRLDSGGIMLILHDVRLYQLAADGRLQSMTRAARVEHHQDVWILQQVQRDTF
FT                   SERGVQRETFDSLPWRSRLDPAVLAAGLAKPRNLSAHELVQSIEYRRRNHLDARDFEGQ
FT                   YWSRWFYPVNVLALCLAAIPFSFGLLRSGGMGKRTFLGILFALSFWMLQMFFERIASVL
FT                   KLNYQIFYLLPPMVMLCGSYWLFRRQHR"
FT   gene            complement(138383..138937)
FT                   /locus_tag="XfasM23_0101"
FT   CDS_pept        complement(138383..138937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0101"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   xac:XAC3552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91558"
FT                   /db_xref="GOA:B2I6L6"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L6"
FT                   /protein_id="ACB91558.1"
FT                   /translation="MSIPHRTSPLIGRRLLALSYDLLPILALWLLVALLFTLAYTLSGH
FT                   RLHENIAPFSPWQWLLWLCCWCTTGLYATVSWRYGGQTLGMRPWQLRVVATTGHTPPDW
FT                   CRLWCRYAVASVSLAALGCGFWWGWLDPDGRTWHDRASRTRLERLPRHSPTQPLNDAAA
FT                   GTTNTTRTTSPLEAINKKSGN"
FT   gene            139008..139178
FT                   /locus_tag="XfasM23_0102"
FT   CDS_pept        139008..139178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91559"
FT                   /db_xref="GOA:B2I6L7"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L7"
FT                   /protein_id="ACB91559.1"
FT                   /translation="MDAMLKRIAVSRGRAVGLFAVYGGRWVALCCVKGQRRSVAVAVGP
FT                   VMFAGYLFLSF"
FT   gene            139406..141235
FT                   /locus_tag="XfasM23_0103"
FT   CDS_pept        139406..141235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0103"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   xom:XOO_0678 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91560"
FT                   /db_xref="GOA:B2I6L8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L8"
FT                   /protein_id="ACB91560.1"
FT                   /translation="MCGIVGAIAGRDVVPVLIEGLKRLEYRGYDSSGIAVLESGSIRRV
FT                   RRTGRVAEMAVAATQEGFTASLGIGHTRWATHGGVTEANAHPHVSHGVVLVHNGIIENY
FT                   EVQRERLSAFGYVFQSQTDTEVIAHLIHYYMQQGGDLLGALQCAVKALTGIYALAVMSQ
FT                   AEPGRFVCARMGCPLLIGIGDGESFVASDISALIQATRQVIFLEDGDTAEIRRDGISIF
FT                   NAEQCPVERSLHLSNVSLSSLELGEFRHFMQKEIHEQPRVLADTMEAAIDAAGFPPMLF
FT                   GAQAESVFRGITGIQILACGTSYYAGLTARYWIEAIAGLPCQVEIASEYRYRKAYVNPQ
FT                   HLVVTISQSGETLDTLEALKYAKALGHRHTLSICNAPDSAIPRISELICYTRAGPEIGV
FT                   ASTKAFTTQLVVLFQLAVALGVLRGAVDAEGEAAYLEQLRQLPCSVQQALNLEPQIAGW
FT                   AECFSSRHHALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVDADMPV
FT                   VVIAPNDSLLEKVKSNMQEVRARGGELFVFADQDSHFSESEGLHVIRTLRHTGVLSPLV
FT                   HTIPVQLLAYHTALVRGTDVDKPRNLAKSVTVE"
FT   gene            141563..142660
FT                   /locus_tag="XfasM23_0104"
FT   CDS_pept        141563..142660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mma:MM_0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91561"
FT                   /db_xref="GOA:B2I6L9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6L9"
FT                   /protein_id="ACB91561.1"
FT                   /translation="MAVSHFVAAFLPSMLHKNYPSIFAKNHHPSGLFDVLTSPMVSIFY
FT                   NGHFAVLIFFVLSGYVLTMPYYNQDESSGVLSKRLWGRYLRLNIPIFFAISISYVVYVS
FT                   GLYLNVHAADMSGSTEWLKNFFPSGILLSDAVKESVFQSIIFGNSALIPPLWTLKIEFI
FT                   GSLYVLLFYISKPKRYTFLSALMVLLLIYVIHRQDSIYFYAIFLGSFLNELKKSSRLRA
FT                   VFFFIGFYFGGFQFENSIYNFLPRVMVGDLEVWDKKTFYNLIGACFITASVVQGFGEKI
FT                   LQWRITQFFGGISFSLYLLHFVILCSLSSYVYVSLSMGKASLLVNFACYVLVCVLVSFI
FT                   FEKYIDKPSISIAHKFSKKIFSKQV"
FT   gene            complement(142964..143821)
FT                   /locus_tag="XfasM23_0105"
FT   CDS_pept        complement(142964..143821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0105"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: xcb:XC_3954 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91562"
FT                   /db_xref="GOA:B2I6M0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6M0"
FT                   /protein_id="ACB91562.1"
FT                   /translation="MTTNDTWFTEHFQTTGSAIGFRVTGKLDEVQSPFQKIEIYNSTDW
FT                   GKLMVIDGALMLTSRDNFLYHEMISHPALFTHTAPKCVVIIGGGDCGTLREVLKHPDIE
FT                   QVTQCDIDEQVTRMAEKHFPELCTSNNDPRATLLFSDGVAYMADCPTNSVDVIIVDSTD
FT                   PVGPAKGLFNRTFYESCFRALKNDGLLIQQSESPLALLELIKEMRHEMSKAGFKAFKTL
FT                   PFPQPCYPTGWWSVTLSSKQPNANFAFRQTDAQTKPFDTLYYNAHLHHGVLVPPPFIAH
FT                   ALGE"
FT   gene            144043..145929
FT                   /locus_tag="XfasM23_0106"
FT   CDS_pept        144043..145929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0106"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: xcb:XC_3953 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91563"
FT                   /db_xref="GOA:B2I6M1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6M1"
FT                   /protein_id="ACB91563.1"
FT                   /translation="MTWSQDLAHKTYSIRHWADGYFEVNDAGHMVVMPLGGDGVRISLP
FT                   EVVDAARAAGAKLPLLLRFPDILGHRLGKLQAAFAQAQSEWEYAGGYTAVYPIKVNQHR
FT                   GVAGVLASHQGDGFGLEAGSKPELMAVLALSRPGGLIVCNGYKDREYIRLALIGRKLGL
FT                   KTFIVIEKPSELRMVLEEAKTLDVLPGLGVRVRLASLGAGKWQNSGGDKAKFGLSPRQV
FT                   LDVWKVLRGTEYADCLNVMHFHMGSQISNVRDIAKGMREATRYFVELSRLGAKITHVDV
FT                   GGGLGIDYEGTRSRSDCSINYGLQAYASHIVQPLASACEDYDLVPPRIVTECGRAMTAH
FT                   HAVLIANVTEVEAVPEGRVPGVCDDEPAVVRHMREIYGELDARPAIELFYEAQHFHAEG
FT                   LAAYTLGQIDLVHRARIDDLFYAISHGVRERLSHEEKSHRPVLDELNERLVDKYFVNFS
FT                   VFESIPDVWAINQIFPIVPIERLNEVPTRRGVVCDLTCDSDGTVKQYVENESLDSALPL
FT                   HVLRHGEAYRIGFFLVGAYQEILGDIHNLFGDTDAVEVAVDGRGYRIAQQRCGDTTDVM
FT                   LDYVGYALDEVRRVYAQRIAAAGMSAAESKALSDMLEAGLTGYPYLSDVPLE"
FT   gene            complement(145902..146717)
FT                   /locus_tag="XfasM23_0107"
FT   CDS_pept        complement(145902..146717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0107"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: xcb:XC_3948 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91564"
FT                   /db_xref="GOA:B2I6M2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M2"
FT                   /protein_id="ACB91564.1"
FT                   /translation="MTKTILITGATSGFGRAAVHRFANAGWRVIATGRRIERLEALAAE
FT                   WPPGHIHITAFDMRDSATLHTAIQTLPADFADIDVLVNNAGLALGTAPAQHADLAQWRE
FT                   MIDTNITSLVTLTHHVLPTLIERKGTIINISSVAATYPYTGGNVYAGTKAFVKQFSLGL
FT                   RSDLHGTGVRVTSIEPGMAETEFTLVRTGGNQAASDALYRGAHPITAEDIAEQIFYVAT
FT                   LPPHLNINRLEIMPVNQSFAGFQVARQQQSQLITPPHTLPTHSSGTSDK"
FT   sig_peptide     complement(146640..146717)
FT                   /locus_tag="XfasM23_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.380 at
FT                   residue 26"
FT   gene            complement(146846..147592)
FT                   /locus_tag="XfasM23_0108"
FT   CDS_pept        complement(146846..147592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0108"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: xcv:XCV4030
FT                   putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91565"
FT                   /db_xref="GOA:B2I6M3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M3"
FT                   /protein_id="ACB91565.1"
FT                   /translation="MATPRARNQARRNTNNAPPGWVWLIAGAAITAIVFLAAPKLFKKN
FT                   DGSLLHIDANSNPNAQPAPVADHNTPIAQPSKPTTKDKPTPKQQEYDFYTLLPGKEVPT
FT                   SNGDRIEKANTVPSNTPPKITSTPVQTTTNDPKPLPEPLSPSPAPIPVTPKKPTPAPTS
FT                   PPPAVIADTTRYILQAGSFGTSNEAESTKARLAMLGLSARIESTNIGGKQLYRVRMGPY
FT                   SNANELAEARKKIDSNGLQAITIKTH"
FT   gene            complement(147632..149320)
FT                   /locus_tag="XfasM23_0109"
FT   CDS_pept        complement(147632..149320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0109"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: xcb:XC_3945 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91566"
FT                   /db_xref="GOA:B2I6M4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6M4"
FT                   /protein_id="ACB91566.1"
FT                   /translation="MKAPVRALICQGIEALRSNGTLPTNTLPPDFVVERPKTRKHGDFA
FT                   TNVAMLLSKATGSNPRLLAQTLVAALPTSADIARIEIAGPGFINFHLHPVAYQRETINV
FT                   LKQDNDYGRNLSGQSRTVGVEYVSANPTGPLHVGHGRAAAIGDCLARLLEANGWNVKRE
FT                   FYYNDAGVQIENLVRSVQARARGLKPGDALWPTDAYNGEYIADIAKAYLAGDSINMVDT
FT                   IITSTKNVDDTAAIHHFAVNYLRNEQNHDLAAFNVDFDIYFLESSLYKDGKVEETVQKL
FT                   INSGHTYEEGGALWLKSTHFGDDKDRVMRKSDGSYTYFVPDIAYHLSKWQRGYERAITE
FT                   LGADHHGSLARVHAGLQALEIGIPPGWPEYVLHQMVTVMRGGEEVKLSKRSGGYVTLRD
FT                   LIEETSTDATRWFLIARKPDSQLTFDIDLARQKSNDNPVFYVQYAYARVCSLMHQAHEK
FT                   NLNYDQTSGMASLDQLSDNTSLCLMIEISRYPEIVQIACELLEPHLIAQYLRELAHAFH
FT                   TWYHNTPVLVENAVERNAKLTLACATRQVLANGLNLLGVGTPEKM"
FT   gene            complement(149447..150175)
FT                   /locus_tag="XfasM23_0110"
FT   CDS_pept        complement(149447..150175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0110"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: xcv:XCV4028 DNA
FT                   repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91567"
FT                   /db_xref="GOA:B2I6M5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M5"
FT                   /protein_id="ACB91567.1"
FT                   /translation="MIHSSLISEKHETRHPTQMHINNWPTHERPREKLLAHGAATLSDA
FT                   ELLAIFLGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLMRLPGLGLARACKLTAAL
FT                   ELSTRHLAAALQRGASIHDPISAGRYFAQRLRANPNEVFAVLFLDNRHRAISFEELFHG
FT                   TINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQMITQRLKNALDLIDVRL
FT                   VDHFVIGDGAPVSFAEHGWL"
FT   gene            150219..151448
FT                   /locus_tag="XfasM23_0111"
FT   CDS_pept        150219..151448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0111"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: xac:XAC3914 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91568"
FT                   /db_xref="GOA:B2I6M6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M6"
FT                   /protein_id="ACB91568.1"
FT                   /translation="MTGSHQPRSLNGQRLLLCVSGGIAAYKSLELVRRLCGAGAQVQVA
FT                   MTASAQQFVTPLSFQALSGQSTRTTLWDGNAEQAMGHIELARWAERVLIAPASADVIAR
FT                   LAHGLADDLVTTLCLATTAPLIICPAMNHNMWLHPATQANVAMLLGRGVQVIGPEDGPL
FT                   AEGVSGLGRMSEPEAIVVALVQGVSPAPVHGGLFHGQRIVISAGPTFEDLDPVRYLGNR
FT                   SSGKMGFALASAAVSHGAEVVLVAGPVYQPTPPGVIRVDVRSAAQMRDAVLSAFPADVY
FT                   IGAAAVADYAPKSVLPQKIKKSGQTLILELVRTQDILSEVAAQTANLKFVVGFAAETHD
FT                   VACYARGKLAAKHLDLIIANQVGIVGNGFESDDNAVTAYWQGGERVFASCSKVELAERL
FT                   LALIAERMQT"
FT   gene            151445..151912
FT                   /locus_tag="XfasM23_0112"
FT   CDS_pept        151445..151912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0112"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: xom:XOO_0464 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91569"
FT                   /db_xref="GOA:B2I6M7"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6M7"
FT                   /protein_id="ACB91569.1"
FT                   /translation="MSAAVKPLQIKILDPRLGTVWPLPTYATEASAGLDLRAALDAPMT
FT                   LVPGDAELLSTGIAIHLVDPSLCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSV
FT                   WNRGREAFTIEPGDRIAQLVVLPIVRVVLQVVDTFVESGRGAGGFGHTGVR"
FT   gene            151926..154469
FT                   /locus_tag="XfasM23_0113"
FT   CDS_pept        151926..154469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0113"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcb:XC_3941 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91570"
FT                   /db_xref="GOA:B2I6M8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M8"
FT                   /protein_id="ACB91570.1"
FT                   /translation="MSVTIGNELILPMKRRRIAFLLAMLCLLLAGVFCWGAYIQWRQNV
FT                   VQQKLEQARDGAVASLLQVLSAQVKQLQNVVQRPAIVQVLGGGDVTAAAAAVREQFPGT
FT                   EDVQVLTGDLSAAYADVARSGYARLGLIEAALGGDGVKAWVVRDGTQIGLGMAVMVKLG
FT                   QAPAVVYLRLPLRGLISVLDAIEVPNSTYLALRQGSYTVVERGSAALASGGEALAKPLG
FT                   WADLRMAAAVPQLENVPFDLGLLPSLIVVGVFALVAAVLLLVAGGHRMLPRRHGQMADA
FT                   EQEQVTLRESVMQEAPERAIVLNDENKENKENKENKENKENKENKENKENKENKENKEN
FT                   KENKENKENKENKENKENKENKENKENNVALSSSLHLQFNLEAVVQPSLFHEDDIHGVV
FT                   PSELNPGVAKLIGQAIGSAMQAKGLSDIVIGRDGRVSSSELSAALSDGLRHAGCNVVDI
FT                   GLVPIPVVYFAACHLGVWSCVAVTGGHHPHDYNGFKIVLGGESLSSEAMSDLYQCITNG
FT                   RLYASVDSGSLSERDVVDDYIQRIADDVQLNRPLKIVVDPGHGAAEEILSRLFKAIGAD
FT                   LVSLYGDIDGVSLIVHPDSGEPGNLQKLIQRVERADADLGLAFDGDAESLRVVTREGEV
FT                   ILSDSVLMLFATDVLQRNPGALVIYDAECTSKLSDYVLRNGGSPLMWKIGHSSIKAKMR
FT                   ETGAELAGEMSGYFFFKERWYGFEDALYAAARLLEILAQREDNPSQVFAALPHAYFTAQ
FT                   MEQSVEGDAQACVQSFIEEVQRSVEGGVFDGARLFAFDGLRADFTDGWGLVRVSDTASA
FT                   LVLRFEADTQAGLERIQSAFRTHLQALLPGQVLVF"
FT   sig_peptide     151926..152036
FT                   /locus_tag="XfasM23_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.991 at
FT                   residue 37"
FT   gene            complement(154482..155153)
FT                   /locus_tag="XfasM23_0114"
FT   CDS_pept        complement(154482..155153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91571"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6M9"
FT                   /protein_id="ACB91571.1"
FT                   /translation="MSIKKHHIYWNTILFVAVAAWPWPGNTQTSAKKLYCWHQNGQRVC
FT                   SDTLPAEAVNAAREEFNAKNGMLKGEVQRALNENERAATASEEAQRRAGQDAQETRKRA
FT                   DQIMLASFQTEDDLRQVFLKRIATIDNNLKTARYNATNLRQGLVNLLLNANERELAGQK
FT                   VPEKLAADIEQRRQDLLSQQRLHTSFEQERATLSGEIEETLQRYRALKSSEANASPLAE
FT                   P"
FT   sig_peptide     complement(155070..155153)
FT                   /locus_tag="XfasM23_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.574 at
FT                   residue 28"
FT   gene            complement(155176..155835)
FT                   /locus_tag="XfasM23_0115"
FT   CDS_pept        complement(155176..155835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0115"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: xcb:XC_3931 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91572"
FT                   /db_xref="GOA:B2I6N0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6N0"
FT                   /protein_id="ACB91572.1"
FT                   /translation="MSHYRQRFLQLALDSNALCFGEFTLKSGRISPYFFNAGHFNSGAK
FT                   TAALAQCYADAIDAANMNFDLVFGPAYKGIPLATALACEYARRERDLLLTFNRKEVKNH
FT                   GEGGTLIGAPLNGRKILIIDDVITAGTAIREALRIIRNAGGTPTGIAVALNRQEIASET
FT                   NRQSSVQALMAETGIPVVAIATLSDLLAFVEENASLAKFYEPLLAYKTHYGTEASD"
FT   gene            156672..157487
FT                   /locus_tag="XfasM23_0116"
FT   CDS_pept        156672..157487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91573"
FT                   /db_xref="InterPro:IPR017483"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N1"
FT                   /protein_id="ACB91573.1"
FT                   /translation="MTTASLDFPFVAFRSELPMNDYSASDMKCGDLTKEKLIYDYGLSF
FT                   ISFCVDPFNNEEKFITRKNKVISDEEAIVILFDEFRFWARVLSFGRYSSLMQSLISNFQ
FT                   DNKGTPFSDPLLDKAFKDLILNKRSKNGSVARIKSVFDNYIDWERGIFPSENKDYLIEA
FT                   LNSAVYPEFTRVKDIFNGLGLAVHNINSMNIKIDSLHIYNDHYSASVQYQGQDHFGLDD
FT                   GDIIDIRFRYFNIFRTWFVLQRWNKYAFKPFMTNMQANIEISGGRPVNK"
FT   gene            complement(157748..158563)
FT                   /locus_tag="XfasM23_0117"
FT   CDS_pept        complement(157748..158563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0117"
FT                   /product="peptidase C1A papain"
FT                   /note="PFAM: peptidase C1A papain; KEGG: pst:PSPTO_3000
FT                   papain cysteine protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91574"
FT                   /db_xref="GOA:B2I6N2"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N2"
FT                   /protein_id="ACB91574.1"
FT                   /translation="MQTVLKRRKKSGYGYIPDIADIRDFSYTPEKSVIAALPPKVDLTP
FT                   PFQVYDQGRIGSCTANALAAAIQFERIHDKQSPEFIPSRLFIYYNERKIEGHVNYDSGA
FT                   MIRDGIKVLHKLGVCPEKEWPYGDTPADPRTEEFPPGAPASKKPSDQCYKDAQNYKITE
FT                   YSRVAQHIDHLKACLAAGSPFVFGFSVYNSWVGNNSLPVRIPLPTKNDTLEGGHAVLCV
FT                   GYDDEIRHFRIRNSWGNNVGENGYFWMPYEYISNTQLADDFWVIKTVRK"
FT   gene            160077..161090
FT                   /locus_tag="XfasM23_0118"
FT   CDS_pept        160077..161090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91575"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N3"
FT                   /protein_id="ACB91575.1"
FT                   /translation="MARINLNYANLGPDQFERLIVSLCMKILGVGVQGFAKGPDGGCDA
FT                   KFIGTAQHYPSDKNQWSGTMIIQAKHTNHFFSSCSDKNFYSEKSSHTVIGEEIPRIKKL
FT                   RAAKQLDYYMLFTNRRLSATAHTKITEYISKQCEIPVESISLCGLEKLDMYFNHFPEAV
FT                   HHAGLDPVDSPLIVRTQELAEIIEALAQLKEKGCQVLPDHSPVIWVPYKEKNELNQLSQ
FT                   EYEKEWRRIYLKEELFIRNFLAAPENTRFVEMYTSTTEHFRFKIIAKRKDHQNFDALVE
FT                   YLMDLLFNRDSVLAQSGHQSLTRALLFYMYWNCDIGKKVDSTEEAEDAASNETLTS"
FT   gene            161059..161307
FT                   /locus_tag="XfasM23_0119"
FT   CDS_pept        161059..161307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91576"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N4"
FT                   /protein_id="ACB91576.1"
FT                   /translation="MLRPTKHSHPDLTVIHLSLLLLKRLRKDRFSRYDVLRALAKQRIA
FT                   GGDVLFLPALNFLYLLGLIEYRGATDTVEYVGNNEVI"
FT   gene            161294..163090
FT                   /locus_tag="XfasM23_0120"
FT   CDS_pept        161294..163090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91577"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N5"
FT                   /protein_id="ACB91577.1"
FT                   /translation="MKLSKLYSNHHQVFSPVKFSPGLNVVMAEIRLPENRKKDTHNLGK
FT                   TTLGRLLDFCFLSKRDRNLFLFKHEKLFDHFVFFLEVECEDASFITVRRSVRSATKISF
FT                   KRHKTGDKDFSTLLPIEWDHWDVTFDDARQLFHDLLGWRMLNKWSYRKVLGYLLRSQEN
FT                   FSKVFELSHSVVKHADWKPFLAHLLGFDGNCAAEYYKKTQELESKKKEAELLRKTWGRS
FT                   LDSLEEIETTELRKQDEVNKKQALLDTFDFHAQDPALTEELVDTVDERIAALNARRYSM
FT                   RSHWKRVKTSLQEGQILFCPDEAQVLFDEVGVLFQGQIKKDFEHLIAFNRAITAERHDY
FT                   LQEELAEIEGDLKEINAELDDLGKRRAEGLAFLTNRGVFTKYQTLCNEIIALRGEVAFL
FT                   EYQREPLRKLQALDQYIGTLKHECIDLEERINTDVRQQCSEKESLFASIGRYFKEMIRE
FT                   VIDCYGALRVTTNKHGHLEFHAEITDAAGKPTSADLGNTYRRLMCIAFDLAVLRAYSND
FT                   PFPRFVYHDGVFESLDDRKKENLLRVIRQYASFGIQSVITLIDSDLPERSVNDLPVFSP
FT                   DEIVLTLHDEGEFGRLFKMQSW"
FT   gene            163901..164701
FT                   /locus_tag="XfasM23_0121"
FT   CDS_pept        163901..164701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0121"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /note="KEGG: xcb:XC_3930 exodeoxyribonuclease III; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III Xth;
FT                   PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91578"
FT                   /db_xref="GOA:B2I6N6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N6"
FT                   /protein_id="ACB91578.1"
FT                   /translation="MRISSFNANGLRSALSKGFFDWFSTQDIDVLCVQEIKAQRHQLVG
FT                   PDFFPAGYHVCFRDATIKKGYSGVAIYSRCEPDELRTTLGWAEFDEEGRYVEARFGNLS
FT                   VVSFYIPSGSSGEKRQHYKFEVMRWLRPILCEWLLSGRDYVLCGDWNIVRSALDIRNWK
FT                   SNQKNSGCLPLERDWLNGLCADSLHDVNSAQGRGWVDTYRVLHPQGEDYTWWSNRGAAR
FT                   VNNVGWRIDYQFVSPGLRERVSRCAIYCEQRFSDHAPYTVEYVL"
FT   gene            164698..166227
FT                   /locus_tag="XfasM23_0122"
FT   CDS_pept        164698..166227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0122"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   azo:azo3975 putative AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91579"
FT                   /db_xref="GOA:B2I6N7"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N7"
FT                   /protein_id="ACB91579.1"
FT                   /translation="MSDYSGKFDVHAVLQNGRRFLTVLLLGFASGLPLALTGGAMQAWL
FT                   TVEGLDLVTLGFLVLVAAPYTFKMLWAPLIDRFDVPWLGRRRGWIVFIQWMLGGALFLM
FT                   GSVSPVHELRLFAVVAVSVAALSATLDVVIDGYRTDLLEPHQRGLGGSLAVLGYRLAMV
FT                   LSGGIALIWAEQWHSWPQVYRVMGGFMFGGGLLSLLLMPRLSGRFVAPVTHGARELLGF
FT                   LALLVGVVVGALLSRYLFMMFGLDPGSKESWVRLLFVIGEISGGVLLGLLCIRFVRFET
FT                   LNRSLATYFQMQGALAFLGLVVLYKVGDAFALSLSTPFLINGAHFSQTEVGIANKTVGL
FT                   LMTIVGAVIGGFFLLRVRLSRALFWFGAMQLVSNLGFYALARVGAGFWGSSVIPSFNAL
FT                   IVHLEMPTEMDRLLLFVLSLENFSGGMGTAAFVALLSNLCNVRFSATHYALLSAFASLG
FT                   RVFVGPFAGVLADACGWQAFFLVSLLVGVPGLVIAWCMRTEIDAMSYRFPG"
FT   gene            complement(166388..167533)
FT                   /locus_tag="XfasM23_0123"
FT   CDS_pept        complement(166388..167533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0123"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   xac:XAC3899 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91580"
FT                   /db_xref="GOA:B2I6N8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N8"
FT                   /protein_id="ACB91580.1"
FT                   /translation="MPVHDDHCNPNPAPLYLGLMSGTSIDGIDAALVRINANPITHCEL
FT                   IAAQTSAWDPNLRTTLLELSQGQNTASLDQLGWLDAQVGLAFATAANTLIAKTGIKHTQ
FT                   IRAIGSHGQTIRHRPHGDLPFTWQLGDAHRIAELTGITTVADFRRRDVAAGGQGAPLMP
FT                   AFHLAILGSANENRAVLNLGGIANLTLIPMTGPVLGFDTGPANALLDSWYQRHHHETFD
FT                   QSGNFAASGKINQKLLACLLDDPWFTLPPPKSTGREQFHLDWMTKQLEPTPPSPADVQA
FT                   TLLELTAVTVADALLRQQPKTTRLLICGGGAHNPVLMARLATHLPNVTVESIQTYGLNP
FT                   DYLEAMGFAWLAAQTLDGQPSNLPSVTGARGLRLLGAIHPA"
FT   gene            complement(167597..169012)
FT                   /locus_tag="XfasM23_0124"
FT   CDS_pept        complement(167597..169012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0124"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: xac:XAC3898 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91581"
FT                   /db_xref="GOA:B2I6N9"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6N9"
FT                   /protein_id="ACB91581.1"
FT                   /translation="MQNAEHRHTHKQRIRERLHVLHVSTLHHKLKHTFPAAFNQRWTPR
FT                   HWIHMALFAMIGALIATIIPGLSNNSPPTQLSSLATLALPLPPQYTSTADTWRMVTIKP
FT                   GQTLSSIFNELKLSSNDMERVLNYADLRKVLTRLSPGDEISFDIPNDGQLRGMRFNRDE
FT                   KHRVELTIDDNTIHQQVSQRQTSTRTVIASGEIKSSLWIAAREAGLSPVDVITLTDEIF
FT                   KYDIDFDKDLQTGDRFSVVMDETWREGERLPDAKILAATFNTGGKIYSGIRFMRDGKVE
FT                   YFDKEGRPLKKSFIRMPISYARLSSTFGLRRHPILGTMRMHKGVDYAAATGTPIMAAGD
FT                   ARVQFIGQQRGYGNVVILNHGKGYRTLYGHMSRFGKIKAGQKINQGTVIGYVGMTGLAT
FT                   GPHLHYEFQVNGQHRNPLSITMPPPEPLRGKDLIAFRTQTAPLIAQIQQYEKRFYAITN
FT                   KHDSKSTEKSTRG"
FT   gene            169209..170465
FT                   /locus_tag="XfasM23_0125"
FT   CDS_pept        169209..170465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0125"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: xcb:XC_3925 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91582"
FT                   /db_xref="GOA:B2I6P0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P0"
FT                   /protein_id="ACB91582.1"
FT                   /translation="MSLVSNSIALIERGANEILKFDELERRLRSGRPLRIKAGFDPTSP
FT                   DLHLGHTVLLNKMRQFQDLGHQVVFLIGDFTGMIGDPTGKNVTRKPLSREDVLANASTY
FT                   EDQVFKVLDRTLTEVRFNSEWFEKMSAVDMIKLAAQHTVARMLERDDFAKRFASQQPIV
FT                   IHEFLYPLIQGYDSIALRADVELGGTDQKFNLLMGRALQEHHGQPPQIVLTMPLLEGLD
FT                   GVAKMSKSLGNYIGIKEPPIDIVTKTMKIGDDLMWRWIELLSFKISAAEAVALREAVAK
FT                   SELNPREVKLRLAHELVSRFYDNAAAEKAIAGWQAVVTGQGNNNLLPLQKINVPADGVR
FT                   LVALLTKSGLAPSNSEAMRKLKERAVRVDGIVVDDAHLHFVPGFEGLIQIGKRNFIKVR
FT                   LVTSSESQEFPESNRIDKS"
FT   gene            171063..172600
FT                   /locus_tag="XfasM23_R0009"
FT   rRNA            171063..172600
FT                   /locus_tag="XfasM23_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            172707..172782
FT                   /locus_tag="XfasM23_R0010"
FT                   /note="tRNA-Ala2"
FT   tRNA            172707..172782
FT                   /locus_tag="XfasM23_R0010"
FT                   /product="tRNA-Ala"
FT   gene            172796..172872
FT                   /locus_tag="XfasM23_R0011"
FT                   /note="tRNA-Ile2"
FT   tRNA            172796..172872
FT                   /locus_tag="XfasM23_R0011"
FT                   /product="tRNA-Ile"
FT   gene            173065..175947
FT                   /locus_tag="XfasM23_R0012"
FT   rRNA            173065..175947
FT                   /locus_tag="XfasM23_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            176079..176191
FT                   /locus_tag="XfasM23_R0013"
FT   rRNA            176079..176191
FT                   /locus_tag="XfasM23_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            176297..177112
FT                   /locus_tag="XfasM23_0126"
FT   CDS_pept        176297..177112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0126"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xac:XAC4286 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91583"
FT                   /db_xref="GOA:B2I676"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B2I676"
FT                   /protein_id="ACB91583.1"
FT                   /translation="MPELPEVETTLRGLLPYLTNQLIYSLTLRRRTLRWDIPSHIESRL
FT                   PGHRITTVCRRAKYLLIDTNAGGSLIIHLGMSGTLRLLAPETPLRPHDHVDIMLNNRRV
FT                   LRFNDPRRFGCLLWQEDGQIHPLLQRLGCEPLSDSFNGDYLYQCSRARNVSVKTFLMDQ
FT                   RIVVGVGNIYAAESLFRAGISPLCEADKISLQRYRRLAEVVKDILLYAINRGGTTLRDF
FT                   LSPDGRPGYFKQELFVYGRQQQPCKQCGSLLRQTTIRQRTTVWCGHCQG"
FT   gene            complement(177249..178091)
FT                   /locus_tag="XfasM23_0127"
FT   CDS_pept        complement(177249..178091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0127"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   xcb:XC_3049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91584"
FT                   /db_xref="GOA:B2I6P2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P2"
FT                   /protein_id="ACB91584.1"
FT                   /translation="MLLLVIIVFFTYFLAVWMLFCELLFNDISRRGEWRIPGLVGLLAH
FT                   GGYHFLVVLGNAGAVDMHFFSVLSMTFFVMSGLTILFSTHVGTVGVVVFPVAGLLLAVY
FT                   HGYGHSPSPELGWRVELHACLALLGYATLGIAALLAMMLWFRERALRRRNVHHWHGALP
FT                   PLTELEKLLFRTITFGFILLTFTVFTGFLFVRDFLEQKLLHKSVLSVLSWVIFGGLLIG
FT                   RWQYGWRGIKAVHWTLTAMMFLVLAFFGSKLMIELMLRHQSSSLSPVRHASYGEQGLR"
FT   gene            178538..180445
FT                   /locus_tag="XfasM23_0128"
FT   CDS_pept        178538..180445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0128"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xcc:XCC1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91585"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P3"
FT                   /protein_id="ACB91585.1"
FT                   /translation="MSSLLIRLLTLFIVTTLNLFLCLPAKAATHKSSELQTMQTHSKSK
FT                   NPMSVLLGKAEQLNLLYDKYWDDSMRLNPLQATLQGDAYHGDRMPNFLSAEFRKQHHDF
FT                   IEKWLKKVEMVGADGLDGQAFISYQIFVRDARNSLHAERYPNWMLPINQFYNIANVAVV
FT                   LGSGNGAQPFNTVQDYDNWAHRSLGIPALFNQAIVNMRLGMKSGVVQPKVLMEKVIPQL
FT                   DSIIKPTAEETLFWVPIRNMSVTFSKENRQRITAEYKSIIEYRLLPAYRALRNFIATEY
FT                   LPVCRDSVGLSALPGGASWYAYTVRQSTTTNMTPEQIHQLGLKEVERLQAEIQSVMRQL
FT                   NFNGSMQKFFSFMQNNEYFTFGSEKEMLAYYRDLRTRVEARVPALFSLVPKAGFEILPV
FT                   ESFRAPSAAAGSYMPPSSNRRHNGVFYANTNDLSSRRTWNAEKLFLHQGIPGYHFQLGL
FT                   QQELRNLPKFRRLGGETAFIEGWGLYAESLGKELGLYQDAYNYFGYLQDALSRAIRLVV
FT                   DTGLHTKGWTRAQVVDYIVENSATSPIEAEAEVDRYIAIPGQALAYKVGELKIHQLRQY
FT                   AQLTLGPMFDLREFHAEILKDGSVPLDILQQKIERWIAVKRVNMRSISHQKSRDQRRKS
FT                   "
FT   sig_peptide     178538..178621
FT                   /locus_tag="XfasM23_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            complement(180844..181584)
FT                   /locus_tag="XfasM23_0129"
FT   CDS_pept        complement(180844..181584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0129"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: xcv:XCV4178
FT                   3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91586"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P4"
FT                   /protein_id="ACB91586.1"
FT                   /translation="MITDDSPRFRALVTGGSGNLGTAICRQLIADGAHVIVHANHHRSR
FT                   ADTLVECLCAEGGSAEVIVFDVTAAQASKTALENLLQAGPIQIIINNAGIHDDAPMAGM
FT                   SSTQWHRVIDVSLHGFFNVTQPLLLPMARTRWGRIVCISSVTAVLGNRGQSNYAAAKAG
FT                   LHGAARSLAREMANRGITVNVVAPGVIESEMVGKTFTPEMIKQLVPTGRPGRPEEVAAL
FT                   IGFLCSEKAGYINGQVIGINGGMV"
FT   gene            182131..183735
FT                   /locus_tag="XfasM23_0130"
FT   CDS_pept        182131..183735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0130"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   xcv:XCV3179 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91587"
FT                   /db_xref="GOA:B2I6P5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6P5"
FT                   /protein_id="ACB91587.1"
FT                   /translation="MSEVVAETARRRTFAIISHPDAGKTTLTEKLLLFGGAIQMAGSVK
FT                   SRKAVRHATSDWMTLEKERGISVTSSVMQFPYEGKIINLLDTPGHADFGEDTYRVLTAV
FT                   DSALMVIDVAKGVEERTIKLMEVCRLRDTPIMTFINKLDREGKNPIELLDEVERVLGIQ
FT                   CAPVTWPIGMGKRLRGVVNLLTNEVHLYEPGRNFTRQDSIIFTSLEAPGLAERIGEQML
FT                   ADLHEELELIQGASACFDPTEYLGGRQTPVFFGSGVNNFGVQPLLDFFVEHAPSPQQRD
FT                   TTSRVVLPTEEKLTGFVFKIQANMDPQHRDRVAFMRVCSGRFTAGMKAFHVRSSKDLKL
FT                   ANALTFMASDRESVAEAFPGDVIGIHNHGRVSIGDTFTEGEVLSFTGIPSFAPELFRRA
FT                   CLGDPLKLKQLQKGLTQLSEEGATQFFRPLMSNDLILGAVGMLQFDVVAYRLKNEYGVD
FT                   ATFEPVSITTARWVYCDNSKTLEEFREKNVTNLAVDASGELVYLAPTRVNLQLAQERAP
FT                   EIHFFATREHAYAVGVD"
FT   gene            183818..184462
FT                   /locus_tag="XfasM23_0131"
FT   CDS_pept        183818..184462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0131"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: xcv:XCV3180
FT                   hemolysin-III family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91588"
FT                   /db_xref="GOA:B2I6P6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P6"
FT                   /protein_id="ACB91588.1"
FT                   /translation="MNANAHSSIDSRDELASAIIHGLGALATLAAGSVLITLVSIYGDR
FT                   WQLLTSIVFSTTLFLLYVASTLYHAIPHPGAKARLRVFDHCAIYLLIAGTYTPFTLITL
FT                   RGPWGWGLFATIWTLALSGVVFKLFFTERFRLLSTIVYVVMGWLVVIALGPLQRLLDGW
FT                   TLRWLLAGGVLYTLGTYFYHRDEVRYFHAIWHVFVLAGSVCHFIAVTAQVL"
FT   gene            complement(184687..185838)
FT                   /locus_tag="XfasM23_0132"
FT   CDS_pept        complement(184687..185838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   xcv:XCV3183 putative bactoprenol glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91589"
FT                   /db_xref="GOA:B2I6P7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P7"
FT                   /protein_id="ACB91589.1"
FT                   /translation="MPLSNMLDLDTLNAVTLIRLEEKPGRSISSSPAVADGRIAPVPYN
FT                   DMNRECLTVVVPAYNEAQTLPLLHLRIVAALNTLPELDGRLLYVDDGSNDRTWDIIEAL
FT                   VVNDTRVGGIKLSRNFGKEIAITAGLDNTPFGAVLLLDADGQDPPELIPQFVARWRAGY
FT                   DNVYGTRLERQGEGLIKRFLAASFYRMIGRLSPTPIPTDTGDFRLLSPRALQALRQIRE
FT                   RHRFMKGLFGWVGFRQIALPYRREPRLSGRSKFTFWRLWNFALEGITSFSTAPLRVTTY
FT                   LGLITAVFAFGYGVWIVLKALILGDRVPGWPTMMTVILLLGGVQLIALGLIGEYLGRLY
FT                   DESKRRPLYFIDTAAGIAECHPQQIIDGKIPQNTASIVDCEQQ"
FT   gene            complement(185971..186753)
FT                   /locus_tag="XfasM23_0133"
FT   CDS_pept        complement(185971..186753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0133"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   xcv:XCV1526 putative TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91590"
FT                   /db_xref="GOA:B2I6P8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P8"
FT                   /protein_id="ACB91590.1"
FT                   /translation="MNVVLIDSHCHLDADTFDGDRAEIIARARAAGIIAQVIPAVTAAK
FT                   WPKLRTICTQTSGLYPAYGLHPMFLTEHHPTHLHALRDWLERERPCAIGECGLDFYLEG
FT                   LNREMQHTYFISQLMLAREYTLPVIVHARHAVEEVIASIKTVGTLRGVVHSFSGSLEQA
FT                   RQLWKLGFMISLGGAMTYPRAHRLHRLAMETPLDCLLLETDAPYQPDSEIRGKRNEPGR
FT                   LLTILDYIATLRKQDRTEISKVTRANTEQLFGLKVTST"
FT   gene            187101..187874
FT                   /locus_tag="XfasM23_0134"
FT   CDS_pept        187101..187874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0134"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: xom:XOO_1407
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91591"
FT                   /db_xref="GOA:B2I6P9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6P9"
FT                   /protein_id="ACB91591.1"
FT                   /translation="MNNQMRIVLIALGALLLGGVATAAFMNNRGHDAGYMANRHSDSHT
FT                   AFEYADIIRVDTITEKKTLYAQVVSVDPIRDTARMMAPREICRDVLVQHHLPERDGNVG
FT                   GTAIGALIGGLVGNQFGHGNGRKALTAAGAVAGGFIGNEVDREHVGGRVVERIERRCHS
FT                   ENSMVQSSHVSGYTVIYRKDDGTTGTLHMANRPGDHVELGQTDNVVGYDVTYLYNGQEK
FT                   TVRLNEKPLGNQLPLVDGHLVNHTTATADHSVNIQ"
FT   sig_peptide     187101..187172
FT                   /locus_tag="XfasM23_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 24"
FT   gene            complement(190513..190908)
FT                   /locus_tag="XfasM23_0135"
FT   CDS_pept        complement(190513..190908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0135"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: xom:XOO_1698 glycine
FT                   cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91592"
FT                   /db_xref="GOA:B2I6Q0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6Q0"
FT                   /protein_id="ACB91592.1"
FT                   /translation="MSDIPGDLKFLKSHEWVRIEDNNRAIVGVSDHAQNLLGDLVYVEL
FT                   PNIGDHLDAGATAAVIESVKAASDIYSPVTGKVIEVNTTLSDKPETINEDPYGEGWIMV
FT                   IEMQAPEEISNLLSPDDYTEVLESDEH"
FT   gene            complement(191439..192545)
FT                   /locus_tag="XfasM23_0136"
FT   CDS_pept        complement(191439..192545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0136"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: xcv:XCV3196
FT                   glycine cleavage system aminomethyltransferase T"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91593"
FT                   /db_xref="GOA:B2I6Q1"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6Q1"
FT                   /protein_id="ACB91593.1"
FT                   /translation="MIKKTILNDTHQALGAKMVDFSGWEMPIHYGSQIDEHHHVRRNAG
FT                   IFDVSHMTVIDLHGTQVRPLLRRLLANSVDKLKVPGKALYSCMLNPQGGVIDDLIVYYL
FT                   REDYFRFIVNAATREKDLAWINTQASAFNVRVEERADLAMLAVQGPAARAQVTNLLAET
FT                   HRDAVEKLGRFAALEVASHSKKPLFISRTGYTGEDGFEILLPQEETITLWNALLKTGVK
FT                   PIGLGARDTLRLEAGMNLYGQDMDEQVSPYEAALGWTVMLDEGRNFIGRNVLEQQKTNG
FT                   VSRQMIGLLMDEKGVLRHGQKVLTAQGEGHILSGTFSPTLNKAIGFARVPAGKPSEVRV
FT                   NIRDREIPVRVVKFPFVREGQTQPNIFD"
FT   gene            complement(192697..193128)
FT                   /locus_tag="XfasM23_0137"
FT   CDS_pept        complement(192697..193128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0137"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   xcb:XC_1231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91594"
FT                   /db_xref="GOA:B2I6Q2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q2"
FT                   /protein_id="ACB91594.1"
FT                   /translation="MRWDAMGWAAAALLLLAAETLIPGAFMLWMGIAAAAVFVGVLLLP
FT                   DISLLLQMFAFVVLSFVSIYLYRTWFRHIDHDSDHPLLNRRADQLVGRIIILDHAIVDG
FT                   NARIKIDDTFWDITGPDLPIGTQIRIVALDGTTLKVHPT"
FT   sig_peptide     complement(193021..193128)
FT                   /locus_tag="XfasM23_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.621 at
FT                   residue 36"
FT   gene            complement(193132..194088)
FT                   /locus_tag="XfasM23_0138"
FT   CDS_pept        complement(193132..194088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0138"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: xcb:XC_1230 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91595"
FT                   /db_xref="GOA:B2I6Q3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q3"
FT                   /protein_id="ACB91595.1"
FT                   /translation="MLQSNVLAFIVLVAGVILLFKSVIMVPQGYEWTVEKFGRYTHTMK
FT                   PGLHFLIPLIYSVGRKVSMMEQVLAVPSQEVITKDNAGVRVDGVVFFQVLDAAKAAYEV
FT                   ANLEIAMIALVQTNIRTVVGSIDFDESLSQRETINAKLLSVVEHATSPWGVKVTRIDIK
FT                   DIQPPHNLAESMQQQKMAEQTRRATILEAEGVRQSAILRADGEKQAAVMEAEGRKEAAF
FT                   RDAEARERLAEAEAKATRILSEAISQGNVQAVNYFVAQKYVEAFKELAAAPNQKFILMP
FT                   METSGIIGSIAGIADLTREALGKSDHSATPSQRPHRG"
FT   gene            complement(194423..195256)
FT                   /locus_tag="XfasM23_0139"
FT   CDS_pept        complement(194423..195256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0139"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: xcb:XC_1228 nucleoside
FT                   triphosphate pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91596"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q4"
FT                   /protein_id="ACB91596.1"
FT                   /translation="MSDLPDASPHIETLLSIMARLRDPIRGCPWNLEKDFTTIAPYTIE
FT                   EAYEVVDAIDRNDLNALKDELGDLLLQIIFHSHMAAEQGAFEFTDVITAITDKMVRRHP
FT                   HVFGDITVDGAETVSTHWEAIKRQEREAVNEQDHSALFGISSGLPEWLRALKLQERATR
FT                   AGFKQAAPIPAIVEMQKTLEQIRQTFLMDTVTHNKAQIEEIFGNLLFICIQLAHHAKVD
FT                   PGNALRHTNIQFEKQFRAMEKTAQAAGATLAQMSLSEQQTLWNTVNRQETDPSAP"
FT   gene            complement(195290..196090)
FT                   /locus_tag="XfasM23_0140"
FT   CDS_pept        complement(195290..196090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0140"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: xcv:XCV3200 sulfite
FT                   synthesis pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91597"
FT                   /db_xref="GOA:B2I6Q5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q5"
FT                   /protein_id="ACB91597.1"
FT                   /translation="MITIPSDLHESVIAIATDSGRAIMKIYQDHFKVQIKADMSPLTQA
FT                   DLISHQIIVHGLKQLTPSLPVLSEESTGITWEERRHWKSYWLVDPLDGTREFVKRNGEF
FT                   CINIALIHEGIPVYGMILAPVEGTIWHAMHGGQAFRRDGHRDTTLHVRAPAGTALQVAA
FT                   SRSHIDVHTSALLAQMKEITLVSQGSALKFCRLAEGTLDVYPRLGATYEWDTAAGQCLL
FT                   LAAGGTLLNIETGKPFRYNKRETLLNGGFIALGDATLPWRDWLP"
FT   gene            complement(196087..196635)
FT                   /locus_tag="XfasM23_0141"
FT   CDS_pept        complement(196087..196635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0141"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xac:XAC3067 ADP-ribose
FT                   diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91598"
FT                   /db_xref="GOA:B2I6Q6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q6"
FT                   /protein_id="ACB91598.1"
FT                   /translation="MNRPLPMIHRIEEIGDSQFRRQQLDLEFSNGERRLYQRHVARGYG
FT                   AVVVVPLLDPQTVLLVREYAAGIHRYELGLVKGRIDANETPEQAADRELKEEAGYGARD
FT                   LRVLRAITLVPGYMNHQSWLVIASDLYPERLVGDEPEEIEVIPWKLSKLHDLMLREDFS
FT                   EGRSLAALFIVREWLEHQQ"
FT   gene            196677..198134
FT                   /locus_tag="XfasM23_0142"
FT   CDS_pept        196677..198134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0142"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   xcv:XCV3202 adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91599"
FT                   /db_xref="GOA:B2I6Q7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q7"
FT                   /protein_id="ACB91599.1"
FT                   /translation="MHHNVHQSEILADPCDLQRAERWRQRDLRVLWHPCTQMREHPDTL
FT                   PLVPIVRGEGVWLVGHDGRRYLDAVSSWWTNLFGHADPRISAAIAAQARTLEHVMLAGF
FT                   SHEPAVRLAEALLRLAPRQDGREPLSKVFYADNGSAGVEVALKMAFHYFRNRGEEQRTR
FT                   FIALHNGYHGETIGALAVGDIPLYRRVYAPLLTEVLFAPSPDAYLAEPGQSAAEYALQA
FT                   AEALEALFKRYSGQICALILEPLLQCAGGMRMHHPVYLHRVRELCDAHGALLICDEIAT
FT                   GFGRTGTLFACEQACSAISTDTDDKDLGIMPDLLCLSKGLTGGFLPLAAVLTTQQLYEE
FT                   FLDDSRERAFLHSHSYTGNPLACIAALTTLDIFENDCIIERNQVTAARMTQLAASLSGH
FT                   PHVADVRQTGMVVAFELTRDGNKRTPFPPQARLGLHVYRAALARGVILRPLGDVVYWMP
FT                   PYCVDEQQLHLLAETTRVAIDEAIACV"
FT   gene            198131..198859
FT                   /locus_tag="XfasM23_0143"
FT   CDS_pept        198131..198859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0143"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   xac:XAC3069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91600"
FT                   /db_xref="GOA:B2I6Q8"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q8"
FT                   /protein_id="ACB91600.1"
FT                   /translation="MSRCHVNVPLILGNEIILPELVANHLLRVLRLCEGDTCVLFNGDG
FT                   HDYLARLIATGRREAWARIEGVSEVCNESPLAITLVQAITRGEKMDLIVQKATELGVVA
FT                   IVPVDTERSGVRLDSERVAKRLAHWNNVVISACEQCGRTRVPEVQMPRALQVLPEILDP
FT                   DTLRLILDPKSEHRLSTLSRLTPVEVIIAIGPEGGWSPRDLEILKDAGFIGFSLGPRIL
FT                   RTETAGLTAIAVLQAQLGDL"
FT   gene            198988..199215
FT                   /locus_tag="XfasM23_0144"
FT   CDS_pept        198988..199215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91601"
FT                   /db_xref="GOA:B2I6Q9"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6Q9"
FT                   /protein_id="ACB91601.1"
FT                   /translation="MRDEMMSDVGISDSRQDASGHHIGHKVITESVTPSHEWSVCKDGL
FT                   LGIFIFILLDLMFFVFVIMRSHTLKVRMLV"
FT   gene            200462..201802
FT                   /locus_tag="XfasM23_0145"
FT   CDS_pept        200462..201802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0145"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   xac:XAC3610 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91602"
FT                   /db_xref="GOA:B2I6R0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R0"
FT                   /protein_id="ACB91602.1"
FT                   /translation="MNFETLGLLPSLLRALSEQGYEIPTPIQQQAIPLALAGHDLLAAA
FT                   QTGTGKTAAFGLPVLQRLMAASSNVGAGKPRALVLTPTRELATQVHDSLRGYAKYQRVS
FT                   SAVIYGGVGMGNQLDVLRRGVDLLIACPGRLIDHIERRSVDLSGVGILVLDEADRMLDM
FT                   GFLPSIKRILGKLPRQNRQTLLFSATFAEPIKQLALEFMCRPREVMVASHNTVAETITH
FT                   RVHPVDVSRKRELLLYLLAQDSREQTLVFVRTKHGSDKLATFLEKYGIKTAAIHGNKTQ
FT                   GQRLRALNSFKAGRVTVLVATDIAARGIDIDQLPKVINYDLPMVAEDYVHRIGRTGRNG
FT                   VQGEAISLVTQEDAKLLRQIVRLLDRDMDIRDVPDFEPQVPIRWGNSAPGKSKQPAGQH
FT                   PPRKSQHRRAFGKASVHTTPALKKQSGVQHSNGSRNRDGMLPVHQRG"
FT   gene            201883..202239
FT                   /locus_tag="XfasM23_0146"
FT   CDS_pept        201883..202239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0146"
FT                   /product="queuosine biosynthesis protein QueD"
FT                   /note="TIGRFAM: queuosine biosynthesis protein QueD; PFAM:
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein; KEGG: xac:XAC3614 6-pyruvoyl tetrahydrobiopterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91603"
FT                   /db_xref="GOA:B2I6R1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R1"
FT                   /protein_id="ACB91603.1"
FT                   /translation="MDIFKVFIIEAAHRLPHVPPGHKCARLHGHSFRIEVHVSGALESD
FT                   TGWIMDFSDLKRAFQPIYDQLDHHYLNEIEGLENPTSERLAIWVWDRLKPVLPALTEIV
FT                   VHETCTSGCRYRGG"
FT   gene            complement(203318..203842)
FT                   /locus_tag="XfasM23_0147"
FT   CDS_pept        complement(203318..203842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91604"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R2"
FT                   /protein_id="ACB91604.1"
FT                   /translation="MTTLQRLRCLALFIAITIAMPLVATATPPSDADVNRLLSVSRMQA
FT                   IHDSMIPQLETMEEKQFDQMAAKHTLSTEEKAKMVQILERSKQRIRKAMSWSELEPVYI
FT                   DLYKHSFSREDVLAMTKFYESSAGQSLLDKTPVLMQNLMVAIQKKMAPLTDDLMQDLEK
FT                   IDNAPKQDHKK"
FT   sig_peptide     complement(203762..203842)
FT                   /locus_tag="XfasM23_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 27"
FT   gene            204373..205002
FT                   /locus_tag="XfasM23_0148"
FT   CDS_pept        204373..205002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0148"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   xom:XOO_0317 acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91605"
FT                   /db_xref="GOA:B2I6R3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R3"
FT                   /protein_id="ACB91605.1"
FT                   /translation="MIQTEPTLPPVTQIDPLREAFPENMPCMHGPLVRWLGRTVLKLGG
FT                   WRLIGRLPNQGKVVIIVAPHTSYWDGFFGFACKFAVGVEMRSLIKSSLFWWPLGALLRW
FT                   VGCIPLDRRLPQGTVSQAVRAFRDSERMWYMLAPEGTRKRVERWKHGFWKIAKYADVPV
FT                   LPVYMDYPSKTIGIGDLFWPSDDMEADIAAIRAWYSPCRAKHSNRV"
FT   gene            complement(205601..206308)
FT                   /locus_tag="XfasM23_0149"
FT   CDS_pept        complement(205601..206308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0149"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   xcb:XC_2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91606"
FT                   /db_xref="GOA:B2I6R4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R4"
FT                   /protein_id="ACB91606.1"
FT                   /translation="MSADPSSLPQRPSLQRIFLTGLLTLLPVWLTWVVVKFVFSLLSGF
FT                   SSPWVVPLSERIAASFPGYLGWIQALWVQNTIALGVTLLAILFVGTLSRRMIGQRLLRW
FT                   FEAIMRRIPFASVIYDSARKLLDILQTQPGSTQRVVLIDFPHRDMKAVGLVTRVIRDRD
FT                   TGQELAAVYVPTTPNPTSGYLEIVPVEQLTPTNWSVDQAMSFIISGGAVSPDSIPFSRT
FT                   TDQDEDGAKSPRL"
FT   gene            complement(206599..207198)
FT                   /locus_tag="XfasM23_0150"
FT   CDS_pept        complement(206599..207198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0150"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: xcb:XC_2884
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91607"
FT                   /db_xref="GOA:B2I6R5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R5"
FT                   /protein_id="ACB91607.1"
FT                   /translation="MSNTGKSYDDRYFDQWYRQTKLSSPARLRRKVALAVSQAEYYLER
FT                   PIRSVLDIGCGEGAWRKPLLRLRRHIHYLGFDSSHYAVNRYGLQRNLHIAQIGDFSWLR
FT                   PCAPVDLLVCADVLHYVATRELTRALPGFVELCNGVAFLEIFTAEDAFEGDTIGFQSRQ
FT                   ARWYRRRFTAAGFTALGSHCWLSPVLAGHTTALEHN"
FT   gene            207263..207715
FT                   /locus_tag="XfasM23_0151"
FT   CDS_pept        207263..207715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   xcb:XC_2883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91608"
FT                   /db_xref="GOA:B2I6R6"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R6"
FT                   /protein_id="ACB91608.1"
FT                   /translation="MALYFWVKTFHLLFVIAWMAAVFYLPRILVNVAETDGQPAVQARL
FT                   RQMGRRLYIFGHIMFGLSGLLGVLLWLGYRVIPAFPTMVGDGSGWLHAKVGLVVLILVH
FT                   YIVAGYWLKRVERGGVLPGAGALRVFNEIPVLVLIGILWLVFAKPF"
FT   gene            complement(207881..208840)
FT                   /locus_tag="XfasM23_0152"
FT   CDS_pept        complement(207881..208840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0152"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="2.7.7.72"
FT                   /note="KEGG: xom:XOO_1851 acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha; TIGRFAM: acetyl-CoA
FT                   carboxylase, carboxyl transferase, alpha subunit; PFAM:
FT                   acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91609"
FT                   /db_xref="GOA:B2I6R7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6R7"
FT                   /protein_id="ACB91609.1"
FT                   /translation="MNPNYLDFEQPIADLEAKIQDLRTASAGPSVNVDIEVRALENKLR
FT                   LRTAQIFRNLSAWQISQLARHPRRPYTLDYISIVCDEFQELAGDRTLADDKAIVGGLAR
FT                   IGHRPVMLIGHQKGRDNKERLMRNFGMPKPEGYRKALRLMKLAERFGLPLLTFIDTMGA
FT                   WPGIDAEERNQSEAIATNLIEMAELKIPVICTVIGEGGSGGALAIGIGDRTLMLEYSTY
FT                   SVITPEGCASILWKDAAKASDAAEQLNLTARRLKEFGLIDKVIREPIGGAHRNPQQMAN
FT                   RLKAVLLNELEALDKVPLVTLLNQRHKRLRTYGAYENH"
FT   gene            complement(208935..212516)
FT                   /locus_tag="XfasM23_0153"
FT   CDS_pept        complement(208935..212516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0153"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xcb:XC_2880 DNA polymerase III subunit alpha;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: PHP
FT                   domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91610"
FT                   /db_xref="GOA:B2I6R8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6R8"
FT                   /protein_id="ACB91610.1"
FT                   /translation="MSTSSFVHLHIHTEFSLADSTIRVPEKPEQAHPKKAKQANLLSRA
FT                   VELGLPALAVTDLNNLFALIKFYKAAETVGIKPISGADLLIAEPEHPPWGMTLLCRDHA
FT                   GYLNLSQLISRGWLEGHRPEGGVAVHPDWVRDHHKNLFALIGRHSLAGQLLAKGRADLA
FT                   EQQLADWQHVFGDGLHLELTRTGRDGEEPFNQFALQVAGIRGIPVIASNDVRFLVQSDF
FT                   LAHEARVCIASGRMLDDPKRPRTYSEQQYLRSSEEMAALFADIPDALDNTRTLAQRCNI
FT                   EMRLGTYFLPNYPVPNDETLDSWIRKQSHEGLEARLLKHPLAPGQTREDYVTRLEFELD
FT                   TIIKMGFSGYFLIVADFIQWGKQQGIPIGPGRGSGAGSLVAWALLITDLDPLPYNLLFE
FT                   RFLNPERVSMPDFDIDFCMERRDEVISYVARKYGRERVSQIITYGTMAAKAVVRDVGRV
FT                   LGFPYGLVDSVAKLIPSTLGITLKDAMGEGETNDNASAELIQRYQAEEDVQELLNLARQ
FT                   LEDLTRNAGKHAGGVVIAPNPLTEFCPLFAEHDENGRGKNPVTQFDKNDVEEVGLVKFD
FT                   FLGLRTLTIIDWAVKAINKRHARACIDPVDITALPLDDIPTYKDVFASGNTSAVFQFES
FT                   SGMRRLLKDARPDRFEDLIALVSLYRPGPMDLIPEFTARKHGVQETIYPDPRTKNILKD
FT                   TYGIMVYQEQVMQMAQIVGGYSLGSADLLRRAMGKKVPAEMAKHREIFREGAAKGGMDA
FT                   VKADEIFDLMEKFAGYGFNKSHAAAYALVSYQTAWLKRHYPAEFMAATLSSDMDNTDKV
FT                   VGFLDEARNLNLKVLRPNINHSAYMFEATHADTIQYGLGAIKGVGQSVCEAIVKERLHY
FT                   GPYTSLLDFCTRVTSAKLNRRALEAMIHAGALDELGKNRASVMLQLPEVIKATEQMSRE
FT                   RESGQNSLFGNADPGTPVIQLDLPECEEWPLTRMLNGERETLGLYFSGHPFDPYRKQVK
FT                   ELVGCDLNTSALERILGSQQRGNGEKRTWQPEVNTILAGLVVSVRRKGDSQVFVQLEDG
FT                   RGRIECSAFSDALAEFGHLLTRDRILIVKGGLREDEFNGGYSLRIRQCWDYAQLCTDYA
FT                   QRLLLRVDLRTSHAWERIDAILARYRPGNTPLRLDLLLNSTHGPVAGTLDLSGGQSVRI
FT                   EQSLLDKLQKDPAVSKLKVKYTPPWVQ"
FT   gene            complement(212805..213731)
FT                   /locus_tag="XfasM23_0154"
FT   CDS_pept        complement(212805..213731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0154"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: xom:XOO_3829
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91611"
FT                   /db_xref="GOA:B2I6R9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6R9"
FT                   /protein_id="ACB91611.1"
FT                   /translation="MLTTLLQSDLPGLPLRHCGKVRDVFDIPRKRLPVDTRSGEYLLIV
FT                   ATDRLSAFDVVLPDPIPGKGEILCQISNFWFQKTEHLMPNHLTGINVASVLPDGIDKTL
FT                   YIQRAVVTKKLKPVGIEAIARGYLIGSGWKDYQRTGKVSGIQLPDGLQEAEKLPDPIFT
FT                   PSTKAAVGHHDENIDFDTTVKMVGAELAERVRDATLRIYHFAAKYAAECGILLADTKLE
FT                   FGTDIDGRLYVMDEMLTPDSSRYWPIDEYQVGTSPPSYDKQLVRNYLETLDWDKTAPGP
FT                   TLPQDIIDRTRAKYTEALQRLAGINID"
FT   gene            214229..214597
FT                   /locus_tag="XfasM23_0155"
FT   CDS_pept        214229..214597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0155"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   xcb:XC_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91612"
FT                   /db_xref="GOA:B2I6S0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S0"
FT                   /protein_id="ACB91612.1"
FT                   /translation="MSPLNSLVGSPFVMHWYGKLFGFIIGALLFRPNPVFGVLIGVLIG
FT                   HAVDKRRLRHPEDDPYRVMGLGAGATNAEIELAYRRLMSRYHPDKLAQASPQLREQAEQ
FT                   KVRQINAAYDRIQRRCRR"
FT   gene            214642..215313
FT                   /locus_tag="XfasM23_0156"
FT   CDS_pept        214642..215313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0156"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   xcv:XCV0502 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91613"
FT                   /db_xref="GOA:B2I6S1"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S1"
FT                   /protein_id="ACB91613.1"
FT                   /translation="MSNCLIAPSILSADFARLGAEVDAVLAAGADWIHFDVMDNHYVPN
FT                   LTFGPMVCKALRSYGITAPIDVHLMVEPVDRIVPDFAQAGASMISFHMEASRHVHRTIQ
FT                   LIKSHGCMAGLVFNPATPVDMLDWVLPELDLVLLMSVNPGFGGQRFIPGTLDKLRLVRK
FT                   KIDLLGRPVRLQVDGGVGIDNIGAIAEAGADTFVAGSAIFHARDYADVVAQMRAAVAAV
FT                   R"
FT   gene            216182..217687
FT                   /locus_tag="XfasM23_0157"
FT   CDS_pept        216182..217687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0157"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: xoo:XOO4049 anthranilate synthase component I;
FT                   TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91614"
FT                   /db_xref="GOA:B2I6S2"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S2"
FT                   /protein_id="ACB91614.1"
FT                   /translation="MLSVSGRKVALITAMQFQRQVAEGCTRIPVVREVQSDLDTPLSIY
FT                   LKFADAPYTYLFESVEGGEHFARYSIIGLPARRVYTFHGHTLVVSEFGKVLETRQVADP
FT                   LAEVELLRAQYVVPQLEGLPGFTGGLVGWFGFECIQYIEPRFMGGKKRDELGTPDILLM
FT                   LSEEFAVFDSLKGRLYLIVHADPAQPHSYVRAMKRLDALIHRLRQGGMDYPHSHISEVI
FT                   NEEDFHSSLTREQYHAVVRKAQEYVRSGDIFQVVPSQRLCTQFHARPIDVYRALRTLNP
FT                   SPYMYFIDIGATQVVGSSPEILARLQGDVVTVRPIAGTRPRGATPEHDKRLEMELLADP
FT                   KERAEHVMLIDLGRNDIGRVVEAGSVQVKESFVIERYSHVMHIVSEVTGILKPGLNYVD
FT                   VLRATFPAGTVSGAPKIRALEIIRELEPVCRNVYSGAVGYIGWHGDADTAIAIRTAVIQ
FT                   NGCLYVQAGGGVVYDSDPDLEWQETMNKARALFRAVAQAARGL"
FT   gene            217845..218429
FT                   /locus_tag="XfasM23_0158"
FT   CDS_pept        217845..218429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0158"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   xcv:XCV0514 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91615"
FT                   /db_xref="GOA:B2I6S3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S3"
FT                   /protein_id="ACB91615.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYLQTLGAEVMVIRNDAMTVEQIAALKPE
FT                   RIVISPGPCTPNEAGVSLKLIEQLGSSTPILGICLGHQSIGQAYGGDVIRATNIMHGKT
FT                   SAIYHNGKGVFVGLPNGYDATRYHSLVVDKTTLPDVLEVTAWTENQDGTIEEIMGLRHR
FT                   EYFVEGVQFHPESILTAHGHALLKNFLEHPL"
FT   gene            218498..219532
FT                   /locus_tag="XfasM23_0159"
FT   CDS_pept        218498..219532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0159"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: xac:XAC0480 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91616"
FT                   /db_xref="GOA:B2I6S4"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6S4"
FT                   /protein_id="ACB91616.1"
FT                   /translation="MSMTAQKALQRIVEHREILQDEMVQLMRQIMNSEVSGIMVAAILA
FT                   GLRVKKETVGEIAGAATVMREFSRKVNVQDRTHLVDIVGTGGDGWHTFNISTCAMFVAA
FT                   AAGAKVAKHGNRSVSSKSGSADVLEALGASIELQPLEVAEAIGCIGVGFMFAPIHHPVM
FT                   QVVSPVRREMGVRTIFNILGPLTNPADAPNILMGVFDPDLVGIQVHVLHKLGAERALVV
FT                   CGRDGMDELSLGTTTLVGELRGGRVCEYEVSPEDYGMAVSPISNLRVESSAESREMLLN
FT                   VLAGKPGPALDVVALNAGAALYVAGVAQDIGHGVALAREVIFNGRARNILNQYVAFTRR
FT                   PRNV"
FT   gene            219611..220405
FT                   /locus_tag="XfasM23_0160"
FT   CDS_pept        219611..220405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0160"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   xac:XAC0481 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91617"
FT                   /db_xref="GOA:B2I6S5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6S5"
FT                   /protein_id="ACB91617.1"
FT                   /translation="MSNILTKILARKVEEIAERLLHVSQAELVARCADLPTPRGFAAAL
FT                   QATIAHGDPAVIAEIKKASPSKGVLREDFRPAEIAISYELGGASCLSVLTDVHFFKGHD
FT                   DYLSQARDACTLPVLRKDFTIDPYQVYEARVLGADCILLIVAALDDAQLVDLSGLALQL
FT                   GMDVLVEVHDIDELERAIQISAPLIGINNRNLSTFNVSLETTLTMKGLVPRDRLLVSES
FT                   GILTSADVQRLRAAGVNAFLVGEAFMRAAEPGESLREMFFIT"
FT   gene            220402..221124
FT                   /locus_tag="XfasM23_0161"
FT   CDS_pept        220402..221124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91618"
FT                   /db_xref="GOA:B2I6S6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S6"
FT                   /protein_id="ACB91618.1"
FT                   /translation="MSALSPSLREDAPLVVFDFDHTLYDGDSGSDLFAWLMLRNPLRLL
FT                   VALLVTPLLGPLVAMLATRRRSLSCYVWIATFGMRYTHEFNKVIRDYVRGHASQIRKRL
FT                   LPKALEVFASHRIAGDCVVVATGAPPELVREILALVADQQEVVPVIGSSIVPRLGAIIV
FT                   ARHCHHEEKMRMLREQGYGDVAVAYSDSTADLPLLMAAKVPVVVNPKPKREKLFRRVLQ
FT                   PGTSIIHWGCPRRGGACD"
FT   gene            222117..222623
FT                   /locus_tag="XfasM23_0162"
FT   CDS_pept        222117..222623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0162"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: xcb:XC_2827
FT                   transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91619"
FT                   /db_xref="GOA:B2I6S7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S7"
FT                   /protein_id="ACB91619.1"
FT                   /translation="MESLETTDLRLAVTCQRFPAYSRNQAVLLGLVKHIYKRIHTDCNR
FT                   FLRRFGLSYPEYDILMIIYGTEDFSLTPTEVAESSGEKPANVTRLTNSLCEKGLIRRSI
FT                   HHNDRRKVTLTLEPAALELLDKALPEACVQMEAQVCNLSEQENQELEHLLKKMLSMIDN
FT                   STDKQ"
FT   gene            complement(223102..223177)
FT                   /locus_tag="XfasM23_R0014"
FT                   /note="tRNA-Ala4"
FT   tRNA            complement(223102..223177)
FT                   /locus_tag="XfasM23_R0014"
FT                   /product="tRNA-Ala"
FT   gene            224328..224540
FT                   /locus_tag="XfasM23_0163"
FT   CDS_pept        224328..224540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91620"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S8"
FT                   /protein_id="ACB91620.1"
FT                   /translation="MMNRDTELSRFSDYRAGHLLNSGMVLARCLIIAQVTELAAMLEVL
FT                   FQALCDGIACCLDGGWSNVRVRGCI"
FT   gene            224537..225739
FT                   /locus_tag="XfasM23_0164"
FT   CDS_pept        224537..225739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0164"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: xcb:XC_1703
FT                   proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91621"
FT                   /db_xref="GOA:B2I6S9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6S9"
FT                   /protein_id="ACB91621.1"
FT                   /translation="MSIQIGHLTFEQAHAQLAPWAQRAPAITVNEYAQRIEQARVLMRI
FT                   QGVDALLVGAGASLRYFTGVPWHASERLVALLILLSGDPLLICPVFEEGSLDAVLLLPV
FT                   GKRLWEEHEDPYALVAQAMREHGARTLALDSGATFAVHTGLCRHVDAGAITDATAIVDG
FT                   CRLCKSPAELALMQQACDMTLQVQRLAAGIAHEGIGTDAMVRFIDEAHRALGADNGSTF
FT                   CIVQFGEATAFPHGIPGVQHLVEGQLVLIDTGCTVQGYHSDITRTWIYGKPSDHQRRIW
FT                   DLEQAAQAAAFAVVRPGVACEVVDRAARQVLELGGLGPDYRLPGLPHRTGHGCGLAIHE
FT                   APYLVRGNRTVLCPGMCASDEPMIVVPGHFGVRLEDHFHVTEDGAHWFTLPSPEIDRPF
FT                   I"
FT   gene            225928..227754
FT                   /locus_tag="XfasM23_0165"
FT   CDS_pept        225928..227754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0165"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xcv:XCV2741 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91622"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6T2"
FT                   /protein_id="ACB91622.1"
FT                   /translation="MPSICTLAVSLLSVVLLSACTSSSSLSRSDTRDCRVIPSEQAARA
FT                   FDQLLNEQWQYELAHSPEFASIIGDKRYNDRWSDYSSAAVAADRQATVGFLAKFQKVNA
FT                   AALDGQRQLSLILMQRQLQDHLEAIRLRLHEMLLEPVGGVHLELASDADMFPFDDIKDY
FT                   RDYIKRLQRVPALIDQVIEISRQGAQDGLTQPRYLLETLPAQIRKIAEAAGADSPFASP
FT                   LKTLDQVVTDAAQRAQLRAALITAIDQQVRPAYETLAAFVQNEYAAKGREHEGLWSLPD
FT                   GEARYRFAIHTQTTTDRSPEDIHRIGLREVARIEGEMTAIAISIGYKDLASFRKAVAND
FT                   KAHFAEDDEQILGLYRGYIAGMQVALPKLFEDGDLPKTPLEVRAMPAFRRQAPGAEYLQ
FT                   GTPEGSKPAIVMVNTNDAIERTLVNVETTAYHEGVPGHHLQISLAQRLPLPPFRQHAGY
FT                   NAYVEGWALYAERLGKEAGFFKDPYSDYGRLAGELLRANRLVLDTGVHYKRWTRQQMVD
FT                   FFHAHPSDDEPSIQAETDRYIVWPGQALGYKLGEMQILRLRAKAEKVLGARFDLRAFHD
FT                   AVLGGGAMPLDVLAQRIDAWIAQVQGVQQAKR"
FT   sig_peptide     225928..226011
FT                   /locus_tag="XfasM23_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.641 at
FT                   residue 28"
FT   gene            227751..229547
FT                   /locus_tag="XfasM23_0166"
FT   CDS_pept        227751..229547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0166"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xcb:XC_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91623"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6T3"
FT                   /protein_id="ACB91623.1"
FT                   /translation="MMRCIRLFWIALLVMAVTVSVAQATPAPFDMAARFKALYTREWRW
FT                   RQAEFPGVVERSSQPQCVDHLPKVDLARQNKRTAYWQQVLEELKTIDPVRLSSKDQINY
FT                   QVYRQQIEVLLDGQRFRSWEMSFNSDTAFWSDLSFSARDRFRTSEDYRCYLGVLADIPR
FT                   YFNEQIVNLRQGLARGFAQPRVTLEGRDQVIAEVAGAAGEDNLFYIPFKQMPTMMSAGE
FT                   QARLRAQVLHLIVDQVVPAYRHLLAFMREEYLPKARTVLAAESLPGGVAYYRAKIFEYT
FT                   TLDLDPEAIYQIGVAEVAKLRQQMDQVIVDSGFKTSPDQQIFSAFLRYLRTDPQFYPKT
FT                   PEALLKEAAWIAKRVDAKIGLYIGRLPRRRFAIEPVPADVAPYYTSGRGGPGIYFVNTY
FT                   DLPSRPLYNLTALTLHESSPGHALQMPLAEEAKEVPEFRRYAFISAYGEGWAVYAEYLG
FT                   QEMGLYDTPYDRFGYLSYQIWRACRLVIDTGIHHKGWTRAQAQAYLRDNTALSEREITT
FT                   EVDRYISWPGQALSYYLGELKILELRHKAEAALGAKFDIRHFHDAVLGLGSVPLQVLEA
FT                   RIDRFIAEDGRSPYPETIAVVH"
FT   sig_peptide     227751..227825
FT                   /locus_tag="XfasM23_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.895 at
FT                   residue 25"
FT   gene            229999..231132
FT                   /locus_tag="XfasM23_0167"
FT   CDS_pept        229999..231132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0167"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: xac:XAC2513 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91624"
FT                   /db_xref="GOA:B2I6T4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I6T4"
FT                   /protein_id="ACB91624.1"
FT                   /translation="MSRLQFQLQATDGAARRGQLSFPCGTVQTPTFMPVGTYGAVKGVL
FT                   PGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHR
FT                   RKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDVVMIFDECTPYPATEDVARDSME
FT                   LSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYGIGGLAVGE
FT                   SESERNVILEYLHPRLPTDRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYF
FT                   TGFGTVKIRNACYARDVDPIEQGCGCPACVGGYTRAYLRHLDRCNEMLASMLGSLHNLW
FT                   YYETLMANMRAAITAGTFFAFRRSFYLARGLDPPPLP"
FT   gene            231264..231626
FT                   /locus_tag="XfasM23_0168"
FT   CDS_pept        231264..231626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0168"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: xac:XAC2512 preprotein
FT                   translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91625"
FT                   /db_xref="GOA:B2I6T0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6T0"
FT                   /protein_id="ACB91625.1"
FT                   /translation="MEITMNLFDFFIPVAQAQSAAPAGASPGGGLQMFFLPVILIAVMY
FT                   FSIIRPQMKRQKEYKTMMDHLGCGDEVITAGGIAGVVSVIGDEFVTVEIAENVRVRVQK
FT                   SAIAKALPKGSLPSAK"
FT   gene            231693..233537
FT                   /locus_tag="XfasM23_0169"
FT   CDS_pept        231693..233537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0169"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: xcb:XC_1738
FT                   preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91626"
FT                   /db_xref="GOA:B2I6T1"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B2I6T1"
FT                   /protein_id="ACB91626.1"
FT                   /translation="MLELPRWKYVLIFVVLVLSTLYALPNVYQKDPSVQITANRGGHID
FT                   DAFRQQVMTDLQASGIVPKAVTKEGESLMVRLMSLEMQTRASDVLRAKVGENYTVALNL
FT                   ASTVPDWLAKLGGRPMVLGLDLVGGVHFALQVDQKAALNKRMDAFVEEVRSTLGSKRIG
FT                   FRMVERRPDNTIRVTFDDDAHLNEARMVLFKEQVGLSYSVSGNTLIARVSENELRQIAS
FT                   GAVEQNLTTLRNRINELGVAEPIIQRQGDDRIVVELPGVQDTAEAKRLIGATATLEFRG
FT                   VVDGDAYEAVRTGNVPPEARVYYIRGTNQPVLLNKRVIVSGDEMVNATVGVDENGMPAV
FT                   NVTLSNAAGQRMLDYTQRNLYKLMSVVYIERIPTVSMVDGKEVRGVRLKEEALSPTRIA
FT                   GVFGKNFRTTGLEKTEAENLSKLLRAGSLAAPMDFVEEYVIGPSLGAENVERGVTAVVF
FT                   SFLFTLVFFTIYYRMFGVITSLALLFNLLIVVAVMSLFGATMTLPGFAGLALSVGLSVD
FT                   ANVLINERIREELRHGMPPRSAIVAGYDKAGSTILDANLTGLIVGVALYAFGTGPLKGF
FT                   ALTMIIGIFASMFTAITVSRSLSALIYGTRNNLKSLAI"
FT   gene            233557..234522
FT                   /locus_tag="XfasM23_0170"
FT   CDS_pept        233557..234522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0170"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: xcv:XCV2692
FT                   preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91627"
FT                   /db_xref="GOA:B2I717"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B2I717"
FT                   /protein_id="ACB91627.1"
FT                   /translation="MKLFPLHLIPNDTKIDFMRWRKPTLSLMSILFAISVLVVVFKGFN
FT                   YALEFTGGTLVRTQFAKPVDADQVRQRLEVGGLGNAQVQSVGGGNELLIRLQPYGEHNN
FT                   DDVAKNAAEAVRKVITLPDNPATVQPGEFVGPQVGKDLAMNGVYATIFMLLGFLIYIGF
FT                   RFEWKFAVAASLTAFFDLILTIAYMSLLGREFDLTVLAGLLSVMGFAINDIIVVFDRVR
FT                   ENFRSLRVEPLEVLNRSINQTLSRTVITAVMFFLSAFALYLYGGRSMEGLAETHMAGAV
FT                   IVVVSSVVMAVPLLTIGPLKVSKQDLLPKAKDLESLERRP"
FT   gene            complement(234696..234770)
FT                   /locus_tag="XfasM23_R0015"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(234696..234770)
FT                   /locus_tag="XfasM23_R0015"
FT                   /product="tRNA-Glu"
FT   gene            234852..236036
FT                   /locus_tag="XfasM23_0171"
FT   CDS_pept        234852..236036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0171"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="KEGG: xcv:XCV1814 polynucleotide
FT                   adenylyltransferase; TIGRFAM: poly(A) polymerase; PFAM:
FT                   Polynucleotide adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91628"
FT                   /db_xref="GOA:B2I718"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B2I718"
FT                   /protein_id="ACB91628.1"
FT                   /translation="MLCIVPRGHHTISRKDISPNALRVLYRLREAGFGAYLVGGAVRDL
FT                   LVGGHPKDFDLATDATPEQIKQLFRSCRLIGRRFRLAHVVFGREIIEVATFRANSDDGS
FT                   GDRELENGRLVCDNVYGTIEDDATRRDFTCNALYYTIEDFSVRDYVGGFEDVQSRLMRL
FT                   IGDPVRRYQEDPVRMLRAVRLAAKLGFEIEAGTAEPISRMAGLLADVAPARLFEEVLKL
FT                   FLSGHAVVSFEALEDFGLIDVLFPESAKALRANRSGALRRVLIEGLHSTDKRVIKDEPV
FT                   SPAFLFALLLWPGFCHALVTLQLQGVQPEEAQRRAADRVTLHHLERVALPRRFSLPMQE
FT                   IWLLQNRFISRQPKRVLRLLEHPRFRAAFDFLVVRLAASAEHAADVEFWRVAQQ"
FT   gene            236138..236635
FT                   /locus_tag="XfasM23_0172"
FT   CDS_pept        236138..236635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0172"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: xcb:XC_2469
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91629"
FT                   /db_xref="GOA:B2I719"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B2I719"
FT                   /protein_id="ACB91629.1"
FT                   /translation="MTSGNVVAYVGLGANLGPAEMTLRAAIAALDQLPFTRLRIASSLY
FT                   RTPPWGRQDQAEFVNAVAALETRLAPLALLDALLEVECLHGRVRLPGDRWGPRTLDLDL
FT                   LLYGEHVLDLPRLRVPHPHLHERTFVVVPLAEIAAELVLPRHGMVCELLEHMDTLGLVP
FT                   IR"
FT   gene            236668..237486
FT                   /locus_tag="XfasM23_0173"
FT   CDS_pept        236668..237486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0173"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="KEGG: xac:XAC1785 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91630"
FT                   /db_xref="GOA:B2I720"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I720"
FT                   /protein_id="ACB91630.1"
FT                   /translation="MSIYTNSKPWTVPALAEAKRNGSKIVMLTAYDAGFARILDANGVD
FT                   LILVGDSLGMVVQGHDSTLPVSVHDMVYHTACVARGVRHAMLVVDLPFQADASPERALE
FT                   AATALLRVGAQMIKIEGAGHKLEVISYLVEREIPVCSHLGLTPQSVLRFGGYKVQGRGE
FT                   EAGGRLRAEARAAVEAGATLLLLECVPSQLAAQITTDASVPTIGIGAGAGCDGQVLVLH
FT                   DLLGLDSGHPRPKFVKDFLAHGGSVAGAVRAYANAVRDGSFPDVEHTYTS"
FT   gene            237483..238328
FT                   /locus_tag="XfasM23_0174"
FT   CDS_pept        237483..238328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0174"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: xcv:XCV1817 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91631"
FT                   /db_xref="GOA:B2I721"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I721"
FT                   /protein_id="ACB91631.1"
FT                   /translation="MIDTVTDLSRLRGIVADWRRQGLRVALVPTMGNLHAGHFSLVMLA
FT                   RHYADRVVSSVFVNPTQFGPHEDFQRYPRTPEADMRGLEHVGCDVLWLPSVETMYPLGT
FT                   ERTVRLFIPCVSDVLEGTFRPGHFEGVCTVVARLFNQVLPDVAVFGKKDYQQLVVIRQM
FT                   VVDLAFPIEILGGCIVRESDGLAMSSRNQYLSMQQRPQAAEIHRTLIAMRDAVMSGGVH
FT                   ADVEAEAVRRLEAAGFQVDYAVIRLPDLCEPIDGIVISQGIALVAARLGNTRLIDNLEF
FT                   "
FT   gene            238363..238791
FT                   /locus_tag="XfasM23_0175"
FT   CDS_pept        238363..238791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0175"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: xcv:XCV1818 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91632"
FT                   /db_xref="GOA:B2I722"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B2I722"
FT                   /protein_id="ACB91632.1"
FT                   /translation="MSVIGYNHFPYFAVFPMQLSLLKAKIHRATVSHSELNYEGSIAID
FT                   GLLLEAAGLYEFEKVHIWNVTNGARFTTYAIRAEHGSGIISVNGGAARYVQVGDLVIVA
FT                   AFAQMSEDEAAVFRPNLVYVNAANAMTHTNHSIPTQVA"
FT   gene            238795..240303
FT                   /locus_tag="XfasM23_0176"
FT   CDS_pept        238795..240303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0176"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   xcv:XCV1819 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91633"
FT                   /db_xref="GOA:B2I723"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I723"
FT                   /protein_id="ACB91633.1"
FT                   /translation="MHNGFDALQLHANRLRGVTIPDLLAAELKRPEQYARQVGPLYFNF
FT                   ARQKYDCVALEALFALARNHNVTGAFQRMFCGEQVNVTEGRAVLHTALRGDLSGTSVAV
FT                   AAYTAAAKVRERMYALIAGLDASEVTDIVSVGIGGSDLGPRLVVDALRPISQGRFRVHF
FT                   VSNVDGAAMRRTLDMLDPSRTAGILISKTFGTQETLLNGRILYDWLGGSERLYAVTANP
FT                   ERAANAFDIVPTQVLPIWDWVGGRYSLWSAVGFPIALAIGSQRFEELLAGAAEFDAYAL
FT                   RVPLEENVAVLHGLTAVWNRNFLGCATYAVMAYDQRLALLPTYLQQLVMESLGKRVKCD
FT                   GTPVDRDTVPVWWGGVGTDVQHSFFQALHQGTNIVPADFIGTIRNDDLYTENHFALNAN
FT                   LLAQIEVLANGQLSDNPHRVYPGGNPSTLILLDALTPQALGGLIAMYEHSVYVQSVIWG
FT                   INAFDQFGVELGKHLAVQLLPALKGESVEVADPVTRAVLLRLRG"
FT   gene            241370..241446
FT                   /locus_tag="XfasM23_R0016"
FT                   /note="tRNA-Met1"
FT   tRNA            241370..241446
FT                   /locus_tag="XfasM23_R0016"
FT                   /product="tRNA-Met"
FT   gene            242070..242669
FT                   /locus_tag="XfasM23_0177"
FT   CDS_pept        242070..242669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0177"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   xac:XAC2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91634"
FT                   /db_xref="GOA:B2I724"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I724"
FT                   /protein_id="ACB91634.1"
FT                   /translation="MSDKGIEIVNLLAPKVEMLGFDLLGAEYLLVPSGAILRLYIDIPF
FT                   AMQPECMVSIDDCERVSREVSAYLDLEEPISGNYTLEVSSPGLDRRLFTLEQFARHHNH
FT                   LVKVGLKLQQHGSRRLQGKIVRVEQVGGFVVLLVNGVELAVDFNNIDKARIVPDWSALG
FT                   LAPLEKSKHDTKKMSQGSKKPSNESAARQAVRGVIR"
FT   gene            242666..244177
FT                   /locus_tag="XfasM23_0178"
FT   CDS_pept        242666..244177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0178"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: xcc:XCC2512 transcription elongation factor
FT                   NusA; TIGRFAM: transcription termination factor NusA; PFAM:
FT                   RNA binding S1 domain protein; NusA domain protein; SMART:
FT                   KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91635"
FT                   /db_xref="GOA:B2I725"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B2I725"
FT                   /protein_id="ACB91635.1"
FT                   /translation="MSKELLLVVDVVANEKGVPRQIIFDAIEVALASAAKKRYQDRDIL
FT                   TRVTIDQKNGNYETYRRWEVVADDVVMESPERQIRLMDALDEADGVEVGDYIEEQIENP
FT                   DFGRISAQAAKQVIVQRVREAERQQVVDAWKNRVGELVTGVVKRVERGNIYVDLGGGTE
FT                   AFIPKDKGIPRDVIRPGDRVRGYLAEVRSESRGPQLFISRSAPEFMIELFKLEVPEVGQ
FT                   GLVEIKGCARDPGDRAKIAVIAHDNRTDPIGACIGMRGSRVQAVSNELNGERVDIVLWN
FT                   ENPANFVINAMAPAEVQSIIVDEERHSMDLAVAEDRLAQAIGKGGQNVRLASRLTGWQL
FT                   NVMTAEQVAAKSEAEQLAARRLFMDRLEVDEEIASILVMEGFNTIEEIAYVPVGELLAV
FT                   EGFDEDIVEELRARARDALLNAALAEEEVLEHSGPAPDLLELNGMDEITAHALAAHGVR
FT                   TSEDLSDLAADEIVEFDIQGMTVQRAAVLILAARAEEIARLERGE"
FT   gene            244273..246951
FT                   /locus_tag="XfasM23_0179"
FT   CDS_pept        244273..246951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0179"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   translation initiation factor IF-2 domain protein;
FT                   Initiation factor 2 associated domain protein; KEGG:
FT                   xcv:XCV2837 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91636"
FT                   /db_xref="GOA:B2I726"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I726"
FT                   /protein_id="ACB91636.1"
FT                   /translation="MSQQTTIRKLAELVNTPVEKLLEQLAGAGMKFSGPDQVVTSTEKM
FT                   KLLGFLRRTHGKSDVSVGTVREAPKKITLNRRRLQEVTVNAGRNKTTVNVEVRQKRTYV
FT                   KPPESEYHTPTKPPIELADAERVEILRKLEESRQRNLAEQQRLAEVDRQRVEEQERKRR
FT                   EEEQAELERQKTESRVVEEILVKTDSNSVKPVSKPISEERTRALPRTVRPTPAARPSVS
FT                   RSDDRNSNGGVRHKARGSHVIVSDEDDSARRFAGQMHLTAAERARRGSNTRGKGGGSHR
FT                   SATHRGNENSIRSSGAHGFERPTVAVVREVAVGDTITVADLAQKLALKSGDMVKALFKM
FT                   GVMVTITQTIDHDTAVLVSEELGHKVTRASSSDFEDALLAHTEELHGEPVPRPPVVTIM
FT                   GHVDHGKTSLLDYIRRTKIAVGEAGGITQHIGAYHVETPRGVISFLDTPGHAAFTSMRA
FT                   RGAKITDIVVLVVAADDGVMPQTKEAVQHARAAGVPLIVAVSKIDKSTADPQRVKNELL
FT                   TESVVAEEFGGDTQFVELSAKTGVGVDALLDAISIQAEVLELKAVIEGRATGTVIESSL
FT                   DKGRGPVATVLVQQGRLKKGDYLVCGTHYGRVRALFDEVGHQPLAASPSIPVQVLGLSG
FT                   VPDAGDDFVVVDDERLAKDVAQQREAKRRESRLVTSAGNRMEDILAQMGKGENQQVLNL
FT                   LIKADVQGSLEALKQALVALSNDDIRINVIHVGVGGITESDANSAVTSKATVIGFNVRA
FT                   DASARKIIEVNGVDLRYFSIIYDVIDQVKQVASGLLGVEIREEIIGVAEVRDVFRSSKF
FT                   GAVAGCMIIEGVVKRSKPIRVLRDNTVVFEGELESLRRFKENVDEVRNSIECGIGVKAY
FT                   NDVRVGDSIECFERIEVARTL"
FT   gene            247061..247438
FT                   /locus_tag="XfasM23_0180"
FT   CDS_pept        247061..247438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0180"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: xcv:XCV2836
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91637"
FT                   /db_xref="GOA:B2I727"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I727"
FT                   /protein_id="ACB91637.1"
FT                   /translation="MPKKSFQRTERISVQIRRDLGAFVQAAVRDHGLPSMSVSDVEVTR
FT                   DMAHAKVFVTALQAERSFEAVAGLKALARELRMQLAQTMRLRFVPELHFHYDDSLDRGE
FT                   RIDTLLRDLIPPADAEKDESG"
FT   gene            247535..248437
FT                   /locus_tag="XfasM23_0181"
FT   CDS_pept        247535..248437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0181"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; tRNA
FT                   pseudouridine synthase B; KEGG: xcb:XC_1607 tRNA
FT                   pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91638"
FT                   /db_xref="GOA:B2I728"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B2I728"
FT                   /protein_id="ACB91638.1"
FT                   /translation="MSRISYRRLDGILLLDKPAGISSNSALQVARRLLRAKKGGHTGSL
FT                   DPLATGLLPLCFGEATKIAGLLLDSTKAYDADVLLGTTTTTDDAEGAVLLTRPVPTLDA
FT                   EMVDALIPQLIGRIRQRAPIYSALKQGGEPLYAKARRGEVVNAPVREVEVHAIELLFLA
FT                   TPRLQLRVTCGSGTYIRSLVRDLGEILGCGAHINALRRRWVAPFQIPKMLTLDALEQAL
FT                   SAGRDPDSLLLPLVEGLAGFPALELDAQRLACFRLGQRLRDHSFQTGRVAVFSRDGIPA
FT                   GLGEVDSEGLLVPQRLFNL"
FT   gene            248616..248876
FT                   /locus_tag="XfasM23_0182"
FT   CDS_pept        248616..248876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0182"
FT                   /product="ribosomal protein S15"
FT                   /note="PFAM: ribosomal protein S15; KEGG: xom:XOO_3048 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91639"
FT                   /db_xref="GOA:B2I729"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I729"
FT                   /protein_id="ACB91639.1"
FT                   /translation="MSIDTQSIIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKK
FT                   DHHSRRGLLQMVNRRRSLLDYLNKKENERYKLLIEKLGLRR"
FT   gene            249029..251131
FT                   /locus_tag="XfasM23_0183"
FT   CDS_pept        249029..251131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0183"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: xcb:XC_1609 polynucleotide
FT                   phosphorylase/polyadenylase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; KH type 1 domain protein;
FT                   Exoribonuclease, phosphorolytic domain 2; Polynucleotide
FT                   phosphorylase, phosphorolytic RNA-binding,
FT                   bacterial/organelle-type; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91640"
FT                   /db_xref="GOA:B2I730"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I730"
FT                   /protein_id="ACB91640.1"
FT                   /translation="MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVA
FT                   AKTAREGQDFFPLTVDYQEKFYAGGRIPGSFFKREGRATEKETLISRLIDRPIRPLFPE
FT                   DYKNEVQIIAMVMSLDPEIDGDIPAMIGASAALSLAGIPFKGPIGAAKVGYNDGQYILN
FT                   PTVSELKKSQLELVVAGTANAVLMVESEAALLSEEVMLGAVIFGHREMQKVIQVIDSLT
FT                   AEACTQPSDWVPPAKNDALVIALKKVIGGRLSDAFHIRDKLQRRDAIAAVKDDVIQQLA
FT                   GRLEVEGWNLAELLKEFGELEYRTMRDALLDTKVRIDGRSLEAVRPITVKVGVLPRVHG
FT                   SGLFTRGETQAIVVTTLGTARDGQVIDAVTGEYKENFLFHYNFPPYSVGECGRFGVPKR
FT                   REIGHGRLARRGVLAVMPSLDEFPYTIRVVSEITESNGSSSMASVCGSSLALMDAGVPV
FT                   KAPVAGIAMGLVKEGERFVVLSDILGDEDHLGDMDFKVAGTSEGVSALQMDIKIEGITE
FT                   EIMRQALQQAKVGRLHILGEMDKALAAPRAELSDYAPRLLTIKIHPDKIRDVIGKGGST
FT                   IQAITKETGTQIDIQDDGTIVIASVNNAAAREAKRRIEQITSDVEPGRIYEGKVAKIMD
FT                   FGAFVTILPGKDGLVHVSQISSERVERVGDKLKEGDVVRVKVLEVDKQGRIRLSIKAVE
FT                   EEVASI"
FT   gene            complement(251273..251707)
FT                   /locus_tag="XfasM23_0184"
FT   CDS_pept        complement(251273..251707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0184"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: xcb:XC_0334
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91641"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2I731"
FT                   /protein_id="ACB91641.1"
FT                   /translation="MNMFASIASSAPPPGWENLPFDATKCQVRDVLDHIGDKWSLLILL
FT                   TLVPGPTRFSAIQRAVPDISKRMLTQTLRHLERNGMIGRTVYPTKPPRVEYALAPLGES
FT                   LLVPVMHLLKWASTHHDEVRSARDRFDHAQQGGLAIASRI"
FT   gene            251816..252697
FT                   /locus_tag="XfasM23_0185"
FT   CDS_pept        251816..252697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0185"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: 3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   NmrA family protein; KEGG: xcv:XCV0349 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91642"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I732"
FT                   /protein_id="ACB91642.1"
FT                   /translation="MTRTISRILVTGTSGQLGALVIEELLKKIHASHLIAAARDPKALM
FT                   AFSRRGVETRLLDYTDQISIEAAFQGVERLLLVSSNVIDQRLVQHRNVIEAAARAGVGL
FT                   FAYTSLLHADNSSLLLAKDHVQTEALLKGSGIPYVLLRNGWYTENYTDSIGAALVHGAV
FT                   LGSAGTGRIAAATRADYAAAAAAILASDVDQAGRTYELAGDEAFTMPEYAAEIAQQSGK
FT                   PVIYRDLPEAEYAAILMQVGLPESFAAILAQSDIGASQGALFDDSHQLSTLIGRPTTPL
FT                   REVVAKALSAVR"
FT   gene            complement(253022..253354)
FT                   /locus_tag="XfasM23_0186"
FT   CDS_pept        complement(253022..253354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91643"
FT                   /db_xref="UniProtKB/TrEMBL:B2I733"
FT                   /protein_id="ACB91643.1"
FT                   /translation="MFGDVSHLKTQGKYNDGTIQKDQGNISPAMALRNLTLLHRRWSAI
FT                   KPLGYRYQTNQQHAQFFVHSGFKRNKVTVHNHKSSGVFALFMPCLFDIQRGNQAIPSCN
FT                   AVLYES"
FT   gene            complement(253963..257046)
FT                   /locus_tag="XfasM23_0187"
FT   CDS_pept        complement(253963..257046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0187"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   xcv:XCV2960 RND superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91644"
FT                   /db_xref="GOA:B2I734"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2I734"
FT                   /protein_id="ACB91644.1"
FT                   /translation="MKITHVAMSANRLTLFTAVLLLIAGIATFLNFPSQEEPSVTVRDT
FT                   LISVAYPGMPSEQVETLLAKPIEERLREIVGIKKIVSTVRPGSVLIQLTAYDNVKNLET
FT                   LWLRVRAKVAEAGTGLPTGTLGPFLNDDFGRVAVASIAITAPGFSMSEMREPLRRMREQ
FT                   LYTVPGVERVTLHGLQEDQVYVAFDRARLVEAGLTPAAVIQQLQAQNVVAPGGLVSASG
FT                   MALTVATSGEVGSVDELRRFLVSVPGSSSTREVPLSQIAQVQVMPADPPQTAAVYQGQS
FT                   AVVLAVSMTRGRNISEFGNTLRAALEETSQLLPIGFQQHVVTFQADVVDREMGKMHRVM
FT                   GETVLIVMAVVMLFLGWRTGLIVGAIVPLTVLSALIIMRAINIELHTVSIAAIIMALGL
FT                   LVDNAIVIAEDIERRLAIGEDRRHACIEAGRTLSIPLLTSSLVIVLAFSPFFFGETATN
FT                   EYLRPLVIVLAITLLSSWLLSITIIPLLCLYFAKAHRAPTEDQGHNLYDSAFYRSYRAI
FT                   ISRVLEHKVLFIGSMLALLAVAVIVITLIPYSFLPKSDRLQFQMPITLQPGSDSRQTLD
FT                   TVQQISRWFAEKQINPEVVDSIGYVADGGPRIVLGLNPPLPAPNVAYFTISVHPGTDID
FT                   AVIARTRKHMHNAFPYVRAEPKRFSLGANEAGVVIYRIVGPDEAVLRQSAKQISEALSA
FT                   LPGTYDIYNDWQARVPRYIVHVDQLKARRAGISSEEIAQALQMRYSGVNASLIRDDGVA
FT                   APIVLRGNAMERTAQGNPGDTLVYSQTQGTPLPLSAIAKIENDTEPSTLMRRNLNRTIT
FT                   IIGHNAGMTAGEIVQALAPKVASLKLPPGYRIELGGEIEDAAQANQALLQFMPHALVAI
FT                   LLLFILQFNSFRKLFIVVASIPFVLIGAATALLITAHPFGFIATFGLLALAGIIVNNAV
FT                   LLLERIEVELADGLPRREAVVSAAVKRLRPIVMTKLTCIVGLVPLMLFGGPLWTGMAIT
FT                   MIGGLALGTLVTLGLIPSLYDMLFGLSFRKRNVVETSG"
FT   sig_peptide     complement(256936..257046)
FT                   /locus_tag="XfasM23_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.752 at
FT                   residue 37"
FT   gene            complement(257043..258152)
FT                   /locus_tag="XfasM23_0188"
FT   CDS_pept        complement(257043..258152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0188"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   xoo:XOO1562 RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91645"
FT                   /db_xref="GOA:B2I735"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2I735"
FT                   /protein_id="ACB91645.1"
FT                   /translation="MKNNILTLSMCITLGVITLSSCGSDTSPQTTPLRTVKLETAGAEN
FT                   LAKTQFVASVRQEQRADLAFENGGRIAAINVDVGDKVRHEQVLARLDREPVRLKLQQAE
FT                   ATLRAATAQLHERQTQLNQQQAMFKEAMVSQAALTSAQVALDAAQADLHVAESNHALAK
FT                   RALRQSELRAPFDGSVVARLLQPQADTAPGQTVLQIEGRGRLQAVATLPAEIAQALSPD
FT                   KVIQGNRTDTPQASISLRLRSVSPRLESGASLQAIFDVTETTTPLHSGDTLLLALSATA
FT                   TPALSVQLPAVIPGLNGNSGIVFVYQPKTGVVLRRDVTLGMIEGERMQIRSGLKPGEQV
FT                   VVAGAAFLSDGQKVLPFRSSSRLSTGDSR"
FT   sig_peptide     complement(258081..258152)
FT                   /locus_tag="XfasM23_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.796 at
FT                   residue 24"
FT   gene            complement(259455..259937)
FT                   /locus_tag="XfasM23_0189"
FT   CDS_pept        complement(259455..259937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91646"
FT                   /db_xref="UniProtKB/TrEMBL:B2I736"
FT                   /protein_id="ACB91646.1"
FT                   /translation="MSSHATLNNRHIYSESPERNWPYRVEYCKNPTIAGALDGKRHVML
FT                   LTINEINAPPKRMNNAHARCLLQCTRNRRQHKGFNNNHGQQQLKSTSNRKSKQPLPIQA
FT                   VPASTNKVSRNGCHAQKPHYSTGHSEILEAHRCASHMTTLDVTPPSAFIAHQIPHK"
FT   gene            259977..260891
FT                   /locus_tag="XfasM23_0190"
FT   CDS_pept        259977..260891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0190"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xcc:XCC2639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91647"
FT                   /db_xref="GOA:B2I737"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2I737"
FT                   /protein_id="ACB91647.1"
FT                   /translation="MLISSKVRTAQLQIHVCVLLWGFTAIFGRLITLEALPLVWWRMTM
FT                   VVVSLVLLPRVWRGLRALHPRVMLAYAGIGALVALHWLAFYSAVKLANASVAATCIALA
FT                   PVFTAVVEPCVVGRPFRARELLLGLMVLPGVALVVGGVPDGMRIGIFIGVVSALLAALF
FT                   GSLNKRMVVHADPLTVTALELGSGILTLTGLMLLLSLVFPTLHEMPWQIPSAHDIFLLL
FT                   ILSFACTLLPFALSLVALRYLSAYSLQLVTNLEPVYSIALAIVLLGEQRELTGLFYLGV
FT                   AVVLGVVLLHPMLERRGRASSPQ"
FT   gene            complement(261227..263056)
FT                   /locus_tag="XfasM23_0191"
FT   CDS_pept        complement(261227..263056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0191"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: xcv:XCV2974 ATP-dependent
FT                   RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91648"
FT                   /db_xref="GOA:B2I738"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:B2I738"
FT                   /protein_id="ACB91648.1"
FT                   /translation="MSNPSSTPLLFADLGLSDAVMQAVTKIGYETPSPIQAATIPALLA
FT                   GRDVLGQAQTGTGKTAAFALPLLTRTVLNQVKPQVLVLAPTRELAIQVAEAFQRYAASI
FT                   SGFRVLPVYGGQSYGQQLAALKRGVHVIVGTPGRVIDHLERGTLDLSELKTLVLDEADE
FT                   MLRMGFIEDVEEVLRKLPASRQVALFSATMPPQIRRIAQTYLQDPIEVTIATKTTTAAN
FT                   IRQRYWWVSGLHKLDALTRILEVETFDAMIIFVRTKAATEELAEKLQARGLTAAAINGD
FT                   MQQAQRERTIHQLKDGKLDILVATDVAARGLDVERISHVLNYDIPYDVESYVHRIGRTG
FT                   RAGRSGEAILFVTPREKGMLRQIERATHQPIEAMQLPSVDAVNDTRVTKFFGRISNALV
FT                   VGAEIDFYRKLLQRFESEHNVPAIEIAAALARLLQGDSPFLLSVPTRPQRERSELASEH
FT                   HVKRPSSFKQTERPNNTEHPKRPQRNAPARNVPEFGMESYRIEVGRMHGVKPANIVGAI
FT                   ANEAGLESRYIGRIDIRDDHSVLDLPAEMPHEILQHLKKVWVSGQQLQMRRIDTTETTA
FT                   PAREFKSKPGGAGKFPPKPHHNKSTKPKPPYSG"
FT   gene            263176..263382
FT                   /locus_tag="XfasM23_0192"
FT   CDS_pept        263176..263382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91649"
FT                   /db_xref="GOA:B2I739"
FT                   /db_xref="UniProtKB/TrEMBL:B2I739"
FT                   /protein_id="ACB91649.1"
FT                   /translation="MLESAVLFPYFCFLAFVSGVAVLTLFALNETAISSELWSMHQHMK
FT                   GYFTALLAMEELPDFGSFWKLIC"
FT   sig_peptide     263176..263265
FT                   /locus_tag="XfasM23_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.301 at
FT                   residue 30"
FT   gene            complement(263372..264322)
FT                   /locus_tag="XfasM23_0193"
FT   CDS_pept        complement(263372..264322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0193"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: xac:XAC3587 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91650"
FT                   /db_xref="GOA:B2I740"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2I740"
FT                   /protein_id="ACB91650.1"
FT                   /translation="MTKLLIIAEHLDGQLNAATAKTVSAALALSPEAIDIAVLAAIPDS
FT                   VAAQAQHIAGVTRVLTIANPANKHPIAQILAPQIAALVQTNSYTHVFGPSTTFGKDLMP
FT                   VVAALLNVNQISDLMGLQDAYTFTRPIYAGNAIITVKAPTDQIVVATIRTASWPEAAKG
FT                   GNATIETVTVSAHLPNHTRFLSLDVHTCDRPDLQNAKRVVAGGRGLGSPENFKLIYTLA
FT                   DTLGAAVGASRAAVDAGYVPNELQIGQTGKIIAPDLYIAIGISGAIQHLTGIKDAGTIV
FT                   AINQDADAPIFEIADIGLVGDLFQLIPELDMALNK"
FT   gene            complement(264319..265068)
FT                   /locus_tag="XfasM23_0194"
FT   CDS_pept        complement(264319..265068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0194"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: xcv:XCV3710 electron transfer
FT                   flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91651"
FT                   /db_xref="GOA:B2I741"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2I741"
FT                   /protein_id="ACB91651.1"
FT                   /translation="MKILVAYKRVVDYNVRIQVKPDGSGVMTEGVKVSANPFDEIALEE
FT                   ALRLRDAGIASEVVIATLAPNDVTAHLRNGLAMGANRAIHIVTHTTVQPLTAARALLKL
FT                   VEKEHPALVILGKQAIDDDANQTGQMLATLWGRPQATFASKVTIADGKATVTREVDAGL
FT                   ETLHIDLPAVITADLRLNAPRFIKLPDIMKAKSKPLETIAFADLGVTAHDSLQTTHYAP
FT                   PKKRNQGVMVKNVTELVTLLKNQGALS"
FT   gene            265284..266345
FT                   /locus_tag="XfasM23_0195"
FT   CDS_pept        265284..266345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0195"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: xcb:XC_3613
FT                   dTDP-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91652"
FT                   /db_xref="GOA:B2I742"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I742"
FT                   /protein_id="ACB91652.1"
FT                   /translation="MGLATWLVTGGAGFIGGNFVLQAISLGHRVINLDALTYAGHLETL
FT                   AALDGCAEHLFVHGDIGDRALVSRLLDTHRPDAVLNFAAESHVDRSIDAPAAFIQTNVV
FT                   GTLLLLEAVCGYWKALPEAARAAFRFLHVSTDEVYGSLGETGAFTERTAYAPNSPYSAS
FT                   KAASDHLVRAFHHTYGLPVLTTHCSNNYGPYHFPEKLIPLVITKALAGEPLPVYGDGRH
FT                   VRDWLFVGDHCTALCAVLAGGRVGETYNIGGQAERENLEVVRMICRLLDERRPRADGLS
FT                   YQSQIVHVADRPGHDRRYAIDTSKLVSELGWAPVYRFEQGLALTVDWYLQHQDWVRAVL
FT                   QGRDRVEGLLTAV"
FT   gene            266408..267295
FT                   /locus_tag="XfasM23_0196"
FT   CDS_pept        266408..267295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0196"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: xac:XAC3584
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91653"
FT                   /db_xref="GOA:B2I743"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2I743"
FT                   /protein_id="ACB91653.1"
FT                   /translation="MTQRKGIILAGGAGTRLYPITQGIGKQLLPVYDKPMIYYPLSVLM
FT                   LAGIRQVLVITMLHEQALFQRLLGDGTQWGMEICYAVQASPDGVAQSYLIGRAFIDDKP
FT                   SCLILGDNIFYGHGLTDTLCHADARTVGATVFGYWVSDPERYGVAEFDGDGRVINIEEK
FT                   PAQPRSNYAVTGLYFYDGRAPAFAAELTPSARGELEITDLNRRYLAEGALHLEALGRGY
FT                   AWLDTGTHQSLHDASNFIGTIQTRQGLQVCCPEEVAFWKGWIDATHLERLAAPLAKNAY
FT                   GQYLLNLAQRGRSL"
FT   gene            267292..267849
FT                   /locus_tag="XfasM23_0197"
FT   CDS_pept        267292..267849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0197"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: xcb:XC_3611 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91654"
FT                   /db_xref="GOA:B2I744"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2I744"
FT                   /protein_id="ACB91654.1"
FT                   /translation="MKVIDTALPGCLVIEPRVFDDARGEFFEVWNAECFEHQGMSSRFV
FT                   QSNVSISIYGVLRGLHYQWPRPQGKLVGVLEGEVYDVAVDIRRGSPHYGRWVAVLLSAK
FT                   NKRQLWIPEGFAHGFVVLSERAVFNYLCTDVYVKEADAGIRWNDAVIGVDWPIAAPLLS
FT                   AKDQKAPFMEEVPIDRLPIYVP"
FT   gene            267846..268754
FT                   /locus_tag="XfasM23_0198"
FT   CDS_pept        267846..268754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0198"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: xac:XAC3582
FT                   dTDP-4-keto-L-rhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91655"
FT                   /db_xref="GOA:B2I745"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I745"
FT                   /protein_id="ACB91655.1"
FT                   /translation="MTVLVFGAGGQIGQELLRSLSGRVVCAVTRSGRLPNGVGCVQADF
FT                   GQPETLRALLDAQRPVQVVNAAAYTAVDRAESEPDVVFRINAQAPGVIAHWCAEHGVPL
FT                   VHYSTDYVFDGQGTSPYGVDDPVAPLNIYGASKLAGECAVRAAGGCSLILRTSWVYAAH
FT                   GHNFLRTMLRLGATSECLRVVADQIGTPTAAGLIADVTAQLLVEQVQSRHAGIWHLTAA
FT                   GQTSWHGFAEEIFVQAQACGLMMRVPQVQAIGSVVYPTAARRPGYSCLDTTALVEAFGI
FT                   VLPDWRQGVRGVLDEIVKRSR"
FT   gene            complement(268932..270335)
FT                   /locus_tag="XfasM23_0199"
FT   CDS_pept        complement(268932..270335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0199"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: xcb:XC_3609 phosphomannose
FT                   isomerase/GDP-mannose pyrophosphorylase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91656"
FT                   /db_xref="GOA:B2I746"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2I746"
FT                   /protein_id="ACB91656.1"
FT                   /translation="MNDILPVILSGGSGTRLWPLSREAYPKQFLPLVGHHSMLQATWLR
FT                   AAPVTTHSPIVVANEEHRFIAAEQLQHLGVYPSAILLEPTGRNTAPAIAVAALEATRTG
FT                   NDPLLLVLPSDHVIRDETAFQTAVHVAAAAAAQGKLVTFGITPNTPEIGYGYIKATGND
FT                   TIRPVERFIEKPDLATAQSYLASGDYFWNSGMFLFRASRYLAELSTFQPAIAEACQRAW
FT                   SAAKRDTDFIRLDKEAFESSPADSIDYAVMEHTADAVAVPLDAGWNDVGSWSALHEVSK
FT                   QDNDGNAHQGDVIQIDCRNTYAYGSRLIAMVGLENVVVVETDDALLVGHRDSIQTVKEI
FT                   VGKIKANGRPEATWHRKVYRPWGAYDSIDTGQRFQVKRITVKPGGTLSLQMHHHRAEHW
FT                   IVVSGTAEVTRGSEILLLTENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIV
FT                   RFEDTYGRT"
FT   gene            complement(270388..271737)
FT                   /locus_tag="XfasM23_0200"
FT   CDS_pept        complement(270388..271737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0200"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcb:XC_3608 phosphoglucomutase;
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91657"
FT                   /db_xref="GOA:B2I747"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B2I747"
FT                   /protein_id="ACB91657.1"
FT                   /translation="MSLPAFKAYDIRGRVPDELNEDLARRIGIALAAQLDRAAPVVLGH
FT                   DVRLTSPSLQEALSAGLRASGREVIDIGLCGTEEVYFQTQYRNAAGGVMVTASHNPMDY
FT                   NGMKLVREQARPISSDTGLFTIRDAVATDIATITPPTAAEHQYLDKSAYIAHLLSYVDS
FT                   NALKPLKLVVNAGNGSAGLIVDLLAPHLPFEFVRIFHEPDGHFPNGIPNPLLPENRDAT
FT                   AQAVKHHGADLGIAWDGDFDRCFFFDHTGRFIEGYYLVGLLASVILSKHPGGKIVHDPR
FT                   LIWNTVEMVEAAGGIPVLSKSGHAFIKEKMRKENAVYGGEMSAHHYFREFSYADSGMIP
FT                   WLLIAELISRSGRSLADLVESRMQQFPCSGEINFKITDTKTATARIMDHYTAQSPTIDH
FT                   TDGISADFGDWRFNLRSSNTEPLLRLNVETRNNAALLKQRTDEISALLRT"
FT   gene            271944..272144
FT                   /locus_tag="XfasM23_0201"
FT   CDS_pept        271944..272144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91658"
FT                   /db_xref="UniProtKB/TrEMBL:B2I748"
FT                   /protein_id="ACB91658.1"
FT                   /translation="MCGLFGQVFNTNLSDVNEDTVSASLADLWFKLSSRIERVFSSLGR
FT                   QFAGQWSLWERTDGAQNFELK"
FT   gene            complement(272326..272634)
FT                   /locus_tag="XfasM23_0202"
FT   CDS_pept        complement(272326..272634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0202"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   protein (ABC superfamily, membrane)"
FT                   /note="KEGG: kpn:KPN_04538 high-affinity branched-chain
FT                   amino acid transport protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91659"
FT                   /db_xref="GOA:B2I749"
FT                   /db_xref="UniProtKB/TrEMBL:B2I749"
FT                   /protein_id="ACB91659.1"
FT                   /translation="MRELTLTEIDNVSGADLGSRLNAAIVGGVAAFFAGSIWGGTRGGD
FT                   GGGILGVGTIGQGVGMVYGGIVGAVGGAIAGFVLDQSVTYSYTSGFMASLFNGTFAK"
FT   gene            272964..273272
FT                   /locus_tag="XfasM23_0203"
FT   CDS_pept        272964..273272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0203"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   protein (ABC superfamily, membrane)"
FT                   /note="KEGG: kpn:KPN_04538 high-affinity branched-chain
FT                   amino acid transport protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91660"
FT                   /db_xref="GOA:B2I750"
FT                   /db_xref="UniProtKB/TrEMBL:B2I750"
FT                   /protein_id="ACB91660.1"
FT                   /translation="MRELTSNEMNNVSGGDLASRLEASIVGSVAGFFAGSIWGGTRGGD
FT                   GGGILGVGSIGQGVGMIYGGIAGAIGGAIGAFVIDKTLTYTYTTGFMNSLFSGTFAK"
FT   gene            273960..274268
FT                   /locus_tag="XfasM23_0204"
FT   CDS_pept        273960..274268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0204"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   protein (ABC superfamily, membrane)"
FT                   /note="KEGG: kpn:KPN_04538 high-affinity branched-chain
FT                   amino acid transport protein (ABC superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91661"
FT                   /db_xref="GOA:B2I751"
FT                   /db_xref="UniProtKB/TrEMBL:B2I751"
FT                   /protein_id="ACB91661.1"
FT                   /translation="MRELTSNEMNNVSGGDLASRLEASIVLGVAAFFAGSIWGGTRGGD
FT                   GGGVIGIGSIGQGVGMVYGGIAGAIGGLIAGFVIDKDLTYTYTTGFMNSLFSGNFAK"
FT   gene            275037..275351
FT                   /locus_tag="XfasM23_0205"
FT   CDS_pept        275037..275351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91662"
FT                   /db_xref="UniProtKB/TrEMBL:B2I752"
FT                   /protein_id="ACB91662.1"
FT                   /translation="MFLSPLHIVCLIFSNVSSSAYYDSNPIDARRLSTDDSSLIEYINK
FT                   MLISPVSRHMIVCLPRQGCGPFMLYCHLWPNCCWQLVLPFRYFFFEVIHKKTALKLLED
FT                   "
FT   gene            276141..279053
FT                   /locus_tag="XfasM23_0206"
FT   CDS_pept        276141..279053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0206"
FT                   /product="autotransporter-associated beta strand repeat
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Autotransporter beta- domain protein; KEGG:
FT                   xom:XOO_1779 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91663"
FT                   /db_xref="GOA:B2I753"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2I753"
FT                   /protein_id="ACB91663.1"
FT                   /translation="MKNMKTAFFPGSILVLTLVAFLSACGGSGLVRPPTPTPTPTPTPT
FT                   PTPTPTPTPTPTPTPLPVLDPALAAKFRVHLDVTNTEPAHTLGFTGKGYMVGVVDSGVN
FT                   RNHVTLHDQVIHNNVYVDYQDPASPDDVSGHGTNVAQLIAGQPVEYWPGGIAPGATIFS
FT                   ARVFSSAAESAKESPIGGNFFEGEAAQLKRVNADMIAAGVRIQNNSWGYENQNTGDKQV
FT                   WIDPAVTDGFVNVYRDLVLNNNVLVIFASGNYSQQQPGRLSRLPSLPTVEGGASPADLE
FT                   RGWLVVAALDSFDHPDQLTSYSNHCGIAMHYCLAAPGDLIEIDTNVTTSPVDGDKGYLN
FT                   GYLIQNGTSFAAPLVSGAAALVWEAFPYFSNDLVRQTLLGTATDLGAPGVDEVFGYGAL
FT                   NVGKAVLGPAKFDWGDVQVSFDDRRSTWGNDITGSGGLIKRGTGTLVLGGSNNQYTGAT
FT                   QVLGGTLQASSLGASAVSVANTATLIGSGRFGGAVSNAGTLELGKDGLKVQGDYTQLET
FT                   GRLALYVGDQLSVAGNATLKGGELQVLGKRDYVTFNTSYSVLQADGSLTGTFSQLTWGP
FT                   AVLLGEGRLTYGTNNAYVTLQRLNVSAAAQALGIVDRVAQASAQRVEHAFRAIDAQQAQ
FT                   GGGALPTSFIGAAAALQQSSSAAVAAASLQSLSGQSHVAAAAASLDAIDLGRRSLATRL
FT                   DAPRSGERIVTWHQALGGPGHNGAASGTFSLSGWLVGHDAQLASGDIVGVAFGQADSSP
FT                   SGSASGLRGIDRQVQGRVYLQRTQGPLYVLGQLGFGSFQRRLDRQLQLGDWNDWTSSRY
FT                   SGQFWSGSVEAGYHWRQGSLALTPYLGLDQTQLRTDGFREQSGSGFGLQVQSAQATRSQ
FT                   LLAGVRTEWRWGGVQWRGYGEWQQTLRQSGLNPQASFTATSSWTPLVASSWPGRSGGVL
FT                   GLSMVLPVGVTAGLWTMGLEHYFGTRSRGESLGLRYQLGF"
FT   sig_peptide     276141..276221
FT                   /locus_tag="XfasM23_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.474 at
FT                   residue 27"
FT   gene            complement(279513..280700)
FT                   /locus_tag="XfasM23_0207"
FT   CDS_pept        complement(279513..280700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0207"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: btr:Btr_0941
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91664"
FT                   /db_xref="GOA:B2I754"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2I754"
FT                   /protein_id="ACB91664.1"
FT                   /translation="MKILEEKKSASNLNHLKTAFFGMIILSLGIGIGRFLHTPILPVML
FT                   HEGQFTFSQLSYIASANYAGYLLGSLFLSFGKLGNTSRTTMMLYGAAIVTNVLIFAMAF
FT                   TSYFFLVMLIRFTAGISSAAMMIFGSITVMRHTFNVRVIASLYAGVGIGILLGNEYVVI
FT                   GLRHGLNASGLWYGASLLSFIFLLLLFVLTPHVEDKPREASASFPVQQNPFLWWQLAAL
FT                   YGCAGFGYIIIATYLPLIAKTFNVPFIAEHLWSLVGLTIIPSCFAWLWAAQRWGTRRCL
FT                   TTNLLIQGCCVLLTLLSQAPFLLVISCIGFGATFMGTTSLVMPLTRQVRAPHRINLLGL
FT                   VTLTYGIGQILGPLLTSLLHSRLNTVTPAIMCGAVALFVAAGICQYCLDKKAVNV"
FT   gene            complement(281581..282156)
FT                   /locus_tag="XfasM23_0208"
FT   CDS_pept        complement(281581..282156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91665"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:B2I755"
FT                   /protein_id="ACB91665.1"
FT                   /translation="MHRHTLLGLLLFLSITTTAVNAAPQIHGREIIIPAEDIQPFVSNH
FT                   FPQTKTLLGGLIELSTSQPRIAIPPGHRMTLSFDLAISSGGGQPSPLGRVGLSSAMYYD
FT                   TARQAFFLDQPTLEHFKPAHSGIELDEQIREFINTWLQDYARREPVYQLSPALTAMLGN
FT                   VHLQSSTITNGHFSLTFDRDISPLIPDN"
FT   sig_peptide     complement(282088..282156)
FT                   /locus_tag="XfasM23_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(282570..283823)
FT                   /locus_tag="XfasM23_0209"
FT   CDS_pept        complement(282570..283823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0209"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: xom:XOO_0878
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91666"
FT                   /db_xref="GOA:B2I756"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B2I756"
FT                   /protein_id="ACB91666.1"
FT                   /translation="MAKETLLYAQSGGVTAVINATAAAVITEARSHRIKVLAARNGILG
FT                   ALREDLIDTSKESITAIRALTHTPGGAFGSCRFKLKSLEADHEKYERLLEVFKAHNVRW
FT                   FLYNGGNDSADTALKVSQLAKTFDYPLHCIGVPKTIDNDLAITDASPGFGSAAKYTAVS
FT                   ICEAARDVAAMAETSTKVFIYEAMGRHAGWLAAAAGLAGQGQEEAPHIILLPERTYDET
FT                   AFLAKVQQVVDRVGWCVVVASEGIRSNDGRFVADAGGTTDAFGHTQLGGVAAYLANRVK
FT                   QALGLKVHWTLPDYLQRSARHIASKTDWEQAQAVGKAAVHYALEGMNAVMPVIVRTSDT
FT                   PYRWKIEPAALTKIANHEKTLPASFLRRDGFGISERARTYFEPLIRGEAPMPYERNGLP
FT                   RHVHLKNQSVQKRLPAWE"
FT   gene            283967..284530
FT                   /locus_tag="XfasM23_0210"
FT   CDS_pept        283967..284530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0210"
FT                   /product="adenylate kinase"
FT                   /note="PFAM: adenylate kinase; KEGG: xcb:XC_0873 adenylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91667"
FT                   /db_xref="GOA:B2I757"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I757"
FT                   /protein_id="ACB91667.1"
FT                   /translation="MRLVLLGPPGSGKGTQAAQMQETLQIPHISTGDLLRSEVVAGTPL
FT                   GLQAKQVMAQGDLVSDAILLGMLESRLSHTDVVKGFILDGYPRNLSQAAALDGLLAKFG
FT                   HPLNAVVQLEVPTDVLVERIAGRAQAEGREDDTPDAVRKRLQVYNDSTAPVIGFYQQRG
FT                   ILLRVDGVGRLDEVSQRIAVALGC"
FT   gene            284825..286240
FT                   /locus_tag="XfasM23_0211"
FT   CDS_pept        284825..286240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0211"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; KEGG: xcb:XC_0874
FT                   UDP-N-acetylmuramate-L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91668"
FT                   /db_xref="GOA:B2I758"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2I758"
FT                   /protein_id="ACB91668.1"
FT                   /translation="MNKLHILGIAGTFMGGIAALARELGWNVAGSDQAIYPPMSVQLER
FT                   LGITLMHGYLPEHIAADCAEVVVGNALSRGNAAVEALLDSGCRYISGPQWLAERVLPGR
FT                   DTLAVAGTHGKTTTTTILAWLLEAAGRAPGFLIGGVPENFGVSARLGGVLSQGSMDPLV
FT                   AGEVSAAVRPLFVVEADEYDTAFFDKRSKFVHYRPRVVILNNLEYDHADIFPDVAAIQR
FT                   QFHHLVRTIPGRGRLIVNGEDQRLAEVLAMGCWTPVERFGFDPEFHWSARLIAADGSRF
FT                   SVWHEGCEVGQVSWSLLGRHNVLNALAALAAAHAVGVAPAAVIPSLAQFRSVKRRLECL
FT                   GERGAVTVYDDFAHHPTAIATTLEGLRANVGDARIVVAIEMRSHSMRLGAHAQALAPSL
FT                   QAADTVVFLDHPGLVWNAAGVVAQMHGQVHVVHDTEGLLSMLNEVVHASDHVVFMSNGG
FT                   FDGAPRRFLAQLR"
FT   sig_peptide     284825..284890
FT                   /locus_tag="XfasM23_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(286505..288559)
FT                   /locus_tag="XfasM23_0212"
FT   CDS_pept        complement(286505..288559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0212"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SNARE
FT                   associated Golgi protein; KEGG: xcv:XCV3548 putative
FT                   membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91669"
FT                   /db_xref="GOA:B2I759"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2I759"
FT                   /protein_id="ACB91669.1"
FT                   /translation="MNTPWITATLAWIEQHPALAGLVIFAIAFSDAVIILGAIVPALPL
FT                   LFAVGVLIGLDKINGLYAVACASLGAFAGDALSFWIGYRWGHRLREIWPFNRYPQLLHR
FT                   GESLFRGNAFKSILVARYVGAVRPFVPAIAGMLRMPLKHYTFASGLACLSWGALFLAPG
FT                   WLLGEAYDAVAAVAGRLLLVIGLLLLVLGVVWAVVLYSYRWAARNLDQSIARLLAWSHR
FT                   HPTLGRWSISVFDPQRRESVPLAVLAVMLLLLGWGWFALLMIVLVHGEPLPMDLAVNNM
FT                   MLALRNPLADYPMTALASLGDWQILLPAITVAMAYLAWHKRWMAVLHWLAALSFGLAFT
FT                   WLLGKTMHVVQPPAASSGFGFPSVAVTIVTITLGFFAVLIARELPGRNRVWPYMVTGAL
FT                   ASLIGFARLYLGAHWLSDVLGGMLFGIFWLLVLGIAYRRRLTHELQVNPLSWLFYGTFS
FT                   IAAIVMAPRHLEQKLTKFEPPPPSPRTIAAESWWKNDWRELPARRNEFDDAERWPLNVQ
FT                   VAGSLVPLQQHLETQGWRRQPQAGWKEALHLLDVNSQPNTVPVLPATLDTRVEALLMVR
FT                   NSPHADECYVLRLWPTATQLQPEQQPLWLGSVQTLHYDRHFSLMGLWYPLRGVDLALKE
FT                   LQSSLSALHHREEHHPDTNTPILLIDNRAPTVPTGAPTIPQEPSGLPTR"
FT   gene            288649..289308
FT                   /locus_tag="XfasM23_0213"
FT   CDS_pept        288649..289308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0213"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: xac:XAC3432 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91670"
FT                   /db_xref="GOA:B2I760"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2I760"
FT                   /protein_id="ACB91670.1"
FT                   /translation="MSRPFSVSETLKADCFGRILLVNGKGEKFIRRDLGAVSWWLRGLA
FT                   GWLARREVAALRQLNTLPAVPRLLNWDGVCLDRSFLSGQMMYQCPPRGDLAYFRAACRL
FT                   LQQMHRCGVVHNDLAKEANWLVLEDGSPGVIDFQLAVRGDPRAPWMRLLAREDLRHLLK
FT                   HKRMYCPEALTPVERRLLKRPSWIRRLWFATGKPVYRFVTRRVLHWEDNEGRGAKP"
FT   gene            289458..289628
FT                   /locus_tag="XfasM23_0214"
FT   CDS_pept        289458..289628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91671"
FT                   /db_xref="UniProtKB/TrEMBL:B2I761"
FT                   /protein_id="ACB91671.1"
FT                   /translation="MSALVGVSQQQIRTLCIGDCGASVLWAVAGCSRILMNERWLASFG
FT                   AVWLGPLVAYL"
FT   gene            complement(289619..290986)
FT                   /locus_tag="XfasM23_0215"
FT   CDS_pept        complement(289619..290986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0215"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcb:XC_3992 leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91672"
FT                   /db_xref="GOA:B2I762"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B2I762"
FT                   /protein_id="ACB91672.1"
FT                   /translation="MPIPFGFTVATTNTLPLHVLDRAHFANWLTAQSPAIQSWVQAQGF
FT                   AAAAGSVLLLPGEHGLSGAVLGTGDYADPYAYAHGPFALPAGTHWQPTGTWDPIKQATL
FT                   TLGWGLGSYRFTRYRLPDRAPAELAVTPTPETLALIQACLRVRDWVNTPTQDMGPEELQ
FT                   TITRDLAQRHGGTFESIIGEALLTQNFPTIHAVGRASHRAPRLLQLNWGQHTHPHLVLI
FT                   GKAVCFDTGGLDLKPADGMRHMKKDMGGAAHALALAGLVMEQQLPVRLTVLIPAVENAI
FT                   GPDAFRPGEVIVTRAGVSVEIDNTDAEGRLILCDTLAYANELKPHTILDFATLTGAARI
FT                   ALGPDLPALFSNNEVLAQAWLDAGKQTRDPVWRMPLWRPYLHYLNSHVADLANAGSRMA
FT                   GAVTAALYLERFVAQDLPWAHLDVYAWNDLNRPGRPAGGEALGLRSAWAMLKERYR"
FT   gene            complement(291110..292219)
FT                   /locus_tag="XfasM23_0216"
FT   CDS_pept        complement(291110..292219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0216"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   xcb:XC_3990 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91673"
FT                   /db_xref="GOA:B2I763"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2I763"
FT                   /protein_id="ACB91673.1"
FT                   /translation="MTDQPTHNNCTNDAIKRRRSPLTARPQAPLSLVVLATLAVGYTLW
FT                   ATQAVILPVLLAVFFALVGNPILRALGHIRIPRAIGALLLLCLGISGTVVLSVELAGPA
FT                   SEWIQQAPDKIRQVARQVRHLTRPMQQANQAVESLARAADGETERQSQIVRTRLYNPYT
FT                   VLMDTHKLVISVLGVILLTFFFMVFGEKLQRKAIALLPNHHQQRFTASILRNLEHEISR
FT                   YVLTISVINALVGLIFSGLLLLLSIPLQEALLWGTVVALLNFAPYVGPLIGVLLMLLIG
FT                   LVQFHESSRALLPALLYLMLHTLEGQLITPIILGHRMAISPLMLIVALLLFGSLWGLIG
FT                   LLLAVPMLVCIKMVMSRIEDLQRWSRLLE"
FT   gene            complement(292293..292673)
FT                   /locus_tag="XfasM23_0217"
FT   CDS_pept        complement(292293..292673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91674"
FT                   /db_xref="UniProtKB/TrEMBL:B2I764"
FT                   /protein_id="ACB91674.1"
FT                   /translation="MSFRTLCHRVERAERLVEERSKQTCNHWQELQHSWQATWTPLRIV
FT                   ITGLGLGFIAGRVKPSITLKTFTDKFGSAKHLIQILGAMSTFFTTTCAHNASKQNKPST
FT                   EESHTTTTSQPTADIINLSEHA"
FT   gene            complement(292670..293146)
FT                   /locus_tag="XfasM23_0218"
FT   CDS_pept        complement(292670..293146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91675"
FT                   /db_xref="GOA:B2I765"
FT                   /db_xref="UniProtKB/TrEMBL:B2I765"
FT                   /protein_id="ACB91675.1"
FT                   /translation="MNNQDTADRVSQSTAADVNPSDIQDSVETVTGAGRASLASSKATV
FT                   RAFYLLLLSDLKMAWSALGHAFIWACIMIVLGVSSWLLLIGITISLLERMGLPWLESLI
FT                   LTALGNLIMTGLAMWRMLHYLRHTGLHATRRQLLRLALLHGTDESQLTTEKDRS"
FT   gene            complement(293152..293517)
FT                   /locus_tag="XfasM23_0219"
FT   CDS_pept        complement(293152..293517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91676"
FT                   /db_xref="UniProtKB/TrEMBL:B2I766"
FT                   /protein_id="ACB91676.1"
FT                   /translation="MMNPTNTEHLKDNLNQAGARLKSAALAASEAVKDAAGAASEELKQ
FT                   GRSNVKAQLSDSAQAGLAAAEFSTAAAKEQVDALMDKGRNLLDSAAELIRERPLTSLGV
FT                   ALAAGWVIAKLSNNHDK"
FT   gene            complement(293772..295217)
FT                   /locus_tag="XfasM23_0220"
FT   CDS_pept        complement(293772..295217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0220"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: xcv:XCV4074 protease DO precursor; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91677"
FT                   /db_xref="GOA:B2I767"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2I767"
FT                   /protein_id="ACB91677.1"
FT                   /translation="MRPLPTLLTLSIAAAFGGFAATGMNAWLDNRAEAASNTNAISPIS
FT                   SLPTGTVPQTTATNQPLPSLAPMLQQVMPAVVSINSKQVVRVRNPFFDDPILRRLFPEI
FT                   PQERINESLGSGVIIDARNGYVLTNHHVIENADAVQVTLADGRSFKAEFLGSDADTDIA
FT                   LIRIKANKLTEIKLADSNKLRVGDFVVAIGNPFGFTQTVTSGIVSAVGRSGILGLGYQN
FT                   FIQTDASINPGNSGGALVNLHGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARNVVEQ
FT                   LVTKGVVVRGTIGVQTQNIDARMAQSLGLSNPHGALVTRVLPNSAGAAAGLQPGDVILA
FT                   ANDQRVDNAETLHNYEGLQPVGSSVTLEVHRGGKPLKIRLTLKELPRAIAGETLDSRLS
FT                   GAIFVDLPESLRQSGIGGVMVNKIKHGSRAAANGLVAGDVIIAASIGEFSDLASWRASF
FT                   SHPPQRLILRVLRGNAQYDALMR"
FT   sig_peptide     complement(295155..295217)
FT                   /locus_tag="XfasM23_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.642 at
FT                   residue 21"
FT   gene            complement(295500..296396)
FT                   /locus_tag="XfasM23_0221"
FT   CDS_pept        complement(295500..296396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0221"
FT                   /product="protein of unknown function DUF1731"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; domain of unknown
FT                   function DUF1731; KEGG: xcv:XCV4067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91678"
FT                   /db_xref="GOA:B2I768"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I768"
FT                   /protein_id="ACB91678.1"
FT                   /translation="MRLLITGGTGFIGTPLCAMLIGGGHQVTVLSRDPTRHSARLPQVQ
FT                   LVNTLENVVTPIDAIINLAGKSLLEGRWNKHIKEEIRSSRLQTTRRLYDWIATLAVERR
FT                   PRRLISASAIGYYGECGDTPLKESAPPGNDFAAQLCRDWENEALRISALGSQVSLIRIG
FT                   IVLERDGGALGQMLPAFRFGVGGRFGNGQHWMSWIHREDLINMIIWLIEHGQPGAYNLT
FT                   APHPVINAAFVRALGAILHRPTLFTLPPQLLRLCFGEIADLLTLSQRVKPGRALEEGYR
FT                   FKHTDINAALASILRKN"
FT   gene            complement(297100..298809)
FT                   /locus_tag="XfasM23_0222"
FT   CDS_pept        complement(297100..298809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0222"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   xcc:XCC1858 long-chain fatty acyl CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91679"
FT                   /db_xref="GOA:B2I769"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2I769"
FT                   /protein_id="ACB91679.1"
FT                   /translation="MSQTRPWLQHYPSGISIEIDTNAFRTIADVFNTSVIKYRHCPAYT
FT                   NFGKTLTYGEVDLLTKQFASYLLNVLKLKKGDRIALMMLNCLQYPVATFGALCAGLTVV
FT                   NVNPLYTARELKHQLVDAGSTVLVVMDNFCTTVQQIIADTPIKQVITTELGDLLDFPKR
FT                   SLINFAVKHIKKLVPEYQLPRSIRFREALALGSKHSMPPIHIASDDLAFLQYTGGTTGT
FT                   PKGAMLTHRNMVANMQQVSQWLQTNNSLKEGCETVLTALPLYHIFALTANSLVFMKIGG
FT                   CNHLISNPRNMRTFVKELQRVRFTVITGVNTLFNKLLNTPGFDKLDFSSLKIALGGGMV
FT                   IQRSVAEQWKQVTRVPLIEAYGLTEASPAACINPLNLQEHNGSIGMPIPSTDVCIKDDT
FT                   NTVLPIGEMGELCIKGPQVMKGYWQRPEETSEVLDADGWLHTGDIVKMDKQGFLYIIDR
FT                   KKEIILVSGFNVYPKEIEEVIAMIPGVAEVAAVGVPDEQSGEVVKVVIVKKDPMLTAEE
FT                   VKAHAATNLTRYKLPRIIEFRATLPKTDVGKILRRELRDAAPASNTFTAQPK"
FT   gene            299572..299769
FT                   /locus_tag="XfasM23_0223"
FT   CDS_pept        299572..299769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91680"
FT                   /db_xref="UniProtKB/TrEMBL:B2I773"
FT                   /protein_id="ACB91680.1"
FT                   /translation="MEYYFQAIVSSRYMVDGDTRVNPLVFEVIPTLLHVIVLTRMQSVF
FT                   IVLLPLEWLSMRFPVRSCLF"
FT   gene            complement(300296..303022)
FT                   /locus_tag="XfasM23_0224"
FT   CDS_pept        complement(300296..303022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0224"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: xcv:XCV1924 aconitate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91681"
FT                   /db_xref="GOA:B2I774"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B2I774"
FT                   /protein_id="ACB91681.1"
FT                   /translation="MRDSFSTHRQLHVGNQSYHYYSLTKLGEHFDISHLPYSMKILLEN
FT                   LLRHEDGGVTVSTAHIEAVAKWNPKAEPDTEIAFMPARVLLQDFTGVPCLVDLAAMRDA
FT                   AIRLGGTAEQINPHIPSELVIDHSVQVDVFGKPEALERNGNIEFQRNKERYGFLRWGQK
FT                   AFNNFKVVPPNTGIVHQVNLEHLARVVMTTEKEGATWAYPDTVFGTDSHTTMINGIGVL
FT                   GWGVGGIEAEAAMLGQPSSMLIPQVVGFKLTGTLPEGATATDLVLTVTQMLRKHGVVGK
FT                   FVEFYGDGLAHLPLADRATIGNMAPEYGATCGIFPIDTESLNYLRLSGRSESQIALVQA
FT                   YAKAQGLWYAPNTPPPSYSTTLELNMDDIKPSLAGPKRPQDRVLLQDMQNNYREHVRAL
FT                   TAHRTTKANDHDTHPIKGQVDLDINGQTLQLKDGAVVIAAITSCTNTSNPAVMFGAGLL
FT                   ARNAVAKGLQRQPWVKTSLAPGSRVVTDYLEKAGLLNDLETLGFYVVGYGCTTCIGNSG
FT                   PLPPEVSAGIAKGDLVAAAVLSGNRNFEGRIHPEVKMNYLASPALVVAYAIAGTVNSDL
FT                   TSEPLGNGNDGQPVYLRDIWPSNKQIGDAIAATIGPEMFQQNYADVFKGDTRWNTIASP
FT                   NGALYAWDAHSTYIKNPPYFDGMTMQTEPVKDVRGARVLGLFADSITTDHISPAGNIKQ
FT                   DSPAGRFLQEHGVQPTDFNSYGSRRGHDDVMVRGTFANIRLKNLMLNGEEGGNTWYRPK
FT                   AGGPPEKMSIYDAAMKYNTDGVPLVVIAGKEYGTGSSRDWAAKGTKLLGIKAVIAESFE
FT                   RIHRSNLVGMGVLPLQFLDGQNAQTLGLDGSEMFDVTGLEGTISKHATVSAKQSDGSIK
FT                   QFQVKVLLLTPKEVDYFTHGGLLQYVLRHLINTGKPA"
FT   gene            303282..303509
FT                   /locus_tag="XfasM23_0225"
FT   CDS_pept        303282..303509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0225"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: xcb:XC_2328
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91682"
FT                   /db_xref="GOA:B2I775"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B2I775"
FT                   /protein_id="ACB91682.1"
FT                   /translation="MDATVAERGQITLPKRVRDALGLTKGTVLKVELEGGRIILRKSVD
FT                   DAIARARGRFILDDLDDFGCSATATKTDKQ"
FT   gene            303514..303912
FT                   /locus_tag="XfasM23_0226"
FT   CDS_pept        303514..303912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_2327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91683"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B2I776"
FT                   /protein_id="ACB91683.1"
FT                   /translation="MIAVDFPVLVELLTDRPQADAVEAALRQCLVSGRVVVCDVVLAEM
FT                   SAVLRGGAEVLGVLEEMGVHFDPLEAKSALRAGEMYRRYRQRNATESDMKYFLVGAHAL
FT                   LQCDGLMTWNDAFYRDYFKGMKLIVPGA"
FT   gene            303909..306569
FT                   /locus_tag="XfasM23_0227"
FT   CDS_pept        303909..306569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0227"
FT                   /product="aconitate hydratase 2"
FT                   /note="TIGRFAM: aconitate hydratase 2; PFAM: aconitate
FT                   hydratase domain protein; Aconitase B, N-terminal; KEGG:
FT                   xac:XAC1885 bifunctional aconitate hydratase
FT                   2/2-methylisocitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91684"
FT                   /db_xref="GOA:B2I777"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B2I777"
FT                   /protein_id="ACB91684.1"
FT                   /translation="MSASIHTLSILNYLCGELPMLEAYRHHVAERAALGIPPLPLSAQQ
FT                   TADVIELFKAPPAGEEDFLLDLITHRVPGGVDDAAKVKASYLAAVAFGTEVTPLLTSQR
FT                   ATELLATMLGGYNIQPLIDLLDHAALGQVAAEGLKHTLLVFDAFHDVQEKAEQGNGNAR
FT                   AVLESWAAAEWFTSKPEVPQCLTVTVFKVPGETNTDDLSPAPDATTRPDIPMHALAMLK
FT                   NKREGAPFVPEEDGKRGPIQEMLSLKEKGHLVAYVGDVVGTGSSRKSATNSVLWWTGKD
FT                   IPYIPNKRFGGVCLGSKIAPIFYNTMEDAGALPIELDVSKMEHGDVIELYPYEGKARKN
FT                   GVVIAEFSLKSDVLLDEVRAGGRIPLIIGRGLTSKAREALKLEPTSLFRLPVNPPETGR
FT                   GFSLAQKIVGRACGLPEVNGKQQGMRPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLG
FT                   FSADLVMQSFCHTAAYPKPVDVKTHHTLPEFISTRGGVSLRPGDGVIHSWLNRMLLPDT
FT                   VGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGHMQPGVTLRDLV
FT                   NAIPLYAIKQGLLTVAKQGKKNIFSGRILEIEGLPNLKVEQAFELSDASAERSAAGCTV
FT                   RLNKEPIIEYLNSNITLLKWMIAEGYADARSLARRIKKMEAWLADPQLIEPDTDVEYAA
FT                   VIEIDLADIHEPIVACPNDPDDVKTLSEIAGAKIDEVFIGSCMTNIGHFRAAAKLLEGK
FT                   RDIPTRLWVAPPTKMDASELTKEGHYGTFGNAGARMEMPGCSLCMGNQAQAREGATVFS
FT                   TSTRNFPNRLGRNTNVYLGSAELAAICSRLGKIPTKDEYMADIGVIDTQRTEIYRYMNF
FT                   DQIQEYLDVDHTAVA"
FT   gene            306956..307031
FT                   /locus_tag="XfasM23_R0017"
FT                   /note="tRNA-Phe1"
FT   tRNA            306956..307031
FT                   /locus_tag="XfasM23_R0017"
FT                   /product="tRNA-Phe"
FT   gene            complement(307304..307759)
FT                   /locus_tag="XfasM23_0228"
FT   CDS_pept        complement(307304..307759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0228"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   mfa:Mfla_1174 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91685"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B2I778"
FT                   /protein_id="ACB91685.1"
FT                   /translation="MKSSQYPAQDLKRRVLSWAVKLKVNPRAVRVQDMRKKWGSCSSTG
FT                   TITLASDLLDQEQRFQDYVIVHELLHLRLATHGRMFKALMSAYVPGWHAMEGTGQHRFA
FT                   ESTDRQEAGCDAGGIDEHTVRHRTRKKGNSATQHGTVAVHVENSVSA"
FT   gene            complement(307821..309611)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0229"
FT   gene            complement(309642..310700)
FT                   /locus_tag="XfasM23_0230"
FT   CDS_pept        complement(309642..310700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0230"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: protein of unknown function DUF450; KEGG:
FT                   mfa:Mfla_1175 type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91686"
FT                   /db_xref="GOA:B2I779"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B2I779"
FT                   /protein_id="ACB91686.1"
FT                   /translation="MSTLKISEAGTVQFPMVKHAVEIGWTSITPEDARTKRGGEAGTFF
FT                   RDVLEAKLAAFNPWMSADTMRSVVETLDALPATIEGNRKLLAWLRGEHQWYDASAKRHR
FT                   PVTLIDFTHVADNLFHVTWEWKIKPPARKGNRADVMFLINGVPVMIVEHKNPKDGDAIE
FT                   RAIKQLRRYTLETPELLATAQLFNVTHLLDYWYGVTWNANRRSMARWKQAPEETYRFAV
FT                   QSFFQPTEFLRTLQHWILFYVEDGKMRKSVLHQHQRRAIDVILERCADPAKTRGLIWHT
FT                   QGLGKTFTLLTAARLILENKARFANATVILVVDRTELEGQLKGWVECLLGEMQQQDITV
FT                   KRANNKAKLQSL"
FT   gene            complement(310697..311316)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0231"
FT   gene            complement(311347..311925)
FT                   /locus_tag="XfasM23_0232"
FT   CDS_pept        complement(311347..311925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0232"
FT                   /product="Restriction endonuclease S subunit-like protein"
FT                   /note="KEGG: swo:Swol_0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91687"
FT                   /db_xref="GOA:B2I780"
FT                   /db_xref="UniProtKB/TrEMBL:B2I780"
FT                   /protein_id="ACB91687.1"
FT                   /translation="MKSARVLRSTNFAGDGLLDFDDVVELEVEDRHVASRQLQPGDIII
FT                   ERPGGGPKQPIGKAALFVPFDDHTYFSSNFTTTIRIRDRSLFDPGYVALYLHALYLDEA
FT                   TETLQRATTGIRNLDWREYLRIEVPAHPLQEQQSLARLIIGVRTAYRHEQHLCQTLMAL
FT                   KRSALSSIFTRGLHGEAQKDTEIGPMPES"
FT   gene            complement(311998..313614)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0233"
FT   gene            complement(313625..313864)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0234"
FT   gene            313980..314408
FT                   /pseudo
FT                   /locus_tag="XfasM23_0235"
FT   gene            314827..315150
FT                   /locus_tag="XfasM23_0236"
FT   CDS_pept        314827..315150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV4088 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91688"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2I781"
FT                   /protein_id="ACB91688.1"
FT                   /translation="MAIVVSIAVIHLMVAVVWWRTQGVILVQRVTAISSRSSAATPLLQ
FT                   GTGYVIARRQATVSAQVSGVLVQLFIEEGDTVKAGQVIARFDDSALRTEFNTAVVSVEA
FT                   AAA"
FT   gene            315265..315847
FT                   /pseudo
FT                   /locus_tag="XfasM23_0237"
FT   gene            316138..316887
FT                   /locus_tag="XfasM23_0238"
FT   CDS_pept        316138..316887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0238"
FT                   /product="Triose-phosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; KEGG: xcb:XC_1587
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91689"
FT                   /db_xref="GOA:B2I782"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I782"
FT                   /protein_id="ACB91689.1"
FT                   /translation="MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLY
FT                   LSDLAQRFKGEGLAFGAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHED
FT                   SELVARKFAAALSAGLRPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLI
FT                   AYEPVWAIGTGRHADPSQVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFS
FT                   QQDVDGGLIGGASLVADDFLAIARATV"
FT   gene            316929..317327
FT                   /locus_tag="XfasM23_0239"
FT   CDS_pept        316929..317327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0239"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: xac:XAC2706
FT                   preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91690"
FT                   /db_xref="GOA:B2I783"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B2I783"
FT                   /protein_id="ACB91690.1"
FT                   /translation="MLLLNVIYVLVAIAMIVLILMQRGTGAAAGSGFGAGASGTVFGSR
FT                   GASNFLSKSTKWLAVVFFGISLFMAWYASRGHHSVAQQNSLMTEVPAAPAAGADQAASP
FT                   VLQVPAVPTSTNTPVGDKEKASDHSQKR"
FT   sig_peptide     316929..317012
FT                   /locus_tag="XfasM23_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.394 at
FT                   residue 28"
FT   gene            317375..317459
FT                   /locus_tag="XfasM23_R0018"
FT                   /note="tRNA-Leu1"
FT   tRNA            317375..317459
FT                   /locus_tag="XfasM23_R0018"
FT                   /product="tRNA-Leu"
FT   gene            317531..317938
FT                   /locus_tag="XfasM23_0240"
FT   CDS_pept        317531..317938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0240"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: xcv:XCV2853 NADH dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91691"
FT                   /db_xref="GOA:B2I784"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:B2I784"
FT                   /protein_id="ACB91691.1"
FT                   /translation="MPMSSYFMGASVRKRIAVLAEYLPILIFLVVATGIGLALILIGRF
FT                   LGPHRPDSEKLSSYECGFSAFEDARMKFDVRYYLIAIQFIVFDLEIIFIVPWTQVFMDI
FT                   GARSLVTMGLFVGMLFLGFIYVWKKGALEWE"
FT   gene            317929..318483
FT                   /locus_tag="XfasM23_0241"
FT   CDS_pept        317929..318483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0241"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xcb:XC_1590 NADH dehydrogenase subunit B;
FT                   TIGRFAM: NADH-quinone oxidoreductase, B subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91692"
FT                   /db_xref="GOA:B2I785"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I785"
FT                   /protein_id="ACB91692.1"
FT                   /translation="MGVIQAIDRLMTNPIPDGQVDDILRPQGESPLLQKGYVTTSVDAL
FT                   LNWARTGSMWPMTFGLACCAVEMMHAGAARLDLDRYGIVFRPSPRQSDVMIVAGTLVNK
FT                   MAPALRKVYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAE
FT                   ALVYGILQLQKKIWRTKTIAG"
FT   gene            318601..319287
FT                   /locus_tag="XfasM23_0242"
FT   CDS_pept        318601..319287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0242"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: xcv:XCV2851 NADH dehydrogenase subunit C;
FT                   TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C; PFAM:
FT                   NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91693"
FT                   /db_xref="GOA:B2I786"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I786"
FT                   /protein_id="ACB91693.1"
FT                   /translation="MAQPRGEISLDVPVVEWCAVCKALRDEFDFEQLSDLCGVDYLGYG
FT                   NAEWDTTDVSAQGFSRGVAGKAVGRFAWGEFPSAGSNDGTQPWDVPQERFAVLAHLISY
FT                   RHNRRLRVRCFASNDALPIVASLTDVWPGVNWFEREAFDLFGIVFEGHPDLRRILTDYG
FT                   FIGHPFRKDFPLTGNVEVRYDEEKKRVVYVPVTSVEPRVSVPRVIRDDPRFGAAAGEST
FT                   HSETVK"
FT   gene            319284..320591
FT                   /locus_tag="XfasM23_0243"
FT   CDS_pept        319284..320591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0243"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xom:XOO_3064 NADH dehydrogenase subunit D;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91694"
FT                   /db_xref="GOA:B2I787"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I787"
FT                   /protein_id="ACB91694.1"
FT                   /translation="MNQIRQAPAASASNATESKQEIRNYTMNFGPQHPAAHGVLRLILE
FT                   MDGETVVRADPHIGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRAIETLI
FT                   GIQAPERAQYIRTMFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDVYEAIS
FT                   GARMHAAYYRPGGVYRDLPDTMPKYKESRWHKGKALKRLNAAREGSMLDFLEHFTDTFP
FT                   QRIDEYETLLTDNRIWKQRTVGVGVIEPDVAKAWGMTGVMLRGSGIAWDLRKKQPYAKY
FT                   DAVDFDIPLGTCGDCYDRYLCRVAEMRESNRIIKQCVQWLKMNPGQVMVENCKVAPPKR
FT                   ESMKDDMEALIHHFKLFSEGYCVPAGETYSAVEAPKGEFGCYLISDGANKPFRVHLRAP
FT                   GFAHLSSMDAVVRGYMLADVVAMIGTYDLVFGEVDR"
FT   gene            320588..321115
FT                   /locus_tag="XfasM23_0244"
FT   CDS_pept        320588..321115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0244"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit; KEGG:
FT                   xcb:XC_1593 NADH dehydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91695"
FT                   /db_xref="GOA:B2I788"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B2I788"
FT                   /protein_id="ACB91695.1"
FT                   /translation="MKATKSFELVRDVDPQVVLGDRTRAHIDHWLAKFPADQKRSALLQ
FT                   GLYAAQEQNQGWLTDELIAAVAKYLDIPSVWAYEVATFYSMFETRKVGRHNVAFCTNVS
FT                   CWLNGAEDLVSYAEEKLGCKLGQSTADGRVYLKCEEECLAACAGAPMMVINGHYHERLT
FT                   KEKVDQLLDGLE"
FT   gene            321120..322454
FT                   /locus_tag="XfasM23_0245"
FT   CDS_pept        321120..322454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0245"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xac:XAC2699 NADH-ubiquinone oxidoreductase
FT                   NQO1 subunit; TIGRFAM: NADH-quinone oxidoreductase, F
FT                   subunit; PFAM: Respiratory-chain NADH dehydrogenase domain
FT                   51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91696"
FT                   /db_xref="GOA:B2I789"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B2I789"
FT                   /protein_id="ACB91696.1"
FT                   /translation="MGHPHVSKGPVGPAPQPHQVIYTTLHYEIPWSYESYLKTGGYTAL
FT                   RKIFEEKIPPEQVIDMVKQSNLRGRGGAGFPTGLKWSFMPKGTMQKYILCNSDESEPGT
FT                   CKDRDILRYNPHSVVEGMAIACYATGSTVAYNYLRGEFHHEPFEHFEQALADAYTHGWL
FT                   GKSVLGSGVDIDIYAVLGAGAYICGEETALMESLEGKKGQPRYKPPFPANFGLYGKPST
FT                   INNTETYAAVPAIIRNGPEWFLSLSKTKNGGSKIFSVSGCVQQGGNFEVPLGTTFDELL
FT                   EMAGGLRPGRALKAAIPGGVSMPVLKAEQLQGLQMDYDTLRVLGSGLGSGGIVVLDDSV
FT                   CCVRFACRISQFFHKESCGQCTPCREGTGWMHRVLERIVAGQATMEDLHQLKVVAGQIE
FT                   GHTICAFGEAAAWPIQGFLRQFWDEFEYYIVHGRSIVDDKARVAA"
FT   gene            322451..324685
FT                   /locus_tag="XfasM23_0246"
FT   CDS_pept        322451..324685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0246"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   ferredoxin; molybdopterin oxidoreductase; KEGG: xcv:XCV2847
FT                   NADH dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91697"
FT                   /db_xref="GOA:B2I790"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2I790"
FT                   /protein_id="ACB91697.1"
FT                   /translation="MSDQSVNPEVRPDRVTIEIDGQNLVVPKGSMIIQAADNAGIPIPR
FT                   FCYHEKLPIAANCRMCLVDVEKVPKPLPACATPVMEGMKVRTRSEKALQYQRSVMEFLL
FT                   INHPLDCPICDQGGECELQDVSMGYGRSVSRFHERKRVVPDEDIGPLVATEMTRCIQCT
FT                   RCVRFTADIAGTYELGGMYRGENLQIGTYDGKPLITELSGNVVDVCPVGALTNKVFQFR
FT                   ARPWELMAYQSLGYHDAMGSNLFLHVRQGEVLRTVPRDNEYVNECWLSDRDRYSHQGLY
FT                   AADRAVKPLKKVGDQWLEVSWAEGVSAAAEILSAHRGDALGVLVHPATSNEEGALLARL
FT                   AAGLGTGHLDHRIFNRDFSDVAVAEPFALPLAEIGNADLVVLFGSNIRQELPLLHARLR
FT                   KAVTCNGAKVYAVNPVDFDFTFSLTGKSIVPPSQLANALTDAALLNAAKAAARVVIVVG
FT                   ALAENHPQAATLRAAARQFAETTGAALCRIPQGANSIGLTQHGVLPTGRDAAAMLVEPC
FT                   QAYVLYGIEPGLDFADTATARQVLHGAKVVAFSHFACVSTRDVADVILPIGLLPEIDGT
FT                   LTNLDGRTQAAKPGGKLPLEAREGWRVLRALGGELGLSGFDFLDLAGLRAQLRPHPVVP
FT                   STSAQPIAAQEGLEVAATPAIYRTDAVVRRAAALQAHPLNVAPALALHPEQAKQLQVVA
FT                   GQMVKVSTAAGKATLPVVLDTRVALGTVWIETGHGATAPIGAGRVTMVAV"
FT   gene            324682..325773
FT                   /locus_tag="XfasM23_0247"
FT   CDS_pept        324682..325773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0247"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: xoo:XOO3228 NADH dehydrogenase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91698"
FT                   /db_xref="GOA:B2I791"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I791"
FT                   /protein_id="ACB91698.1"
FT                   /translation="MNTWFLNVVDPLHQWFLGFGDIGVVLWTVLKILMIAIPLIVSVAF
FT                   YVVWERKLIGWMHVRHGPMYVGMGLFQAFADVFKLLFKEVLYPSKAHKAIFVIAPLLTL
FT                   APSFAAWAVVPFDTKLVLSNANVGLLYLLAMTSLGVYGIILAGWASNSKYAFLGAMRSA
FT                   AQVVSYEIAMGFALVGVMIAAGSLNLSQIVMAQAGSSGFFDWFLIPLFPLFIVYWVSGV
FT                   AETNRSPFDVVEGESEIVAGHMVEYSGSVFALFFLAEYANMILVSFLISIFFLGGWLSP
FT                   IQGWVSGQVSPLIDWVWNGGWPWLLLKVLFFASAYIWFRASFPRYRYDQIMRLGWKVFI
FT                   PLTIVWIAVTALMVFSGVIQKGV"
FT   gene            325777..326265
FT                   /locus_tag="XfasM23_0248"
FT   CDS_pept        325777..326265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0248"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /EC_number="1.6.99.3"
FT                   /note="KEGG: xcb:XC_1597 NADH dehydrogenase subunit I;
FT                   TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91699"
FT                   /db_xref="GOA:B2I792"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2I792"
FT                   /protein_id="ACB91699.1"
FT                   /translation="MNRVMHYFKSLLLLELLAGLWLTLKYTFRPKYTVLYPMEKFPQSP
FT                   RFRGLHALRRYPNGEERCIACKLCEAVCPALAITIDSAKREDGTRRTTRYDIDLFKCIF
FT                   CGFCEESCPVDSIVETHILEYHFEKRGENIVTKPQLLAIGDRFEAEIAERRAADAAFR"
FT   gene            326273..326938
FT                   /locus_tag="XfasM23_0249"
FT   CDS_pept        326273..326938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0249"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: xcb:XC_1598 NADH dehydrogenase subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91700"
FT                   /db_xref="GOA:B2I793"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:B2I793"
FT                   /protein_id="ACB91700.1"
FT                   /translation="MDWVNIAFYLFSAVVVAAAGAVISVRHPVYAVLCLILTFFSMACI
FT                   WLLVGAEFLGVTLVLVYVGAVMVLFLFVVMMLDIDTSRLREGWVRYLPVGLLVAGVMLV
FT                   QMVVLIGVKMRMATPFPVDNAAAQAADTSNLIWLAHSLFTDFLFPFEFAAVILTVAVIA
FT                   AVMLTLRKREGVKTQDPSQQTRVKSADRLRIVSMPTEKPIAVVPIRSDTNNDAQEITP"
FT   sig_peptide     326273..326338
FT                   /locus_tag="XfasM23_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.218 at
FT                   residue 22"
FT   gene            326935..327240
FT                   /locus_tag="XfasM23_0250"
FT   CDS_pept        326935..327240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0250"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   xom:XOO_3057 NADH dehydrogenase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91701"
FT                   /db_xref="GOA:B2I794"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B2I794"
FT                   /protein_id="ACB91701.1"
FT                   /translation="MISLGHLLALGAVLFCISLAGIFLNRKNVIVLLMSIELMLLAVNV
FT                   NFIAFSRQLGDTAGQLFVFFILTVAAAEAAIGLAILVTLFRTHHTINVAEVDALKG"
FT   sig_peptide     326935..326997
FT                   /locus_tag="XfasM23_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.828 at
FT                   residue 21"
FT   gene            327248..329389
FT                   /locus_tag="XfasM23_0251"
FT   CDS_pept        327248..329389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0251"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xac:XAC2693 NADH dehydrogenase subunit L;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH-Ubiquinone oxidoreductase (complex I)
FT                   chain 5/L domain protein; NADH/Ubiquinone/plastoquinone
FT                   (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91702"
FT                   /db_xref="GOA:B2I795"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:B2I795"
FT                   /protein_id="ACB91702.1"
FT                   /translation="MDITLSKNMLIAVVLAPLFGSIIAGLLGRQVGRKGAHCVTLLGVA
FT                   VSCAMSCWTLYQLVGQGAAPFNQNLYTFFQVGEYSAHVGFMIDRLTAVMMVVVTFVSLL
FT                   VHLYTIGYMEEDPGYQRFFSYISLFTFSMLTLVMSNNFLQLFFGWEAVGLVSYLLIGFW
FT                   FKRPSAIFANMKAFLVNRVGDFGFLLGISLVLYTFGTLDYSVVFANVGSLVGQTTNVWS
FT                   GNVDVFGSIIHVMGPLSWSTATLVCICLFIGAMGKSAQVPLHVWLPDSMEGPTPISALI
FT                   HAATMVTAGIFMVARMSPLFQLSEVALQFVLFVGATTAFFTGLIGMVQNDIKRVVAYST
FT                   LSQLGYMTVALGVSAYSAAVFHLMTHAFFKALLFLAAGSVIIGMHHEQDMRKMGGLRKY
FT                   MPITYITSVIGTLALVGTPFFSGFYSKDTIIEAAAYHAEHAHSWVATYGYWAVLGGVLV
FT                   TSFYSFRLLFLTFHGEERFRRVGGGHDADDHVNTHTSNDEHAHGVHEPQESPWVVTLPL
FT                   IFLAIPSIALGFFTIGPMLFGTDWAGHHAVEVIWGQTVSFFTGIIDFYDPAQNTVAVLG
FT                   EEFRGPVAFALHGMMSAPFFLTVAGFLLAVLLYLWKPQWPVKIRETFSLPVRILENKYG
FT                   FDALWIGGFSGWGLKLGNVSRAIDTHVVDGVLVNGSARLIDVVANVLRRTQSGFVYHYA
FT                   FAMIIGLIALLAVLMCFWR"
FT   sig_peptide     327248..327322
FT                   /locus_tag="XfasM23_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.552 at
FT                   residue 25"
FT   gene            329411..330916
FT                   /locus_tag="XfasM23_0252"
FT   CDS_pept        329411..330916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0252"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xom:XOO_3055 NADH dehydrogenase subunit M;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91703"
FT                   /db_xref="GOA:B2I796"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B2I796"
FT                   /protein_id="ACB91703.1"
FT                   /translation="MSNWPLLSVLIWLPIIGGLLIMGLRNAHVARWAALAVALVTFGFS
FT                   LHLLGGYDIAKDALQFVEQHVWIQTYSIGYNLGVDGIAIALVLLTTLVTVLVLIGSWGS
FT                   IQQRVPQYVAAFLILEGVTIGIFAATDAMLFYVFFEAMLIPMFLIIGVWGGPRRIYAAI
FT                   KFFLYTFLGSVLMLVGLIYLYLKGGSFQLADLYAMQLSAKEQTWLFFAFLIAFAVKVPM
FT                   FPVHTWLPDAHVEAPTAGSVILAAIALKIGGYGFLRFNLPIVPDASHEFAWVVIALSLI
FT                   AVIYVGLVALVQEDMKKLIAYSSIAHMGFVTLGIFIAFTLVRDFGNTDAARLGLQGAMV
FT                   QMISHGFVSGAMFTCIGVLYDRMHTRRIADYGGVVNVMPWFATFAILFYMANAGLPGTS
FT                   GFVGEFMVILASFQKHPLVAFGAGTTLVITAAYTLWLYKRVFFGEVANTHVAALKDINF
FT                   REASVLVLFAIGVLVLGLYPKPLIDLMDSSIVKLTTQIAVSKL"
FT   sig_peptide     329411..329494
FT                   /locus_tag="XfasM23_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.739 at
FT                   residue 28"
FT   gene            330951..332408
FT                   /locus_tag="XfasM23_0253"
FT   CDS_pept        330951..332408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0253"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: xcb:XC_1602 NADH dehydrogenase subunit N;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain N; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91704"
FT                   /db_xref="GOA:B2I770"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:B2I770"
FT                   /protein_id="ACB91704.1"
FT                   /translation="MTMPTSGLNIADLAPLLPELVLLASTFALLMIDLFIGQVRKVWTH
FT                   FLSVAILVVVLSMLVAGVGGQGAAFHGMFVRDSAADMMKVVIVLVSALSLVYGWSYLRE
FT                   RNLFQGEIPVLVLFATLGMMVLVSAGHLLMVYLGLELLALCSYALVAVNRDSKISTEAA
FT                   MKYIVLGSLASGLLLYGMSLIYGATGTLSLPGISDVIHGSSEKTLLLTGTVFLIAGVAF
FT                   KLGAVPFHMWLPDVYQGAPTPIVLFISSAPKLAAFGMAYRLLEVGVGPLSPQWHLIFGG
FT                   LAALSLVIGNLMAIVQTNLKRMLAYSTVSHVGFLMMGMSGGGIRGYSSSMFYVLSYAIM
FT                   STASFGAIIAMSSRGSEAENIDDFKGLSTRHPWMACLLLCVMASLAGIPPFLGFWTKLA
FT                   VLGAAVQGGMLWLAILGVICAVIGAYYYLRVIKVMYFDEPVGEPLPVNDGRVLRVILSI
FT                   NVFALLALGILWNPIIDWCQKAFAHLV"
FT   gene            complement(333109..333849)
FT                   /locus_tag="XfasM23_0254"
FT   CDS_pept        complement(333109..333849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0254"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="TIGRFAM: acetoacetyl-CoA reductase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   xcv:XCV3614 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91705"
FT                   /db_xref="GOA:B2I771"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I771"
FT                   /protein_id="ACB91705.1"
FT                   /translation="MTLRIAYVTSGMGSIGTAICQKLARNGHTVVAGCGPNSPRKANWL
FT                   REQRELGFDFIASEGNAADWDSTVSAFAKVKAEVGEIDVLVNNAGNNRDMLFRQMGRED
FT                   WNSVISSNLNSLFNITKQVIDAMTARNWGRIVNIGSVSAHKGQIGQVNYATAKAAMHGF
FT                   TRALAQEVATRNVTVNTISPGYIASAAISSFPPDVLDRLANSVPMRRLGKAEEVAGLCA
FT                   WLVSDEAAYVTGADYAVNGGLRME"
FT   gene            complement(333908..335239)
FT                   /locus_tag="XfasM23_0255"
FT   CDS_pept        complement(333908..335239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0255"
FT                   /product="citrate/H+ symporter, CitMHS family"
FT                   /note="TIGRFAM: citrate/H+ symporter, CitMHS family; PFAM:
FT                   C4-dicarboxylate anaerobic carrier; Citrate transporter;
FT                   KEGG: xcb:XC_0810 Mg++ citrate complex transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91706"
FT                   /db_xref="GOA:B2I772"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:B2I772"
FT                   /protein_id="ACB91706.1"
FT                   /translation="MLTALGFGMVITFMYLIMSKRLSPLVSLIIVPIVFALAGGFGSSM
FT                   SEMMLEGIKKIAPTGVMLMFAILYFGVMIDAGLFDPLVRRILRIVKGDPMKIVMGTAIL
FT                   ALLISLDGDGSTTYMITVSAMLPLYQRLGLNALNLTCVTILAGGVMNLTPWGGPTARAA
FT                   TALRVDPADVFIPLIPAMGIAIIGILTLAWWLGMKERKRLGVAKLPNSGAWNGYAMHDD
FT                   EDALPTMEGDAEDIKRPKLLWVNFALTIALMAGLVVGILPMPILFMIGFALALLINYPN
FT                   LAEQRRRVVNHAGNVLSVVSLIFAAGIFTGILSNTGMVDAMSRSFLALIPDSLGPYLAV
FT                   ITAIASMPFTFFMSNDAFYFGVLPILSEAASHYGITPVEMARASLAGQPVHLLSPLVPS
FT                   TYLLVGLAKVDFGDHQRFSLKWAVLISMVLLLSSLLFLIYPLAA"
FT   gene            complement(335372..336568)
FT                   /locus_tag="XfasM23_0256"
FT   CDS_pept        complement(335372..336568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0256"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   xcb:XC_0811 porin O"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91707"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7H9"
FT                   /protein_id="ACB91707.1"
FT                   /translation="MAIRRLRTIFVSLLLGLAASATQAADRSDRNVTAKLEGRFEWDFA
FT                   LFDNDTRGTPNRSNNEIRRFWLDVTGKVFAFDYTIEGNFTNLQDKFKGKSIEMGDVYLR
FT                   HDFGNTGTLTLGQFKQHFSLDDRTSPDYGQFLERSGGANTLAPEYHKGVSWKATHQNTT
FT                   WWVSAYSLDSISLSNVNGRGLGGRGTWSPDTPEGDVLHLGLSLAHQRYDHPGSDGMTAL
FT                   SIRPLPAGHLSDNSGITLAHFANGRDTKVNRWALEYAQVRGPLSWQSEYIGGAFNDGMQ
FT                   RATVQSAYGFVSWFVTGESRTYDRKTGRFTRIKTLHNPRGALELALRYDRMWGNQHHNN
FT                   QPNFLNASTASCTLGVNWYIKPNLRLMLNLIDSRNRDRLAGTVLDHTRALTGRLHYDF"
FT   sig_peptide     complement(336494..336568)
FT                   /locus_tag="XfasM23_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            336768..337463
FT                   /locus_tag="XfasM23_0257"
FT   CDS_pept        336768..337463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0257"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xcv:XCV3611 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91708"
FT                   /db_xref="GOA:B2I7I0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I0"
FT                   /protein_id="ACB91708.1"
FT                   /translation="MRLLLIEDNADLADAIIRRMRRHGHAVDWQSDGLAAAGVLRYQRF
FT                   DLVVLDIGLPSLDGLQLLSELRQRGDTTPVLILTARDAIEDRVYTLNVGADDYLSKPFD
FT                   FREFEARCRVLLRRNRGNASEVVRIGGFEFDNAAHRICLNGEPIKLPNREYRLLEILIA
FT                   RLGQIVGKDEIGNSLFNFDDNAGPNAIELYVARLRRKLEAAPLRIVTVRRAGYLLEPIV
FT                   EARGHEACD"
FT   gene            337447..338820
FT                   /locus_tag="XfasM23_0258"
FT   CDS_pept        337447..338820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0258"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: xcb:XC_0813 two-component system sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91709"
FT                   /db_xref="GOA:B2I7I1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I1"
FT                   /protein_id="ACB91709.1"
FT                   /translation="MKRAINGGSIRRTLWLYLGAFSMMSTVFLFFAARDYGQRAADGSY
FT                   DHLLVSSALSILGSVSLVDGQWQVDLPYVALDVLAMAPEDRVFYRVYDVHGHIMTGYGD
FT                   LPSPPRVPLPGEAPLLFDADYSGELVRFVAVARTLASVATLTEVYVQVGQTRQARDALA
FT                   HEMVVNALLVIAVLTLLSLPLVALGVYRALWPLRRIERDLAQRQPWDLKPLTTAPPQEM
FT                   AQMVGALNHFMERLSNSNETLRAFMGEAAHQMRTPLAALRAQAQLALEEGDAFQLRCSL
FT                   TAIERNASHMSRLLNQLLSDASAIHRTQIQHFEEVNLLELIHQAVSEVVPYREEMLCVQ
FT                   WTNDPHPAWIRGDALLLREALKNLVDNACKYGGGSLQLTLTSDAHECVLTLADQGPGIA
FT                   PSEAERVFERFVRGVHASPGGAGLGLAIVKRIIDNHRGRIDLSNRIGGGLMITLGFPR"
FT   gene            338829..339869
FT                   /locus_tag="XfasM23_0259"
FT   CDS_pept        338829..339869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0259"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: xcv:XCV3609 putative periplasmic iron-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91710"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I2"
FT                   /protein_id="ACB91710.1"
FT                   /translation="MIRVAVLLLLLTCHFMVWAHPGEIRHFSTKGPVTAQLRIQGANDV
FT                   ERFAVVIADYQRLHPGSEVIYEEQIASQIYHRYLHPASSQPPPDLLISASMDLQIKLAN
FT                   DGHALAYRSSRTRALPTWAQWRYEVFGIGYEPAVIVYNTRRLPSPQVPRTRHQLLALLR
FT                   APEAPLRGQIGTYDVERSAVGYLLSTQDAQLGSIAGALWEAMGEERVQLEAGTGALLER
FT                   VASGELLLAYNVLGSYAQARVDAGVPLGIVQPEDYTLLALRTAVIPRGGVHVSEAQRFL
FT                   DYLLSERGQRVLSHEVRLMPVLPGSDRIVSMFRPIALGPGLLVYLDTLKRRQFLYTWRS
FT                   SMLPPR"
FT   sig_peptide     338829..338888
FT                   /locus_tag="XfasM23_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            339934..340194
FT                   /locus_tag="XfasM23_0260"
FT   CDS_pept        339934..340194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91711"
FT                   /db_xref="GOA:B2I7I3"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I3"
FT                   /protein_id="ACB91711.1"
FT                   /translation="MALIVGRIRQWDRALGSHVSIRDSGVMQARAQRDMAPQRCVGGFV
FT                   CCCLAVLISAYGFVSLLCCRCIRKHASLRCAVLWDGAVYLC"
FT   gene            340416..341048
FT                   /locus_tag="XfasM23_0261"
FT   CDS_pept        340416..341048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0261"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: xcb:XC_0816
FT                   transcriptional regulator LuxR/UhpA family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91712"
FT                   /db_xref="GOA:B2I7I4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I4"
FT                   /protein_id="ACB91712.1"
FT                   /translation="MSEMLILVADDHPLFRNAVIQVLRENFQDAQVLDASSAATLRSAL
FT                   QAYPQTELVLLDLAMPGARGFSALLHVRGEHPDIPVVVISSNDHPRVIRRAQQFGAAGF
FT                   IPKSSPPETITEVVAAVLDGCTWFPPMLVECSEADTQLAVKLARLTPQQFRVLLCLADG
FT                   LLNKQIAYELGLAENTVKVHVTAILKKLECYSRTQAAVLVKSLEPEA"
FT   gene            complement(341095..342732)
FT                   /locus_tag="XfasM23_0262"
FT   CDS_pept        complement(341095..342732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0262"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; KEGG: xcb:XC_0818
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91713"
FT                   /db_xref="GOA:B2I7I5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I5"
FT                   /protein_id="ACB91713.1"
FT                   /translation="MPLKQQSQTPPTVQSAILQTTQDSNTTLHCSLEHLPQGVVIIDAE
FT                   LRLAAWNTRYVELFHFPPELMQVGQPIEDLFRYNAERGLLGDGPIEEAIQRRLNHLRSG
FT                   KAHIRESEKEDGTVLEIRGNSLPEGGFVTSYTDITSYKNATRELRLLADTLEHRVAERT
FT                   RDLDQARLEAENANRYKTRFIASAVHDLLQPLNAARMFVAMLRKQLHDTDALRIANNID
FT                   GALIAEDAILSSLLDISRLESGTLKTQVHHFALGTLLETLAGEFGILAQSRGISLKWVP
FT                   SHAIVYSDETLLRRILQNFLSNAIRYTPRGRVLIGCRRHGNWLRIEVHDQGPGIPESLQ
FT                   SEIFEEFRRLDDGVVNDRGAGLGLAIVERIGRLLNHPIGLRSTLGHGSTFSVSVPLEQI
FT                   TTTHPVFTRTPMPTRELDDDPMLHGCQVWCIDNDPSVCQIIHTLLERWHCAVGFTGSLD
FT                   EALITAATAPPPELILMDTSIDEHGDTPLIPLLMTHWGHTPRVILMTSEEDPTLRDRAL
FT                   NRGWGFLGKPIRPPALRALMTQTLLRQD"
FT   gene            complement(343470..344639)
FT                   /locus_tag="XfasM23_0263"
FT   CDS_pept        complement(343470..344639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0263"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   xom:XOO_1013 polyphosphate-selective porin O"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91714"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I6"
FT                   /protein_id="ACB91714.1"
FT                   /translation="MRPIKFLFTLCLTSTASAAVAGDFNHWPLQYTFGNATEASLTGNF
FT                   AYDYNNFSGDDRLKDRNFMRRKELGISIKKKDVYDAAVAFDFQSKLWLDVFFRFETKAL
FT                   FDQDYGRIRLGYMKTPVGMEALASSRAGSFMETALPVQSIYEGRRTGVEWVLERPQYLL
FT                   QTGAYGGKDLQGDNPGTTQAIRAIWTPFKSTGDVLHLGVSYSQENPRGYHNGSNVSFSP
FT                   RTRVRARPESGLTDVRLIDSGTLVDVDKIQRNGLEQLWIHGPLLVQSEALHIKVTRNNG
FT                   LPTYNGNGQYIYGSWILTGESRPYTAGTVGNVTPMHDYGAVELLARYSRLNLDNGSILG
FT                   GRQHDWTVGANWYLTNYFKFQANYVKVNATRLGTRTTPDIVELRAQVHF"
FT   sig_peptide     complement(344574..344639)
FT                   /locus_tag="XfasM23_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            344935..346284
FT                   /locus_tag="XfasM23_0264"
FT   CDS_pept        344935..346284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0264"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   xac:XAC3471 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91715"
FT                   /db_xref="GOA:B2I7I7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7I7"
FT                   /protein_id="ACB91715.1"
FT                   /translation="MHPSSRANGPAPHKPYNPFYLQLYFWVIIAIILGALLGHCYPAVG
FT                   QQLKPLGDAFIKLVKMIISPVIFLTIVTGIASVAHVGTVARVFGKAMVYFLFFSTLALL
FT                   LGLVVAHVVHPGAGMNINPVDLHQGEIANYVEKSHDLTLVGFLMDIIPKTLLSPFVGDN
FT                   ILQVLFVAVLFGIALALAGERGKPVLNLLDALTVPVFKLVQMLMKMAPIGAFGAIAFTI
FT                   GKYGVDSLVNLGGLVGSFYLTSLLFVLVILGAVSWLCGFSILKLIRYLKAELLLVLGTS
FT                   SSESALPSLMEKMVQAGCGKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTP
FT                   AHQLALFLVAMLSSKGAAGVSGAGFITLAATLAVVPEVPIAGMALILGVDRFMSECRSL
FT                   TNFIGNAVATLVVSRWENALNYEQLKIALDGSEAAYQSLHANDAEPSVSR"
FT   gene            346452..348746
FT                   /locus_tag="XfasM23_0265"
FT   CDS_pept        346452..348746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0265"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))., Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   xom:XOO_1015 malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91716"
FT                   /db_xref="GOA:B2I7I8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I8"
FT                   /protein_id="ACB91716.1"
FT                   /translation="MSNDTFKQAAIDYHRTQPAGKIKVVATKPMLTQRDLSLAYSPGVA
FT                   FACQAIVENPQQASELTARGNLVAVISNGTAVLGLGNIGPLAGKPVMEGKGVLFQKFAG
FT                   IDVFDIEIDESDPDKLVDIIASLEPTFGGVNLEDIKAPECFIVERKLRERMSIPVFHDD
FT                   QHGTAIIVGAAVLNAMVITGKKIGEVKLATTGMGAAGVSCVNMLVSLGLNPDNILAYDR
FT                   EGVIHTGRTDLDPEKQRYARDTDKRTLAEIVEGADIFLGLSAAGILTPEMVATMAPDPV
FT                   IFALANPIPEIMPEVVCAVRTDAIIGTGRSDYPNQINNVLCFPYLFRGALDVGATTINE
FT                   EMKIACVKAIAALARCEASDLGAAYGGETPSFGREYLIPRPLDPRLLVELSSAVAQAAM
FT                   DSGVATRPITDMSAYHDKLSQFVYRTSLMMKPVYDRARADKQRVVYAEGEEEVILRAVQ
FT                   NVIDEGLAFPILIGRPDVIESRIQRMGLRMKVGVDFEVTNIHDDPRFNDYWQYYHGVTE
FT                   RRGVTVSAAKELMRSRPTLIASVMVARGEADALLTGAVGRFHKRLGYARSVIPLEPRVS
FT                   STAAMTGVINQHGAFFFVDTHVQEDPSAEQITEATLQACYRLRLFGIEPSVALLSHSNF
FT                   GSHDSRDALKMRQVRELLLKRSPRLNIDGEMQADTAWDEVLRERIMPNTTLKGRANLFV
FT                   FPNLEAANIAYNLVRVFTDGVAIGPILMGISKAVHILTSSTTSRRVMNMTAIAAVDAQI
FT                   RKQFEGGKRGG"
FT   gene            complement(348977..350887)
FT                   /locus_tag="XfasM23_0266"
FT   CDS_pept        complement(348977..350887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0266"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: xcc:XCC2393 heat shock protein
FT                   90"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91717"
FT                   /db_xref="GOA:B2I7I9"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7I9"
FT                   /protein_id="ACB91717.1"
FT                   /translation="MTLEADKQTHGFQTEVKQLLQLMIHSLYSNKEIFLRELISNAADA
FT                   ADKLRFEALSAPSLLEEDPNLRIRVEFDKQAHTITIDDNGIGMSRDEAIAHLGTIAKSG
FT                   TADFLKALSGDQRKDANLIGQFGVGFYSAFIVADHVDVYSRRAGLTAAEGVHWSSKGEG
FT                   NFEVATIDKPQRGTRVVLHLKENEQHFAEGWTLRSTLKKYSDHIGLPIEMLKEHHGKEE
FT                   EKDTPQEAEWEAVNKASALWTRPKNDIKDEEYQEFYKHISHDMTNPLAWSHNKVEGKLE
FT                   YTSLLYVPTRAPFDLYHRNAAKGLKLYVQRVFIMDQAEQFLPLYLRFIKGVVDSADLSL
FT                   NVSREILQSGPVVDSMKTALSKRALDMLEKLAKDAPEDYKTFWKNFGQVLKEGPAEDYS
FT                   NREKVASLLRFASTYDTSGDPSVALTDYIARMKEGQDKLYYLTGESYAQIKDSPYLEVF
FT                   RKKGIEVLLLVDRIDEWLMNYLHEFDGKSFVDIARGDLDLGNLDSEADKKAQEEIAKTK
FT                   EALASRIKATLGEDVAEVRVSHRLTDSPAVLAIGEGDLGLQMRQLLEASGQKVPETKPV
FT                   FEFNPSHPLIEKLDAEQDMDRFADLSRILFDQAALAAGDSLKDPANYVRRLNKLLLELS
FT                   A"
FT   gene            351062..351688
FT                   /locus_tag="XfasM23_0267"
FT   CDS_pept        351062..351688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0267"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: xcc:XCC2392 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91718"
FT                   /db_xref="GOA:B2I7J0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J0"
FT                   /protein_id="ACB91718.1"
FT                   /translation="MNHRRVLPVRVCGEGHVRIIGGRWRNTRLRVPELPGLRPTSSRVR
FT                   ETLFNWLMPVLPGAHVLDLFAGSGALGLEAVSRGAARAVLVERHAELVVLLREQVARLG
FT                   AQDQVEIVQADALQWLQRPAAARFDIIFLDPPFAAGVWETVVVRLAGHVAAAAWLYMES
FT                   SVDLEPVMLPGWELHRDGRTREVCYALYRYPAVTLPVGSKSVSSV"
FT   gene            351685..352173
FT                   /locus_tag="XfasM23_0268"
FT   CDS_pept        351685..352173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0268"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: xcb:XC_1723 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91719"
FT                   /db_xref="GOA:B2I7J1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7J1"
FT                   /protein_id="ACB91719.1"
FT                   /translation="MSVVNRRIAVYPGTFDPITNGHIDLVSRAAPLFESVVVGVAQSPS
FT                   KGPSLPLQQRVTLAREALCQHENVQVIGFDTLLAHFVRHVGAGVLLRGLRAVSDFEYEF
FT                   QMASMNRHLIPEVETLFLTPAEQHSFISSSLVREIARLGGDVSGFAPAAVVAALRQNL"
FT   gene            352223..352717
FT                   /locus_tag="XfasM23_0269"
FT   CDS_pept        352223..352717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0269"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV2708 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91720"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J2"
FT                   /protein_id="ACB91720.1"
FT                   /translation="MNNMLRVVVVALFVFVLAACGQKAAQTVADVASSVPTVPAKDDDA
FT                   AWKTYLGQVVSNHLGNSTGSPFLYYLPPASDPDFKGKYDRQLENVTSALGRGVQPGMLV
FT                   VFGSSASAKMADLIVAAFNKVQAGSMKGVHVLFIGMSADNARVQKVVQPSGAEYVFVEA
FT                   K"
FT   sig_peptide     352223..352297
FT                   /locus_tag="XfasM23_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.752 at
FT                   residue 25"
FT   gene            352891..353175
FT                   /locus_tag="XfasM23_0270"
FT   CDS_pept        352891..353175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0270"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: xoo:XOO2506 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J3"
FT                   /protein_id="ACB91721.1"
FT                   /translation="MSLRINALCVNCDVCEPVCPNRAISMGETIYIIDPLRCTECVGHY
FT                   DEPQCVVVCPVECIDPDPGLLETREQLLSKLQQLQRNDPELYEKESPDL"
FT   gene            353172..354983
FT                   /locus_tag="XfasM23_0271"
FT   CDS_pept        353172..354983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0271"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: xcb:XC_1726 gamma-glutamyltranspeptidase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91722"
FT                   /db_xref="GOA:B2I7J4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J4"
FT                   /protein_id="ACB91722.1"
FT                   /translation="MSLFPRCFLLLCVFFSHVSAEQTEVALLREGVARVPPGAVIASSH
FT                   YLATDAGLQILKQGGNAFDAAVAVSSTLSVVEPISSGLGGGGFFLLHDAKTGRDVMLDA
FT                   REYAPASVNLGTFLNKDGQLDHDRSINGPWSAGIPGLPAALVELAEHYGKLPLRQTLAP
FT                   AIRIASAGFPVYRRMVEGYQSRREVMERYPGTREVYLRGGKPMDEGDIFKQPELARTLS
FT                   LLANKGFDGFYRGETAKRLLAGVNQAGGRWTAEDLAGYRVKSRVPITFDYRGWKITTAP
FT                   PPSSGGIALAEMLQILEGWDLARLDDVHRVHLVVEAMRRAYRDRTFFLGDPDFVSIPQR
FT                   VLTSQDYARGLRAGINPEKATPSVLLSGHPTPLEDEETTHFSIIDAEGNRVGATQTVNL
FT                   LYGSGLIPKGTGVLLNNEMDDFALQPGVPNVFGVMGYEANAPKPGKRMLSSMTPTFLES
FT                   ADKVAVIGTPGGSRIITMVLLGILGYDAGLDAQQVAALPRYHHQWLPDVIETEAATFPA
FT                   EVIKGLETMGHTIKQPSDTVAGGRGSSHVWGNVQTVEWDRRSNVLIGGHDPRHVVGKAA
FT                   VWLTDKAVVLPPMDHLPTPCLQDCHAQ"
FT   sig_peptide     353172..353234
FT                   /locus_tag="XfasM23_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.745 at
FT                   residue 21"
FT   gene            355852..357516
FT                   /locus_tag="XfasM23_0272"
FT   CDS_pept        355852..357516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0272"
FT                   /product="periplasmic/7TM domain sensor diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor extracellular
FT                   region 2; Diverse 7TM receptor transmembrane region; KEGG:
FT                   azo:azo0690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91723"
FT                   /db_xref="GOA:B2I7J5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J5"
FT                   /protein_id="ACB91723.1"
FT                   /translation="MKRQLGYFLLRGVLLWLCLAAPAVAQSLMLERLDDDPPAHEVLAG
FT                   VYDAMLRPNDTGGASIYETARHPVWWRIRADRQISAAGQPKLQIEFPYLNWVEAWVPGR
FT                   SVPSHHAIYGAAADRRYATRALVIDLPEGLPQGRAVWLRVHAQSTISMPVSIVSNDVVH
FT                   RRDLDHVAWYSFILGLTTVLAVLSASLWVRLREPVYGYFTVNLVCVLLYLIGFDGEARG
FT                   FPVLGELFGSSPVPIRVVATFGGFVIVNFQRHYLNTAFRIPRVDLALKASSGWLLVMAV
FT                   LNVVPQIQPYPVLTYLSLMVASLLLLFSCVWLGGVRGHRDAWSLLVAWTPLLLFSMLRS
FT                   LELIGWNRLSGNGAWIGYGLSMSLGLSCLLVTLVLADHMLELRRDRDRARLLANVDGLT
FT                   GALTRVAIERRLERDIDDARQMGTPLSVAFIDIDHFKRINDEYGHAAGDACLRQVVQRV
FT                   RGWLRASDALGRHGGDELIAILPGADLVAARRVAEGIRVAVSSQPFQFECTRLRCTLSL
FT                   GVASWLPDESIEALLQRADNGLYASKAAGRDRVSTEM"
FT   sig_peptide     355852..355929
FT                   /locus_tag="XfasM23_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            complement(357616..358473)
FT                   /locus_tag="XfasM23_0273"
FT   CDS_pept        complement(357616..358473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0273"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: xcv:XCV2560
FT                   metalloendopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91724"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J6"
FT                   /protein_id="ACB91724.1"
FT                   /translation="MLALTVNRLLALGMLVTMTLPPITYAQNKINTQETRSEFPTNVSQ
FT                   GALVIGTVPAGSRVEYSGQVLRVDDKGQVVFGVGRNETGPLILRIQTPKGTVKQVNINV
FT                   TTRQWPLEVVNGVPPKTVNPPPAIAARITREQAQITDARQRNDARSDFAQAFIWPVQGR
FT                   ISGRFGSERIYNGQTAGNGHSGMDIATATGTPVKAPAAGVITFAAPDLYLTGGTVLLDH
FT                   GAGVSSNFLHLSRIDVKAGDHVDQGQVIGAVGATGRATGPHLHWGMNWFNVRIDPLLIL
FT                   ERTR"
FT   sig_peptide     complement(358393..358473)
FT                   /locus_tag="XfasM23_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            complement(358473..359822)
FT                   /locus_tag="XfasM23_0274"
FT   CDS_pept        complement(358473..359822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0274"
FT                   /product="Dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="PFAM: amidohydrolase; KEGG: xac:XAC2360
FT                   dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91725"
FT                   /db_xref="GOA:B2I7J7"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J7"
FT                   /protein_id="ACB91725.1"
FT                   /translation="MNPTLIVNARLVNEGREFDSDLRIENGRIARIDTGLSAQSKDIVI
FT                   DAAGRRLLPGMIDDQVHFREPGLTHKGDIASESAAAVAGGLTSFMDMPNTNPPTLGAAA
FT                   LQAKYDAARGRAWGNYGFYLGASNDNLAAIQALDPKTSPGIKVFMGASTGNMLVDNETT
FT                   LEGIFRYAPTPIITHCEDTPTINATLAKYHSRYGNTLSAEQHPDIRSRQACLKSSQLAV
FT                   SLAKKNGTRLHVLHISTADELRLFEAGPLVDAAGKRCKQITAETCIHFLHFDRMDYARL
FT                   GNLIKCNPAIKEASDREALIAALAKDVIDVLATDHAPHTWEEKQQPYAQAPSGLPLVQY
FT                   ALVAALELVHAGRLSVTEIVRKFAHAPAQLFDVIERGFLREGYWADLVLVEDTPFTVKR
FT                   QEILSKCGWSPFEGTTFRSRIASTWVNGNHVWDGNRLVGVPNGQRLEFDR"
FT   gene            complement(359819..360082)
FT                   /locus_tag="XfasM23_0275"
FT   CDS_pept        complement(359819..360082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0275"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   xcb:XC_1859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91726"
FT                   /db_xref="GOA:B2I7J8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J8"
FT                   /protein_id="ACB91726.1"
FT                   /translation="MHPLILLLKIYKRLISPLLGPHCRFEPSCSEYAMVAIARFGTLRG
FT                   IWLAARRLARCHPLQLGGHDPVPDNTSTQVNPRSHRCTGHHQ"
FT   gene            360190..361131
FT                   /locus_tag="XfasM23_0276"
FT   CDS_pept        360190..361131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0276"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger DksA/TraR C4-type; KEGG: xac:XAC2358 DnaK
FT                   supressor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91727"
FT                   /db_xref="GOA:B2I7J9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7J9"
FT                   /protein_id="ACB91727.1"
FT                   /translation="MAAKKIVKKIVPVVSNTAKPIGKNAAVAADKELPAKSPSPSAGKK
FT                   RPATTKKAPVNKTVANKDAQVKLLSGHLTNKVAKSVLKSASKPMTAESVPIDNNVVPAV
FT                   AIIPMDPKSTSAANHALISKSSAKTPAKFDSSRKPSASRPAGKVAVAVTGETLPRVSKT
FT                   KYKVVKYNVDEATGRPILPLGYKPSSEEEYMNPLHQEYFRQRLEQWRKDLVEESKQTIE
FT                   NLRDEVRDIGDEAERATRETENSLELRTRDRYRKLIAKIDSTLNRLEINDYGYCVDTGE
FT                   EIGLERLDARLTAERTIDAQERWEHLQKQQGD"
FT   gene            361296..362342
FT                   /pseudo
FT                   /locus_tag="XfasM23_0277"
FT                   /note="conserved hypothetical protein"
FT   gene            complement(362524..363780)
FT                   /locus_tag="XfasM23_0279"
FT   CDS_pept        complement(362524..363780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0279"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xac:XAC2356 drug:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91728"
FT                   /db_xref="GOA:B2I7K0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K0"
FT                   /protein_id="ACB91728.1"
FT                   /translation="MSTSPSSNATLRTLLCRPGFTAVLAYRIAATLSHQIVSVTIGWHI
FT                   YEITRNPLLLGLVALAEILPFFCIAPFAGYLVDHLPRRRLGMFASLGLAMTPTILLIAA
FT                   FNTAPVTAPVQTTWPIYVAASLSGMVRSFIVPVYNALFARVLPREDYARGAGLGTVAFQ
FT                   ASLVLSPMLGGILIALGGKELAYAAGVVAAIIALLALALLRVEEPAVDKPRAPVLGSIA
FT                   EGVRFVFSNQIMLGAMALDMFSVLLGGAVSMLPAFIQDIFHYGPEGLGILRGTPALGSV
FT                   LAGLWLARYPLQRHAGRTLLLAVAGFGICTIAFGLSQHFWVSAGILLVYGACDGISVVS
FT                   RASILQLVTPDEMRGRVSSINSIFIGSSNELGAFYDGVMARFIGLVHAVVLGGFMTLVV
FT                   VGITALKAPRLRRLDLRDL"
FT   gene            complement(363777..364217)
FT                   /locus_tag="XfasM23_0280"
FT   CDS_pept        complement(363777..364217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0280"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE; KEGG:
FT                   xac:XAC2355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91729"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K1"
FT                   /protein_id="ACB91729.1"
FT                   /translation="MTDDPFPLESTAAAAQAAIAEEFSFFGNWSERYQYLIDLGRKLPV
FT                   FPESWKTEEHRLHGCQSMVWIVSEGNSDDLKFYGASDSAIVSGLIYLALRVYSGRSAAE
FT                   ILKTSPSYITDIGLAKHLSPTRNNGLAAMLDLIRNTAQALTA"
FT   gene            complement(364302..365705)
FT                   /locus_tag="XfasM23_0281"
FT   CDS_pept        complement(364302..365705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0281"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: xcb:XC_1867 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91730"
FT                   /db_xref="GOA:B2I7K2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K2"
FT                   /protein_id="ACB91730.1"
FT                   /translation="MSLHLYNTLHRRVEPFEPLDPACPTMYVCGPTVYNYVHIGNARGP
FT                   VVFGVLAALLRRRYGALRYARNITDVDDKINTAAQEQGVPISAITERFCAAYREDMKKL
FT                   GVEPPDIEPEATAHMPQIIAMIEQLIERQHAYVAMEHVLFAVNSFADYGQLSRRDTEEM
FT                   LAGARVEIAPYKRDPSDFVLWKPSSDQLPGWDSPWGRGRPGWHIECSAMAAAHLGETID
FT                   IHAGGIDLQFPHHENEIAQSRCAHGSSTFARVWMHNGMLNFEGAKMSKSLGNIETVHEL
FT                   VAKHPPEALRYALLSAHYRKPLDWSEALIAQSVRTLNRLYGTLRDLAAYPARAIIPGNI
FT                   EAALDDDLNTPQALAELATLANEARIQLADTTHHAAAEVTTALTRLKAKLLGAGLALGL
FT                   LQQTPEAWFSQGTNESDETHIQALIDARGAAKQARDFVRADAIRAQLAAEGIVLEDTPQ
FT                   GVRWMKQHT"
FT   gene            365924..366400
FT                   /locus_tag="XfasM23_0282"
FT   CDS_pept        365924..366400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91731"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K3"
FT                   /protein_id="ACB91731.1"
FT                   /translation="MPSWAAHPRKADLKNVGIVGNVKFDYAQVMKVAPVYQTWHASHVE
FT                   EQCDPLPLTEVAPELDPGHDKHRKISRVMELVKGFFSNHRTEQALPGASTNSQRNCRIV
FT                   EVPRQFRRPIAYDVDYIYKGTKYRSRLPEDPGNRLPVRVLVTPYLSEHNFPPPR"
FT   gene            366424..366633
FT                   /locus_tag="XfasM23_0283"
FT   CDS_pept        366424..366633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91732"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K4"
FT                   /protein_id="ACB91732.1"
FT                   /translation="MVRHSSSPEPADASSPLELHWHPVHGTIAAPYTNERHYGAFIRAR
FT                   LYSSLTFRVHWLQVSILQCIGMHR"
FT   gene            366801..367811
FT                   /locus_tag="XfasM23_0284"
FT   CDS_pept        366801..367811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0284"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /note="PFAM: aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain; KEGG:
FT                   xcv:XCV2551 N-acetylornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91733"
FT                   /db_xref="GOA:B2I7K5"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K5"
FT                   /protein_id="ACB91733.1"
FT                   /translation="MALKHFLNTQDWTCSELNALLTQARAFKHNKLGNALKGKSIALVF
FT                   FNPSMRTRSSFELGAFQLGGHAIVLQPGKDAWPIEFDTGTVMEAETEEHICEVARVLGH
FT                   YVDLIGVRAFPKFLDWTYDRQDIVLNSFAKYSPVPVINMETITHPCQELAHIMALQEHF
FT                   GTTDLRGKKYVLTWTYHPKPLNTAVANSALTIATRLGMDVTLLCPTPDYVLDERYIDWA
FT                   RQNIADTGSTFQVSHDIDNAYRGADVIYAKSWGALPFFGNWAMEKPIRDQYRHFIVDEA
FT                   KMALTNNAVFSHCLPLRRNVKATDAVMDGSNCIAIHEAGNRLHVQKAIMAALASQ"
FT   gene            367842..369047
FT                   /locus_tag="XfasM23_0285"
FT   CDS_pept        367842..369047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0285"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: xcb:XC_1871
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91734"
FT                   /db_xref="GOA:B2I7K6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K6"
FT                   /protein_id="ACB91734.1"
FT                   /translation="MSNKNIVLAFSGGLDTSFCIPYLKEQGYAVHTVFADTGGVDEDER
FT                   DFIEKRAAELGVASHLTVDGGPAIWDGFVKQLVWAGEAYQGQYPLLVSDRYLIVDAVLQ
FT                   RADALGTCAVAHGCTGMGNDQVRFDLAIKAQGDYTIIAPIREIQKEHTQTRLYEQKYLE
FT                   ERGFGVRAKQKNYTINENLLGITLSGGEIDKWEAPGEGARGWCAPRSAWPTDPLTVAIK
FT                   FVEGEAVAVDGKPLSGPQILMKLNKLFASYGVGRGIYTGDTVIGLKGRIVYEAPGLTAL
FT                   LTAHRALEDAVLTKQQNRFKPHIARKWVELVYEGFFHDPLKTDLETFLKSSQANVNGEI
FT                   VLETRGGRVDAVAVRSPHILTSKGVTYAQTADWGIEEAEGFIKLFGMSSTLYAHVNRSL
FT                   RS"
FT   gene            369118..370212
FT                   /locus_tag="XfasM23_0286"
FT   CDS_pept        369118..370212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0286"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: xom:XOO_2519 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91735"
FT                   /db_xref="GOA:B2I7K7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K7"
FT                   /protein_id="ACB91735.1"
FT                   /translation="MSALLDSTLDHLEQLVSFDTRNPPRSITTDGIFSYVKAHLPGFQI
FT                   EMTDHGAGAVSLYAVRGTPNVLFNVHLDTVPDSPAWSADPHVMRRAVDRVIGLGVCDIK
FT                   GAAAALLAAVQATDGPAALLFTSDEEANDPRGVAAFLKRNIPYHAVLVAEPTMSQAVLA
FT                   HRGISAVLMKFTGRAGHASAEQQPQASALHQAMRWGVRALDYTASLAHTRFGGLTGLRF
FT                   NIGRLEGGIKANIIAPTAELRFGLRPLPSMDVDQLLAALAALAVPAPASFEETFRGPSL
FT                   PWGGIATAEIRRLSARDIADALHLPIGNAVDFWTEASLFSACGYTALVYGPGDIAQAHT
FT                   ADEFVTLQQLQRYAESVYRIINAT"
FT   gene            370277..371593
FT                   /locus_tag="XfasM23_0287"
FT   CDS_pept        370277..371593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0287"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; protein of unknown
FT                   function DUF619; KEGG: xac:XAC2348 acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91736"
FT                   /db_xref="GOA:B2I7K8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011242"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041734"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7K8"
FT                   /protein_id="ACB91736.1"
FT                   /translation="MHANLQTRQIIIRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVG
FT                   GAVLRDDVDALTSSLSFLQEVGLTPIVLHGAGPQLDEELTAVGIQKKTVNGFRVTLPET
FT                   MAIVRKVFHATNLQLIEALQRNGARATSITGGVFEAHYLDQETYGLVGGISAVNIAPIE
FT                   ASLRAASIPVIASLGETPSGQILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKI
FT                   INSINLSTEYEQLIQQPWVYGGMKLKIEQIKHLLDRLPLESSVSITRPADLAKELFTHK
FT                   GSGTLIRRGERVIRATTWKDLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRA
FT                   AVILTKLGNVPYLDKFAVLDDAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAE
FT                   SDGYYKQDHWKIFWNGLHHFQQIQQCVAHCTQHPPTLID"
FT   gene            371596..372579
FT                   /locus_tag="XfasM23_0288"
FT   CDS_pept        371596..372579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0288"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: xom:XOO_2516 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91737"
FT                   /db_xref="GOA:B2I7K9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7K9"
FT                   /protein_id="ACB91737.1"
FT                   /translation="MSTATFTLGIVGARGYTGAALITLLTAHPAIELIFVSSREYHGQP
FT                   VAAHNPTYCGDLRFETLDPAAVAAKRADVVILALPNGNAAPYVHAIDATAPPTLIIDLS
FT                   ADTRFDPDWYYGLPELTRHTYTGQKRISNPGCYATAMQLAIAPLRDQLAGPPQCFGVSG
FT                   YSGAGTTPSDKNNQALLRDNLMPYALTDHLHEREVSAQLGIPVEFMPHVAPHFRGITLT
FT                   ANLWLQRPLTREHIKTLYATRYANDPLIDIIDPPPWVNQIAARHTVQIGAFTMAPGNKR
FT                   VVIVATLDNLLKGAATQALQNLNRALGLDELTAIPYQPNPVPSPIP"
FT   gene            372579..373937
FT                   /locus_tag="XfasM23_0289"
FT   CDS_pept        372579..373937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0289"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="KEGG: xom:XOO_2515 argininosuccinate lyase; TIGRFAM:
FT                   argininosuccinate lyase; PFAM: fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91738"
FT                   /db_xref="GOA:B2I7L0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L0"
FT                   /protein_id="ACB91738.1"
FT                   /translation="MTTPASPMDTTTMPNLLWHKPGVAIDASIQTFLAADDVLLDREFF
FT                   LYDITASTAHAQALQRIGLLTPDELDNILRELQHLSDEYRNGTFLLDTQYEDGHSAIES
FT                   RLTERLGDTGRKIHTGRSRNDQILVATRLWLKDRLTQLSTLNRDIAHHALQRAAAEQHL
FT                   PMPGYTHLQRAVVSSAGMWWAGWAESFIDNALRAADTLALIDCNPLGTAAGYGVNLPLD
FT                   RPHTTTALGFARLQVNPICAQLSRGKFELAALEALGSATLDLRRIAWDLSLFTTSEFAF
FT                   ITLPPEYSTGSSIMPNKRNPDVIELMRATHASVAAARTEIEQLLSLPSGYHRDLQNSKG
FT                   AIVRGFNRGLAALELLPALLSRLQWRPDTLRAAIDPGMYATDAAIEAAIAGIPFRDAYQ
FT                   MAAKTADTAAQDRTPETSLTARRSPGAAADLCLETLRARWHTLTQPTSDPDPR"
FT   gene            374057..375211
FT                   /locus_tag="XfasM23_0290"
FT   CDS_pept        374057..375211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0290"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: xoo:XOO2666 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91739"
FT                   /db_xref="GOA:B2I7L1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7L1"
FT                   /protein_id="ACB91739.1"
FT                   /translation="MTGIPPPSRFPEQPIPPWRRAVLKVGSSLLAADGGGLSPRFALDL
FT                   AHFVSANITAGRQLVIVSSGAVAAGRALIPPLPESGGALAARQALAALGQAQLIALWQR
FT                   FFDRPVAQVLLTHDDLRNRRRYLNARATLRELLHLGTLPVVNENDTVSVDELKLGDNDN
FT                   LAAIVAALIDAQALFIATDIDGLYTTDPRHHSDAQPLHEVRTLTPENLAMAGDSSSTVG
FT                   TGGMRTKLEAALKAGAAGIDTYLFNGRSSDVVRGLAQHRLRGTRIHPTCTPIAARKYWL
FT                   RHAPVEPGAILIDAGAAAALAQQGASLLPGGVLSAEGDFRRGDMIQIATRSPDHPSHPL
FT                   ARGLVQYSAADVRRIAGCHSRDIQTLLGYTYGDTIVHRDDLVLL"
FT   gene            375503..376780
FT                   /locus_tag="XfasM23_0291"
FT   CDS_pept        375503..376780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0291"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   xcb:XC_1880 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91740"
FT                   /db_xref="GOA:B2I7L2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7L2"
FT                   /protein_id="ACB91740.1"
FT                   /translation="MSHIRHLAQQCRDAARILATLSTDAKRRLLETMATALNTDAATIL
FT                   AANAADLDAARTQQVGTAMLDRLALDPQRLAAMADALRDIAALPDPVGQVTRDDRRPNG
FT                   IHIQKIRVPLGVIAMIYEARPNVTADAAALCIKAGNGIILRGGSEAIRSNIAIATALQR
FT                   ALRLASLPETALILVQDMARHTMLELLQLSDLIDLVIPRGGEGLIRFVAEHARIPVIKH
FT                   YKGVCHQFVDASADIEMAIRLLIDGKTTRPAACNALETLLVHTDIAPRFLPAAAAALRP
FT                   YGVQLRGDHATCTLLPDVLLATDADYAAEYLDLILAIRIVPNLDAALEHIRRYGSDHTE
FT                   VIVTADPAHADTFVQQLPSAVVMVNASSRFSDGGALGLGAEIGISTTRLHAYGPMGLDA
FT                   LTVERFVVRGQGQVRHCPPYPPAPRR"
FT   gene            377244..377753
FT                   /locus_tag="XfasM23_0292"
FT   CDS_pept        377244..377753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91741"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L3"
FT                   /protein_id="ACB91741.1"
FT                   /translation="MPFINEIPSAEDIEKYGLPFKKGLNLDISLRSQWTVDRERNFHLY
FT                   GGGLTGNPAYEDAIYYCFYLYLNGTKFVVELDVDRNRIPSTFKDNPYVVEWSKPVSIKV
FT                   MPHDQAGYLKELPHSAWESPDVPQPLLDNYSFNEFISIFKEAVTVHGAGDANRHIHHPI
FT                   VVRFKF"
FT   gene            377777..378250
FT                   /locus_tag="XfasM23_0293"
FT   CDS_pept        377777..378250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91742"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L4"
FT                   /protein_id="ACB91742.1"
FT                   /translation="MTLTVEQANALLDSITTQEQLRDLINQLDIHSSGSITVLYSGYTA
FT                   NGLDNSQIIQGMLHNGDTIRVIDTTEAAKFLNIDPDDPHKNNTLLRSHYYVDVLLHGDD
FT                   VYSTANRSVICLIKHHDRVFYQGCDTATPSQGRSARSKQCFIDSITSSMYFTP"
FT   gene            378261..378767
FT                   /locus_tag="XfasM23_0294"
FT   CDS_pept        378261..378767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91743"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L5"
FT                   /protein_id="ACB91743.1"
FT                   /translation="MPFINEIPSAEDIEKYGLPYKKQLNLDISLRSQWTVDRERNFHLY
FT                   GGGTANQAYEEIFYYRFYMYLNGTKFVVELDVDRNRIPSMFKDNPYVVEWSKLMSIKVW
FT                   PHDQVSPLKRVPPAAWDTPDAPQPLLDNRSLNQFIAILKEALTVHGAGDSNRRIHHPIV
FT                   VHFGF"
FT   gene            378785..379231
FT                   /locus_tag="XfasM23_0295"
FT   CDS_pept        378785..379231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91744"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L6"
FT                   /protein_id="ACB91744.1"
FT                   /translation="MSLTVEQANALLGSITTREQLRDLINQLDIHSSGSITVLYSGYTA
FT                   NGLDNSQIIQGMLHNGDTIRVIDTTEAAKFLNIEPGDPNRNEALLRSHYYVEVLLHGDD
FT                   VYSTANRSVICLIKHHDRVFYQGCDTATPSQGRGHAVSSVLFTQ"
FT   gene            379383..379778
FT                   /locus_tag="XfasM23_0296"
FT   CDS_pept        379383..379778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91745"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L7"
FT                   /protein_id="ACB91745.1"
FT                   /translation="MNATSIYTGGATANQAYEEIFYYRFYLYLNGTKFVVELDVDRNRK
FT                   PSMFKDNPFVVEWSKLMSIKVWPHDQVSPLKRVPPTAWDTPDAPQPLLDNYSLNEFIAI
FT                   LKEAVTVHGAGDSNRHIHHPIVVRFGF"
FT   gene            379796..380269
FT                   /locus_tag="XfasM23_0297"
FT   CDS_pept        379796..380269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91746"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L8"
FT                   /protein_id="ACB91746.1"
FT                   /translation="MSLTAEQANALLGSITTQEQLRDLINQLDIHSSGSITILYSGYTA
FT                   NGLDNSQIIQGMLHNGDTIRVIDTTEAVRFLNITPNDPHKNNALLRSHYYVDVLLHGDD
FT                   VYSTANRSVICLIKHHDRVFYQGCDTATPSQGRGACSKQYFIDSITSSMYFTL"
FT   gene            380280..380783
FT                   /locus_tag="XfasM23_0298"
FT   CDS_pept        380280..380783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91747"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7L9"
FT                   /protein_id="ACB91747.1"
FT                   /translation="MPFINEIPSAEDIEKYGLPFKKDLDLDISLRRQWTVDRERNFHLY
FT                   GGGATGNQAYEGIIHYRFYLYLNGAKFIVELDDGGGSLVFEDNPYVVVWSKLVSIELMP
FT                   SDQGGYLKALPRSTWDTPDAPQPLLHNYSLNQFIVILKEAVTVHGAGESNDSIHHPIVV
FT                   RFGF"
FT   gene            380801..385624
FT                   /locus_tag="XfasM23_0299"
FT   CDS_pept        380801..385624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0299"
FT                   /product="Haemolysin-type calcium binding domain protein"
FT                   /note="PFAM: Hemolysin-type calcium-binding region;
FT                   Haemolysin-type calcium binding domain protein; KEGG:
FT                   rso:RSc0249 putative calcium binding hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91748"
FT                   /db_xref="GOA:B2I7M0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR010566"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M0"
FT                   /protein_id="ACB91748.1"
FT                   /translation="MSLTAEQANALLGSITTREQLRDLINQLDIHSSGSITVLYSGYTA
FT                   NGLDNSQIIQGMLHNGDDIRVIDTTEAARFLNVDPTTPNWNKPLYQKLEQIIGGKPDKW
FT                   GTPANQFLFGEKAADGTRLPNGAWDTISARFVNETVGEVRTLTGGASVNGVFNQTELPR
FT                   LLNNPNITSVDGLPIADLRRLGAVGSFQAISAQSEHLSGYLKLAINADGSIMKLSGGIP
FT                   SVDSQQYFALTGLEGKPPLGDAGRYDNLARYIPARLDTHLEGARLVQDIKDGYQRTTQL
FT                   LGPESAAARADALRVLGKLGVAADLLSLAVMAHDANAAYASGNIEGSRQIVQDWTSQYL
FT                   GGLMGGLAEAKAVGLLLTPVYLDGPIGAAVASVLTVAAGVEGTFLGSHYIGAFLDKVFD
FT                   QLHHIGELSGARLYDWVTQIGDLFRRLNQTLHTDNASLLDLLHDLFRHSRDVRDPLVLD
FT                   LDGDGITHASGWVKSDDGLLVLDRNGNGRIDNGSELFGADTVLSNGHTAASGFDALRDL
FT                   DSNGDGLFSAADARFTDVRVWRDLNQDGQSQANELFTLSTLGIASITLTPTDTQRVNLG
FT                   NGNVMDARGSYTRTDGRSGTVGNLQLGVDQFYRDYRGAHDKVTINDAARALPAISGSGA
FT                   VRDLQEAASLSPALLVAVQALLSGTTQGTLRAALDQVIALWASTSTMLSTEERLKASAD
FT                   VERTVYYQGFVPPEVTAQGKEAVLAFQQQQRTRLGPMIGILEKFNGSRLISDQNDHILG
FT                   APILSWNRVVHPDGHKEDVITITLIPEQLYSGFDPLTDAYAKLKESIYIRLVLEPRLND
FT                   YLSGLTLTYNNGVMGWDASGLEAKLDQTWQHNKAQALQDVMDLQRYGRDALAPSGWNPL
FT                   DALCQMVYRTAATPDGRQALADAGIPLIAGNAEGSAAMDLLFGDAGANLLRGGGGDDVL
FT                   SGGDGDDVLDGGEGSNRLEGGAGHDVLNVANGWNNVLNGGSGDDLLYGSFFADTYLFNK
FT                   GDGHDTLIEQGGADKLVFGVGIVANQVRLLREGQDVVLDLGNGQDSIRLKDWLTFYGAR
FT                   NHSADIEQIVFADGTVWTGETLSTLGLTTLGTSGNDILNGWQGNDLLLGGDGDDVLDGG
FT                   EGSNRLEGGAGHDVLNVANGWNNVLNGGSGDDLLYGSFFADTYLFNKGDGRDTLIEQGG
FT                   ADKLVFGAGIIASQVRLLHEGQDVVLDLGNGHDSIRMKDWLTSDGEYNRTGNIEEILFA
FT                   DGTRWTGDTLGWREMTTFGTSGNDTLQGWGSSDILLGGNGDDVLSGDYGDDTLYGEAGD
FT                   DLLLGDNGNDVLDGGEGHNRLEGGAGKDVLKVSTDGSSDNVFSGGTGDDMLYGSVHSDT
FT                   YLFNRGDGRDTIVEQGGFDKIVFGEEIAVSDIHVLREGQDVVLDLYNGYDSIRLKDWLT
FT                   SDGTRNSNADIEQIVFADGTVWSGETLSSIGLKTLGSADNDTLNGWNGRNILVGEDGDD
FT                   VLKVSMFDSSDNVLVGCRGNDMLYGSSNSDTYFFDQGDGHDTIIEQGGADTLEFGEGLH
FT                   REEACFTRSGDDLSILFNGSEDQVTVAGWFSEAAHQVESLVFQDGTVLSGEVERLIEAM
FT                   ALSPTVTTMQASVRDIKESPRLVASSIV"
FT   gene            complement(385819..386316)
FT                   /locus_tag="XfasM23_0300"
FT   CDS_pept        complement(385819..386316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0300"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   xcv:XCV2199 putative cytidine / deoxycytidylate deaminase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91749"
FT                   /db_xref="GOA:B2I7M1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M1"
FT                   /protein_id="ACB91749.1"
FT                   /translation="MTAPPPVLPEHTHWMRHALTLAHRAATEFDEIPVGAVLISPEGTL
FT                   LGEGCNYNITSHDPSAHAEIMALRAAGHQLRNHRMPGCTLYVTLEPCLMCAMAIIHARI
FT                   AHLIYAAADPKTGACGSTFDILNDPRHNHHVHVYGGLLAEEASRRLTNYFRTKRGQPPL
FT                   PQ"
FT   gene            complement(386324..386818)
FT                   /locus_tag="XfasM23_0301"
FT   CDS_pept        complement(386324..386818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0301"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; iron dependent
FT                   repressor; KEGG: xcb:XC_1948 manganese transport regulator
FT                   MntR"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91750"
FT                   /db_xref="GOA:B2I7M2"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M2"
FT                   /protein_id="ACB91750.1"
FT                   /translation="MQSPMNTRHTIPKHENTQTQTAPLIDAKIHVASFRQVRQARRDEL
FT                   IKDYVELISDLIADSGQARQVDIAAHLGVAQPTVAKMLKRLARDGWVIQRPYRGTFLTP
FT                   AGKALAAASRECHQTVERFLLALGIDATTARRDAEGIEHHVSETTLAAFRTFLQRHSDT
FT                   T"
FT   gene            387032..388390
FT                   /locus_tag="XfasM23_0302"
FT   CDS_pept        387032..388390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0302"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   xcv:XCV2197 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91751"
FT                   /db_xref="GOA:B2I7M3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M3"
FT                   /protein_id="ACB91751.1"
FT                   /translation="MSSSMSSVQPTSPVSDSPSLGEMHASVAVSRRGHWGFRLLAFLGP
FT                   GYMVSVGYMDPGNWATGLAGGSRFGYMLLSVILLSNVMAIVLQALAARLGIASDMDLAQ
FT                   ACRARYSRGTNLALWAVCELAIIACDLAEVIGTAIALNLLLGVPIILGAVITAVDVVLV
FT                   LLLMHRGFRALEAFVIALLLVIFGCFVVQIVLAAPPLQEVLGGFVPRWQVVADPQALYL
FT                   AIGIVGATVMPHNLYLHSSIVQTRAYPRTPVGRRSALRWAVADSTLALMLALFINASIL
FT                   ILAAAVFHAQHHFDVEEIEQAYQLLAPVLGVGVAATLFATALLASGINSTVTATLAGQI
FT                   VMEGFLRLRLRPWLRRVLTRGLAIVPVIVVVALYGEQGTGRLLLLSQVILSMQLPFAVI
FT                   PLLRCVADRKVMGALVAPRWLMVVAWLIAGVIVVLNVKLLGDYAVHLMVGVSD"
FT   gene            complement(388486..388734)
FT                   /locus_tag="XfasM23_0303"
FT   CDS_pept        complement(388486..388734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91752"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M4"
FT                   /protein_id="ACB91752.1"
FT                   /translation="MNRTRKKDSTSNELFQPQPQRNLTSPHHRTHWTIRTFTPTKTNSV
FT                   MAQCLTYQNDTQQIANTSLWRLLPTSTPSTTMQTGIP"
FT   gene            complement(388901..389665)
FT                   /locus_tag="XfasM23_0304"
FT   CDS_pept        complement(388901..389665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0304"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="PFAM: Arginine-tRNA-protein transferase domain
FT                   protein; KEGG: xcb:XC_3101 arginyl-tRNA-protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91753"
FT                   /db_xref="GOA:B2I7M5"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7M5"
FT                   /protein_id="ACB91753.1"
FT                   /translation="MAIDSKPHDDLQLFKTNLHPCGYWPDRWASDLVMDPNDPRLGAIY
FT                   PQTLAWGFRRSGNLLYRPHCEHCNACVPVRVNVNAFVPNRSQRRCLARNATLVTRIVPA
FT                   ERNAEQLSLYRRYLHQRHPDGGMDGHGAIEFDQFLIGPWGYGRFMEIREPATNGTPGQL
FT                   LAVAVTDLTHQALSAVYTFYEPNAAARGLGTLAILHQIHWAQREQRPYLYLGYWIKDHF
FT                   KMDYKRRFQKLEIYDGYRWRPFSTTYPTTHTL"
FT   gene            complement(390089..390580)
FT                   /locus_tag="XfasM23_0305"
FT   CDS_pept        complement(390089..390580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0305"
FT                   /product="pathogenicity-related protein"
FT                   /note="KEGG: xom:XOO_1500 pathogenicity-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91754"
FT                   /db_xref="GOA:B2I7M6"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M6"
FT                   /protein_id="ACB91754.1"
FT                   /translation="MRGIFTSQRVETVEGVAALLNEADIQVKISHQRSYHSKRNGQFSY
FT                   LDTKNKDQHPTVWIIHANDQPLARDILRKARLLDTTRHNLSDTDNVFTSPINTIAPRSL
FT                   HWTWRIRLTLLLTITAIGLIITWHHFPPPTTTPQTSLQTQQRAKQQDEQTVRVQIQPMH
FT                   "
FT   gene            complement(390584..391435)
FT                   /locus_tag="XfasM23_0306"
FT   CDS_pept        complement(390584..391435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0306"
FT                   /product="Palmitoyl-CoA hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /note="PFAM: acyl-CoA thioesterase; KEGG: xcb:XC_3097
FT                   acyl-CoA thiolesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91755"
FT                   /db_xref="GOA:B2I7M7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M7"
FT                   /protein_id="ACB91755.1"
FT                   /translation="MLSLERLEDNLFRGQNRDIGTKYVFGGQILAQALAAAQNTIENSR
FT                   IAHSLHAYFLRTGNIQQPIIYNVERTRDGKSFSLRRVTAIQHGQVIFFCTASFQEREDG
FT                   AEHQTNMPAVPPPEDIAPTPPLPPETLARMPPQMQTWLNLSGQFEFRRVPPNNTLDLQK
FT                   HSAFQHLWLRMNAPLGDRIELHQILLTYASDFQLLETATSRHGINYHTPQVQMASLDHA
FT                   LWFHRPFRIDDWLLYTLESPTAQGARGLARGQFFTRNGVLIANTAQEGLMRMTNHTTPS
FT                   KD"
FT   gene            complement(392512..392841)
FT                   /locus_tag="XfasM23_0307"
FT   CDS_pept        complement(392512..392841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0307"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: xom:XOO_1777 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91756"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M8"
FT                   /protein_id="ACB91756.1"
FT                   /translation="MSINKLLIALAMGATLAACGSKTPETPPTQDPNPASNPAANEAQA
FT                   AADQAAANPPADATPAAADTTAAAANTAANAAATATPPADAAKQSGAAPATPATKAKNP
FT                   AEQKK"
FT   sig_peptide     complement(392779..392841)
FT                   /locus_tag="XfasM23_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.811 at
FT                   residue 21"
FT   gene            393976..396888
FT                   /locus_tag="XfasM23_0308"
FT   CDS_pept        393976..396888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0308"
FT                   /product="autotransporter-associated beta strand repeat
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; autotransporter-associated beta strand
FT                   repeat protein; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Autotransporter beta- domain protein; KEGG:
FT                   xom:XOO_1779 serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91757"
FT                   /db_xref="GOA:B2I7M9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7M9"
FT                   /protein_id="ACB91757.1"
FT                   /translation="MKTIFAARTILASALAAALSACGDPLVRSETPTTPTTPTTPTTPT
FT                   TPTTPTTPTTPTTPTTPTPLPDLDPALAAKFRAHLDVTNTEPAHTLGFTGKGYMIGVVD
FT                   SGVNPDHVTLQGRVIRNNVYVDYQDPSSPHDVDGHGTTVAQLAAGRPFGDFPGGIAPGA
FT                   TIFSARVFSSAAESAKEDPIGGNFFEGEAALLKRVNADMIAAGVRIQNNSWGYESDDSN
FT                   GEPIWTSPIITGLFVNAYRDLVLNNNGLMIFASGNEKQTQPGRLSRLPSLPTVEGGASP
FT                   ADLERGWLVVAALDSFDHPDQLASYSNHCGIAMHYCLAAPGDVITVNSSVTNSSSVSDK
FT                   YYVGQGGTSFAAPLVSGAAALVWEAFPYFSNDLVRQTLLGTATDLGAPGVDEVFGYGAL
FT                   NVGKAVLGPAKFDWGDVQVSFDDRRSTWGNDITGSGGLIKRGTGTLVLGGSNNQYTGAT
FT                   QVLGGTLQASSLGASAVSVANTATLIGSGRFGGAVSNAGTLELGKDGLKVQGDYTQLET
FT                   GRLALYVGDQLSVAGNATLKGGELQVLGKRDYVTFNTSYSVLQADGSLTGTFSQLTWGP
FT                   AVLLGEGRLTYGANNAYVTLQRLNVSAAAQALGIVDRVAQASAQRVEQAFRAIDAQQAQ
FT                   GRGALPTSFIGAAAALQQSSSAAVAAGSLQSLSGQSHVAAAAASLDAIDLGRRSLATRL
FT                   DVLRSGERIVTWHQALGGPGHNGAASGTFSLSGWLVGHDAQLASGDIVGVAFGQADSSP
FT                   SGSASGLRGIDRQVQGRVYLQRTQGPLYVLGQLGFGSFQRRLDRQLQLGDWNDWTSSRY
FT                   SGQFWSGSVEAGYHWRQGSLALTPYLGLDQTQLRTDGFREQSGSGFGLQVQSAQATRSQ
FT                   LLAGVRTEWRWGGVQWRGYGEWQQTLRQSGLNPQASFTATSSWTPLVASSWPGRSGGVL
FT                   GLSMVLPVGVTAGLWTMGLEHYFGTRSRGESLGLRYQLGF"
FT   sig_peptide     393976..394047
FT                   /locus_tag="XfasM23_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.894 at
FT                   residue 24"
FT   gene            397655..397769
FT                   /gene="ffs"
FT                   /locus_tag="XfasM23_R0019"
FT   ncRNA           397655..397769
FT                   /gene="ffs"
FT                   /locus_tag="XfasM23_R0019"
FT                   /note="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(398178..400169)
FT                   /locus_tag="XfasM23_0309"
FT   CDS_pept        complement(398178..400169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0309"
FT                   /product="X-Pro dipeptidyl-peptidase domain protein"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: xac:XAC2341 glutaryl-7-ACA acylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91758"
FT                   /db_xref="GOA:B2I7N0"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N0"
FT                   /protein_id="ACB91758.1"
FT                   /translation="MRRFIAALSFILPLAAIAQTAPMTPDITGRQFVVPTEKDDYIKRE
FT                   VMIPMRDGTKLHTVIIIPKKAQHAPMLLTRTPYNANERSERILSPHMKNLLPQGDDVFA
FT                   TGDYIRVFQDVRGKYGSEGDYVVTRPLRGVLNLTNIDHATDAWDTIDWLVKNIKQSNGN
FT                   VGMIGSSYEGFTVVMALTDPHPALKVAAPESPMIDGWMGDDWFNYGAFRQVNFDYFSGQ
FT                   MTNRGKGLSIARQGYDDYSNFLQAGSAGNYAKAAGLEQLPWWHKLTEHPAYDSFWQEQA
FT                   LDKVMARTPLKVPTMWLQGLWDQEDMWGAIHCYAAMEPRDVHNDKNYLVMGPWRHSQVN
FT                   YDGSNLGTLKFDGNTSLQFRHDVLKPFFDQYLIDGASKADTPPVLIYNTGANHWDRMQH
FT                   WPRSCERGCEYTSKPLYLNAGGTLSFQTSQRKQNDYDEYISDPANPVPFMPRPINFKDN
FT                   AMWSTWLVQDQRFVDNRPDVLTYLSEPLTTPLQIAGVPRINLHASTSGTDSDWVVKLID
FT                   VYPDEIASDPKMGGNELAISLGIFRGRYRTSFQYPTPMTPNQPLLYRFDLPNANHTFLT
FT                   GHRIMVQVQSSLFPLYDRNPQRYVPNIFFAKPDDYIKATQRIWHTPRQPSFVELPVVNP
FT                   DILTQWTHWNIGSSHKTTLPTPSLSDWL"
FT   sig_peptide     complement(400113..400169)
FT                   /locus_tag="XfasM23_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.833 at
FT                   residue 19"
FT   gene            complement(400813..403404)
FT                   /locus_tag="XfasM23_0310"
FT   CDS_pept        complement(400813..403404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0310"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   xcv:XCV4371 glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91759"
FT                   /db_xref="GOA:B2I7N1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7N1"
FT                   /protein_id="ACB91759.1"
FT                   /translation="MPKKNSPLLPKETTTTQSSVDTSGSSNLTWPVSEHTIRRPLWARL
FT                   LGQILDPWLDLSIEPEHSVQYNDGRPIIYVLEDYGLCNTLILDKACRKTKLPSPLIPLS
FT                   GNPLQRKRAYLALSRRSSSNSLIPNQRGGKTHSDSLANLLQAHRIRDTLDVHLVPVSIF
FT                   IGRTPDRQSGWFAVLFSENWALVGRFRRILAILLNGRNTIVCFAPPISVRQTLNEGLPP
FT                   ERTLRKLQRVLRTHFRRIRETVIGPDLSTRRLLVDNVLATEAVREAIGAQAKRDGTDLS
FT                   ETWRKAQAYAWEIAADYSSPVIRSADFLFSHVWNRIYAGVLVHHVDSFKEISPGHEIVY
FT                   VPSHRSHMDYLLLSYCLYKCSIGLPHIVAGINLNLPVVGTLLRKCGAFFIRRSIKGNML
FT                   YSVVLSEYVAQLVAGGYSLEYFIEGGRSRTGRLLQPKGGMIMMTVQAFLRQPRRPVLFQ
FT                   PIYIGYEKLMEGTSYLDELSGEPKKKESIWRVFWNIPKVLKQKYGQVVVNFGEPIALND
FT                   VLAELAPEWEGQALNENEKPAWLSSTVNHLARQIQTRINSAADVNPINLLALALLSTPK
FT                   HAMGEADLIAQITLCKKILLELPYSNRVTITPHTPERIIAHAEQINILTRVHHPLGDVL
FT                   RVDGDNAVLLSYFRNNVLHLFTASAWVACCFKNNRRMSRIALIRLGVGMYPFLQAELFL
FT                   PWTEDQFAQHIQQVIELFVREGLLLSAGNEEEDPLTRNTSQTDEVFRLRAISHSLQQAF
FT                   ERYYITISILVKNGPGTLSASELESLCQLAAQRLSLLYASTAPEFFDKGLFRGFIQKLR
FT                   ELNLVWPDTYSKLLFDERLDTSAKDAQVILGRELRHTIERISPEATKPAPK"
FT   gene            404610..404828
FT                   /locus_tag="XfasM23_0311"
FT   CDS_pept        404610..404828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91760"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N2"
FT                   /protein_id="ACB91760.1"
FT                   /translation="MGTSAYACLLASLLVTLFDYYPSMSCFPVLNINSDHDVPAVMWYF
FT                   FNKGDCGIIFIGKLLDNIWQPIHMLPR"
FT   gene            404929..405224
FT                   /pseudo
FT                   /locus_tag="XfasM23_0312"
FT   gene            405327..408353
FT                   /locus_tag="XfasM23_0313"
FT   CDS_pept        405327..408353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0313"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; KEGG: xac:XAC4274
FT                   OmpA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91761"
FT                   /db_xref="GOA:B2I7N3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N3"
FT                   /protein_id="ACB91761.1"
FT                   /translation="MKKSCSSQLLQIRRLLCYAFAVCLYLALPNAFAQSSNATLRGQVS
FT                   RAQAGAVVLVTNTATGLVRRTTLLSDGTYGMTGLPPGQYTISVGGVSRTVTLSVASSVT
FT                   VNLDAGVPISGDAKTLDAVQVTGQAIREVKTSEIGNTIALRQIQQLPQATRNFLEFADT
FT                   VPGMAFNIDPQGRTTLRAGASNSSASNLYIDGVGQKSYVAKGGISGQNDSQGSPFPQLA
FT                   IGEYKIITSNYKAEYGQIGGAAVTAATKSGTNEFHGETFYRYTNQSLRDRRPDEGETKV
FT                   DSQTKEYGFALGGPIIRDRMHFFFAYEGKDNVVPRSVQADARAAPYVHFLPSYLSQQYG
FT                   PVNLPFNEDLFFGKIDFEPTGDDRLELSVQYRDETQIDNIGGQNAADHGLNKINKDKRG
FT                   SLRWQRSADAWSNELIFTRENARNNPNPMSIGNGFNYVYLDETDPNIGEYTFLSIGPDG
FT                   GSSMQRRHQDGWSLQNDLTFTSVKWNGDHTIKMGVSYKNITLQSQDAASLNPQFSYAVS
FT                   SSGVATTPYRVDFYSPYATPGQKALVETRAKQYGLYLQDDWNVNQKLTLNLGLRWDYED
FT                   NPAYTNFVTSQAFVAALYADDPENPGHPWANRLLPSGINVADYISNGHNRHNFNKGWAP
FT                   RFGFSYDIYGDEAAVMHGGAGRSYDRNLFEQMAYETSKAALSPVAVYFQDPATHTCYHS
FT                   DRLCVPWDPKYLNGIDQLNAIAGVSGSGELFIFNNKLKTPYSDQYSIGISNKIGSWLTD
FT                   VTFQRVLSNDGLAMSLVNRYPDGRYFDAEGNAPWDQSVPGHKNTILGMNGLKQRSSQVL
FT                   LSVEKPYSKESGWGVNVAYTHTSARQNRTIDEPFAFDKATIYEYPFVKSDAVAAHRLVV
FT                   SGSMDGLWGMTFGAKVVLATPTPINTIACYGQIDPDGANCQQVGVIPPSSGKFLVGGNI
FT                   WGYRTVDFQASKEFTVFNDFKLSARVNLLNAFNFKNYASYVYNSFGSDGRLQPDITINR
FT                   IGDINYVPRTVTFELGMKF"
FT   sig_peptide     405327..405428
FT                   /locus_tag="XfasM23_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 34"
FT   gene            complement(408460..409902)
FT                   /locus_tag="XfasM23_0314"
FT   CDS_pept        complement(408460..409902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0314"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: xcv:XCV0856 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91762"
FT                   /db_xref="GOA:B2I7N4"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7N4"
FT                   /protein_id="ACB91762.1"
FT                   /translation="MNTHPQTSPNTHYKIADISLADWGRKEIDIAEHEMPGLMSIRRKY
FT                   ASKQPLKGVRVTGSLHMTIQTAVLIETLKDIGADVRWASCNIFSTQDHAAAAIATSGTP
FT                   VFAWKGETLEEYWDCTLQALTFTLADGTLTGPELIVDDGGDATLLIHKGYELENGSTWV
FT                   DEPSDSLEEQVIKRLLKRIAIERPGYWTRVVNDWKGVSEETTTGVHRLYQIAATGRLLV
FT                   PAINVNDSVTKSKFDNLYGCRESLADGLKRAMDVMLAGKLAVVCGYGDVGKGSAHSLRA
FT                   YGARVIVTEIDPICALQAAMEGFEVTTVEDTLGQADIYVTTTGNKDVIRIEHMTAMKDQ
FT                   VIVCNIGHFDNEIQVDALNALTGVQKINIKPQVDKFILPNGNTLFLLAEGRLVNLGCAT
FT                   GHPSFVMSNSFANQTLAQIDLWQNKDVYEKNVYRLPKKLDEEVARLHLEKIGVKLTTLT
FT                   ANQAAYLGISVEGPFKPEHYRY"
FT   gene            411060..412367
FT                   /locus_tag="XfasM23_0315"
FT   CDS_pept        411060..412367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0315"
FT                   /product="putative AMP-dependent synthetase and ligase
FT                   family protein"
FT                   /note="KEGG: xcv:XCV4192 putative AMP-dependent synthetase
FT                   and ligase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91763"
FT                   /db_xref="GOA:B2I7N5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N5"
FT                   /protein_id="ACB91763.1"
FT                   /translation="MGVGSLHRPLVWVHGKPITLGRFLAQVRGLAAQLPSGRYVVNLCE
FT                   DRYHFLLAFYACALRGQVSLLPSSRAPGVVAEIYAAYPDSYCLGDRELSMEALRYWHLP
FT                   EIFPELDGAIPSLLEDAVVAIGFTSGSTGVPTSNLKTWGSLVTSTEQDWAAFHSLWGSQ
FT                   VPTIVATVPSQHMYGMEFSVLLPLLAPVAVHAGRPFFPEDVAQALAEVPAPRLLVTTPV
FT                   HLRVLVQSGLRFPEVAGIVSATAPLAHDLAVAAEACFGCELREVFGSTETCTFAVRRTV
FT                   YEQAWTRFDGVSIEVNADVTWVYARHLPAPMAIADFVDVYEDGRFEVLGRQADLLEIAG
FT                   KRASLGELNRCLLAIPGVVDGVLVQMPLEADQTVGRIAAVVVAPTLHEVHIQKMLRTKI
FT                   DPLFLPRRLRKVDALPRNETGKLPREALLALLADVC"
FT   gene            412621..412797
FT                   /locus_tag="XfasM23_0316"
FT   CDS_pept        412621..412797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91764"
FT                   /db_xref="GOA:B2I7N6"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N6"
FT                   /protein_id="ACB91764.1"
FT                   /translation="MRNTVLVNTSVCNVSWVLFVTQHCLLGLVAEMRCLLIAILAWRWI
FT                   LVFSMGYKYRGIV"
FT   gene            complement(413252..413956)
FT                   /locus_tag="XfasM23_0317"
FT   CDS_pept        complement(413252..413956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0317"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: xcb:XC_2879
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91765"
FT                   /db_xref="GOA:B2I7N7"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7N7"
FT                   /protein_id="ACB91765.1"
FT                   /translation="MVSKFDTQHLLNSNTALVAGVDEAGRGPLAGPVVVAAVVFDPSQP
FT                   HINGLNDSKQLSPACRERLYAHIVERALAYKVVMIDSTQIDTLNIYQATMLGMRLAVEG
FT                   VAHVAKSARIDGNRLPKNLPCPAEALVGGDARDPTIMAASILAKVTRDRHMVELHLQYP
FT                   HYGFDKHKGYGTPAHLAALAEHGPCLEHRQSFAPVRRMLTPKAIHARQSAHQHNENSPT
FT                   KAAFNMLIERDD"
FT   gene            complement(414013..415170)
FT                   /locus_tag="XfasM23_0318"
FT   CDS_pept        complement(414013..415170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0318"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="KEGG: xcb:XC_2878 lipid-A-disaccharide synthase;
FT                   TIGRFAM: lipid-A-disaccharide synthase; PFAM: glycosyl
FT                   transferase family 19"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91766"
FT                   /db_xref="GOA:B2I7N8"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7N8"
FT                   /protein_id="ACB91766.1"
FT                   /translation="MIQAPRIAIIAGEASGDHLGAGLIQQLRLHFATAEFIGIGGDMMR
FT                   SAGCQTWFDTSELAVMGLTEVLRHLPRLLKIRREFCKRALAWHPDVLIGIDAPDFNLTV
FT                   ERWFKQRHIRTVHYVSPSIWAWREKRAAKIGASVDRVLCLFPMEPPIYARYGIDARFVG
FT                   HPMADEIPYQTDRATARTALGLPLLSPVLAVLPGSRHSEISQLGNTFLEAAGQLSEHLP
FT                   GLHVVIPAANTQCKPLLAEQLSRSTLPVMHSHLLDSSARTAMLAADVVLVASGTATLEA
FT                   MLLKRPMVVAYKVAPLTYRIVKTLKLLKINRFALPNILAGEDLVPELIQKDCTAPALCA
FT                   ALLDCFKHPQKVTALQNRYLQLHTQLRRNASTRAAEAIAELLQQR"
FT   gene            complement(415247..416050)
FT                   /locus_tag="XfasM23_0319"
FT   CDS_pept        complement(415247..416050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0319"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: xcv:XCV1466
FT                   UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91767"
FT                   /db_xref="GOA:B2I7N9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7N9"
FT                   /protein_id="ACB91767.1"
FT                   /translation="MEAVMNKHASLIHPTAVIAPSATLAPDVQIGAFTLIGNDVQIDTG
FT                   TIIGSHCTIHGPTRIGRNNRFIGQAAIGGEPQDKKFAGERTELLIGDNNTIREFVTINR
FT                   GTGGGGGVTSIGNDNWILAYTHIAHDCHVGHHCVFSNNASLAGHVTVGDWVIFSGFSGA
FT                   HQFCRIGRYAFIGMGTLINGDVPPFTLIGSDTLGRPRGINNEGLKRRNFTPERITAIKR
FT                   AYRTLYVAGLPLAEAKQQLAEQAKDNDDIKELLQFIETAQRPLLR"
FT   gene            complement(416060..416542)
FT                   /locus_tag="XfasM23_0320"
FT   CDS_pept        complement(416060..416542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0320"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: xom:XOO_1856 (3R)-hydroxymyristoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91768"
FT                   /db_xref="GOA:B2I7P0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7P0"
FT                   /protein_id="ACB91768.1"
FT                   /translation="MSDSPTTAHTRLELPIDIIRIQALLPHRYPFLLVDRILELDQKQK
FT                   RIVAQKNVSINEPFFQGHFPEHPVMPGVLIIEALAQAGGVMTQLNLSHNGHSSLLFYMV
FT                   RVDNARFNKQVVPGDILILDMTMKRRIRNMGCYYGEARVNGEVVACADIMCAGVKS"
FT   gene            complement(416539..417555)
FT                   /locus_tag="XfasM23_0321"
FT   CDS_pept        complement(416539..417555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0321"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase LpxD; KEGG: xcv:XCV1468
FT                   UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91769"
FT                   /db_xref="GOA:B2I7P1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7P1"
FT                   /protein_id="ACB91769.1"
FT                   /translation="MPIFTAQELAERFNLQLFGDGNIRIHGVATLTQASPEQLSFLANP
FT                   RYLTQLPNSRAGVIVLHADDVKAASGAVLIAKDPYVTFAKIATLFDIKPAREAGIHPLA
FT                   TVDPSAHVSPTAHVGAFVSIGARSSIGASCIIGTGSIIGDDCTIDDGSELIARVTLISR
FT                   VRLGKRVRIHPGAVLGGEGFGLAMESGHWIKIPQLGGVVIGDDCEIGANSCIDRGALDD
FT                   TVLEEDVHIDNLVQIAHNCRIGAHTAIAGCTGIAGSAKIGRYCLLGGHVGVVGHLQICD
FT                   NVVITGKSVVRNSIHTPGEYSSGTPLTDNRTWRKNAVRFKQLDMLVRRMMAVSKEKA"
FT   gene            complement(417744..420098)
FT                   /locus_tag="XfasM23_0322"
FT   CDS_pept        complement(417744..420098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0322"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: xac:XAC1413 outer
FT                   membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91770"
FT                   /db_xref="GOA:B2I7P2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P2"
FT                   /protein_id="ACB91770.1"
FT                   /translation="MTRFYTRHLLTLTIAANFGLPVLTQAAESFVANDIRVDGLQRIAS
FT                   GTVFTYLPVNRGDTVDDAKVADAIRALYRTGFFENVRIDRQGNILVVKVKERPAINKLT
FT                   ITGNKDIKSEELLKGLSEIGLSEGGTFDRLSLDRVTQELKRQYNNRGKYNVQMTTTTTP
FT                   LDRNRVDVTIAIKEGKAAKIRHINLIGTEKFNNKDVMSAWESKEHNWASWYRRDDQYSK
FT                   EKLSGDLEKLNSWYLDRGYVDFNIDSTQVSISPEKHNMFITAGVTEGDQYKISSIKVTG
FT                   NTVLPQEKIEKLVIPKTGDIFSRVLLEYSSAAIINTLSNIGYAFSKVNPIPTANRADRT
FT                   VAVNLHVIPGPRVTVRQILFKGNTRTSDEVLRREMRQFENSWYSQAAIDRSKIRLQRLG
FT                   YFEAVDVESTPVPGSNDQVDIVYTVKETTSGSFQVGLGYSKTYGVTTSVQLSQNNFLGS
FT                   GNRVSVDASRSRYQDRYSFSYTNPFFTDNGVSLGYNLAYQKLDYSDFNAAQYNSKRMSG
FT                   QTIFGIPITENDTVSWVIGADSNQITTFPGSTPKAIIDYIDAVGQRTFRAWRTELGWAR
FT                   DTRNDYFMPNLGMYQRIGAEVTLPGSTIKYYKINYQISKYWPIIPALVLNTRLEVGYGD
FT                   DYGKSHTRILPDGTVATASGLPFFENFYAGGTNSVRGFRDNTLGPRSEVTALYNQGQPL
FT                   GGSFKTVGSTEMYFPKLFDSPSARISAFLDVGNVFNGVKNFTTNELRASSGVALLWRAP
FT                   IGPISISYAFPIKKKNDDEIERLQFTFGGQF"
FT   sig_peptide     complement(420018..420098)
FT                   /locus_tag="XfasM23_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.923 at
FT                   residue 27"
FT   gene            complement(420197..421531)
FT                   /locus_tag="XfasM23_0323"
FT   CDS_pept        complement(420197..421531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0323"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="KEGG: xac:XAC1414 hypothetical protein; TIGRFAM:
FT                   membrane-associated zinc metalloprotease; PFAM: peptidase
FT                   M50; SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91771"
FT                   /db_xref="GOA:B2I7P3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P3"
FT                   /protein_id="ACB91771.1"
FT                   /translation="MGDFLASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFG
FT                   TPLWSRRSSSGTEFVIGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAG
FT                   PLANLLLCMLLLWVLFVIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEA
FT                   SMLLTAAAMDRQNAVLSVIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPP
FT                   IIAKIEPGSIAEGAIKPGDIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEER
FT                   LALELSPRKSAQGVWLLGVKTNPGPVPAFDSQQRYGVLAAVPLAIRETARMTADSLGMM
FT                   KRIITGQASAKNISGPISIAKIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGG
FT                   HLLYYAIELLKGSPLSTRAMAAGQYIGLALLAGLMGLAFYNDLLG"
FT   gene            complement(421558..422742)
FT                   /locus_tag="XfasM23_0324"
FT   CDS_pept        complement(421558..422742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0324"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: xcv:XCV1472 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91772"
FT                   /db_xref="GOA:B2I7P4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7P4"
FT                   /protein_id="ACB91772.1"
FT                   /translation="MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDA
FT                   LLALCRTYRPDHAVIGDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAA
FT                   IVGAAGLHSTLAAARAGKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQC
FT                   LRSRTTDGVHRVTLTASGGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNK
FT                   GLEVIEAHHLFGLPSEQIDVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWP
FT                   ERIGSGVQGLDLMKHNRLDFEHPDTETFSCLRLARDAMQTGGTAPAVLNAANEIAVSAF
FT                   LQGRIGFLTIPALIEHALTTLPRYEADTLETLLTVDTETRRITHAALTHFPLPL"
FT   sig_peptide     complement(422677..422742)
FT                   /locus_tag="XfasM23_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.621 at
FT                   residue 22"
FT   gene            complement(422745..423599)
FT                   /locus_tag="XfasM23_0325"
FT   CDS_pept        complement(422745..423599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0325"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   xcv:XCV1473 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91773"
FT                   /db_xref="GOA:B2I7P5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P5"
FT                   /protein_id="ACB91773.1"
FT                   /translation="MTRTRVIAALVMAPVAMCSILFLPTAWLASLTAIIFLWGLWEWMK
FT                   LSQVEDTLVRTVLLTLNLLLMVLLVWVSAHSLVLFQIATLIGIAWWILALLWLRFLGFC
FT                   ADPNQRTAKIVKVTAGTLAVIPAWSALVLLHSGDKPGSTFPESLHAHLWLLTAQIMIWA
FT                   ADSGAYFSGRLFGKHKLAPQISPNKTVEGLLGGILTGLAVAAGFGLLNGVTMAQFPSLL
FT                   LVSFVAILASVIGDLFESLLKRHAGIKDSGSMIPGHGGVLDRIDSTLAALPVFALGKDI
FT                   FGF"
FT   sig_peptide     complement(423513..423599)
FT                   /locus_tag="XfasM23_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.783 at
FT                   residue 29"
FT   gene            complement(423596..424363)
FT                   /locus_tag="XfasM23_0326"
FT   CDS_pept        complement(423596..424363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0326"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: xcb:XC_2869 undecaprenyl pyrophosphate
FT                   synthetase; TIGRFAM: undecaprenyl diphosphate synthase;
FT                   PFAM: Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91774"
FT                   /db_xref="GOA:B2I7P6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P6"
FT                   /protein_id="ACB91774.1"
FT                   /translation="MQINTIPVNPTLPRHIAIIMDGNGRWAERRSRPRTTGHRAGVKAA
FT                   MRTVDFCLEKGIKMLTLFAFSSENWNRPADEVNFLMEMSIKLFGRGIEELHRRGVQVRF
FT                   IGERKRFDIALVEHMTKAEHLTASNQRLILSLAVSYGGRQDITMAARALAQDVAAGRLK
FT                   PEQIDEDLLGQHMALADLPPPDMFIRTSGVIRISNFLLWQIAYTELWFTDVMWPEFNST
FT                   VLQQALDDYASRERRFGLTNAQIASRGKGSIPA"
FT   gene            complement(424366..424938)
FT                   /locus_tag="XfasM23_0327"
FT   CDS_pept        complement(424366..424938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0327"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: xcb:XC_2868
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91775"
FT                   /db_xref="GOA:B2I7P7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P7"
FT                   /protein_id="ACB91775.1"
FT                   /translation="MNIQAMLNQIKQDAQDRMTKSIDALRNSLASVRTGRASPSLLDGI
FT                   KIKAYGTDTPLNQVASISVSEGRSLVITVFDKNMSKDVEKAIYASDLGLTPTVVGTLIR
FT                   LNLPPLTEERRKELTKVVHSEGEDTKVAIRNIRRDANQQIKDMLKSKEITEDEVRHGEE
FT                   DIQKLTDKAIKSVDEVVKSKEQELMTV"
FT   gene            complement(425677..427020)
FT                   /locus_tag="XfasM23_0328"
FT   CDS_pept        complement(425677..427020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0328"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: xcb:XC_0017 outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91776"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P8"
FT                   /protein_id="ACB91776.1"
FT                   /translation="MIRRVFTLVNVTTLTLSITGVLYISNAHAAAFQLKENSAKALGRS
FT                   FAGAASAQDDAAIIVNNPAGMRQLDGRQFQADLSTVRFSAEYRGNPGIYRNGNPIGGGN
FT                   GGDAGMVALLPDSYFHMPFGDNNNVHLGATLNAPFGFSTKYDRNWTGRYHGIYSKLQAI
FT                   DLGIAVSYDVNPYVSFGGAVFAERLNVNLSNAIDFGSILNARRVPSFSPGSADGYSHIE
FT                   GHDTSMGFTLGGLFSPDEKTHIGFSYRSEVKHNANNGNAHFTVPENAAAVLAVAAPGTF
FT                   INTKIKSTIRLPASATTSFTHAIDDRWSIMAEVTRTAWSKLDKITIHFASSQPKNVLNF
FT                   SYRDTTFVALGTEYRFNDMLTLRGGLAYDQTPTTAEYRSVRVPDNSRTWISFGMTWKPS
FT                   KQTDYNIGYAHLFIGHPTITQISATGSTLAGAYNINADLLATSINYKF"
FT   sig_peptide     complement(426931..427020)
FT                   /locus_tag="XfasM23_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            427252..427932
FT                   /locus_tag="XfasM23_0329"
FT   CDS_pept        427252..427932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0329"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: xac:XAC0020
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91777"
FT                   /db_xref="GOA:B2I7P9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7P9"
FT                   /protein_id="ACB91777.1"
FT                   /translation="MFVSIPSRNRPTWLWAVPLLFFAVLIAFLWSISRPGQERSTLWLD
FT                   WGALSGGFSHVPDMWITSQGGSALRLFTALFLHADWAHLLGNLVFLLIFGLPAERILGS
FT                   WRLLLLFLLGGALANLAAVLTIGSPNHVIIGASGAVSALIGSYLALFPGAKLGVVLPLG
FT                   LFLEFIRVPAPFLIGFWALLQVVFAYTGPTLVMVAWSAHLAGFVSGVVYGSFVRAAIVR
FT                   RLRQ"
FT   gene            428051..428371
FT                   /locus_tag="XfasM23_0330"
FT   CDS_pept        428051..428371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0330"
FT                   /product="protein of unknown function DUF1820"
FT                   /note="PFAM: Domain of unknown function DUF1820; KEGG:
FT                   xom:XOO_4320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91778"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q0"
FT                   /protein_id="ACB91778.1"
FT                   /translation="MSKTLYKIIFVNQGKVYELYARCVISSHLWGFNEISELVFDVHSG
FT                   LVVDPTEEQLRHEFANTKTLHLPMQSIVRIEEVDKKGQSVIRDAETGEKVVTPFITPFK
FT                   PR"
FT   gene            428881..429176
FT                   /locus_tag="XfasM23_R0020"
FT   ncRNA           428881..429176
FT                   /locus_tag="XfasM23_R0020"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 237.92; RNA component of RNaseP"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            429252..429476
FT                   /locus_tag="XfasM23_0331"
FT   CDS_pept        429252..429476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91779"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q1"
FT                   /protein_id="ACB91779.1"
FT                   /translation="MHLSNVGEVLYLIEALQCCAASLPAHVIWSGKETLGRKCPLKRIA
FT                   QKHFESVYVTLSPAWSAQYECEKDPQQRS"
FT   gene            complement(429584..430315)
FT                   /locus_tag="XfasM23_0332"
FT   CDS_pept        complement(429584..430315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0332"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: xom:XOO_1864
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91780"
FT                   /db_xref="GOA:B2I7Q2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q2"
FT                   /protein_id="ACB91780.1"
FT                   /translation="MSKLAYHRVLLKLSGEALMGSADYGIDPKVINRLAGEVIEAQNAG
FT                   AELALVIGGGNIFRGAGLAAKGMDRVTGDQMGMLATIINALAMQDALEKLGTKVRVMSA
FT                   IKINNVCEDFIRRRAIRHLEKSRITIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATK
FT                   VDGIYNKDPQKHCDAVKYSTLSYDEVISQNLEVMDTAAFALARDSNLPLRIFDIEQPGV
FT                   LLRILHGEEIGTLVKERNSKS"
FT   gene            430766..431014
FT                   /locus_tag="XfasM23_0333"
FT   CDS_pept        430766..431014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91781"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q3"
FT                   /protein_id="ACB91781.1"
FT                   /translation="MRVSPSAYMYVVTKFEANPFLEVLQYCDSLGTVCADDWKLLWVWG
FT                   DEMVIGRCAVAGHRRPFAYSVVGDDVVAKQKGQAYKG"
FT   gene            complement(431042..431128)
FT                   /locus_tag="XfasM23_R0021"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(431042..431128)
FT                   /locus_tag="XfasM23_R0021"
FT                   /product="tRNA-Leu"
FT   gene            complement(431259..431334)
FT                   /locus_tag="XfasM23_R0022"
FT                   /note="tRNA-Glu1"
FT   tRNA            complement(431259..431334)
FT                   /locus_tag="XfasM23_R0022"
FT                   /product="tRNA-Glu"
FT   gene            complement(431388..431463)
FT                   /locus_tag="XfasM23_R0023"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(431388..431463)
FT                   /locus_tag="XfasM23_R0023"
FT                   /product="tRNA-Ala"
FT   gene            complement(431717..432376)
FT                   /locus_tag="XfasM23_0334"
FT   CDS_pept        complement(431717..432376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0334"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: xom:XOO_2195
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91782"
FT                   /db_xref="GOA:B2I7Q4"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q4"
FT                   /protein_id="ACB91782.1"
FT                   /translation="MSITETQNKAESLLYNAGILPVVTVDTVDQARRVVGALLEGGLTT
FT                   IELTLRTPVALEALATLKREQPEITIGAGTVLNEHQLRQSIDAGADFLITPGTPPTLAQ
FT                   LLADAPIPAVPGAATATELLALMVLGFHVCKLFPANVVGGLHMLTSLAGPLTNLKLCPT
FT                   GGINETNASDYLAQPNVICIGGSWMVPKDWLVQGHWDNIKNSSSKAAAIIQQARSH"
FT   gene            complement(432489..434381)
FT                   /locus_tag="XfasM23_0335"
FT   CDS_pept        complement(432489..434381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0335"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: xcb:XC_1974 phosphogluconate dehydratase;
FT                   TIGRFAM: 6-phosphogluconate dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91783"
FT                   /db_xref="GOA:B2I7Q5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q5"
FT                   /protein_id="ACB91783.1"
FT                   /translation="MRPHPNIQAVTDHIRQRSATTRTDYLAGIDAALRDGPSRSRLSCG
FT                   NLAHGFAACGTTDKERLREAITPNLGIITAYNDMLSAHQPFEHYPDIIRNTARALGATA
FT                   QVAGSVPAMCDGVTQGRAGMELSLFSRDNIAQSTAIGLSHDMFDAAIYLGVCDKIVPGL
FT                   LIGALAFGHLPAAFVPAGPMPSGIPNKQKAEIRERYAAGQATRAELLAVEAASYHAPGT
FT                   CTFYGTANSNQVLLEAMGVQLPGASFVSPGTPLREALTQAATERVLHITALGQDFRPIG
FT                   RLIDERAIVNAIVALMATGGSTNHTIHWIAVARAAGILLTWDDMDRISQTVPLLARVYP
FT                   NGEADVNRFHAAGGTAFVFRELMDAGLMYDDLPTIVAGGMRAYTQEPHLHHGTLGYSPS
FT                   PTTSTDASVVRPVTHPFEPQGGLRLLHGNLGRALIKLSAVKPEYRAIEAPAVVIDTPQT
FT                   LHKLHAAGALPKDFILVVRYQGPRANGMPELHSLAPLLGLLQNQGRRVALVTDGRLSGA
FT                   SGKFPAAIHLTPEAARGGPIGRIREGDLLRLDGEAGILEALVPTTEWETRTPAPNTATT
FT                   SNDLGRNLFAINRQVVGPADQGGLSISCGPKPPDNHVWSNTANDTPDDHATLAP"
FT   gene            complement(434522..435241)
FT                   /locus_tag="XfasM23_0336"
FT   CDS_pept        complement(434522..435241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0336"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; KEGG:
FT                   xac:XAC2069 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91784"
FT                   /db_xref="GOA:B2I7Q8"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q8"
FT                   /protein_id="ACB91784.1"
FT                   /translation="MIPTNDAHITLMNYDDPLEWAQSVTRELENILLQEITQRGRASLL
FT                   LSGGTTPALVYETLATRPLDWSKIDIGLVDERWLSPQDKDSNAWLVRHTLLEHAKHATF
FT                   LPLIRPGKTLNQCVHDANLQITHSPPPCAVVLGMGNDGHTASLFPGSLDLQKAINTPQP
FT                   YVALDATGCPGAGVWPLRITLTPAGLNNIPHRLLLLRGKQKLKVLETALSCKDALDYPI
FT                   RTAIDLPNARLRVHWCA"
FT   gene            complement(435238..436251)
FT                   /locus_tag="XfasM23_0337"
FT   CDS_pept        complement(435238..436251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0337"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: xcb:XC_1976 glucokinase; TIGRFAM: glucokinase;
FT                   PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91785"
FT                   /db_xref="GOA:B2I7Q9"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I7Q9"
FT                   /protein_id="ACB91785.1"
FT                   /translation="MNAPQAPVLVADIGGTNARFALANPTLTSAPLLNDSMREFAVIEF
FT                   PSLGEAAQHYLHHIGIHTTKGVFAIAGHVDGDEARITNHPWVITRTRTATMLGFDTLHL
FT                   INDFVAQAMAISVLGPQDVIQIGSAKWEQFPLSAATRNYGIIGPGTGLGVGGLMIRNGR
FT                   CYPLETEGGHVSFPPSTPEEIRILEILSQQFGRVSNERLISGPGIVNIHRALSEIDGID
FT                   PGPLRPQDITMRAADGDIRATRTINLFCNIFGTITGDLVLIQGAWDGVFLTGGLVPKLL
FT                   NSIQHSGFRQRFEHKGRFSAIMARIPSLAVIHPHPGLLGAAAYARDTEQVPQEIKA"
FT   gene            complement(436248..437681)
FT                   /locus_tag="XfasM23_0338"
FT   CDS_pept        complement(436248..437681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0338"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: xcb:XC_1977 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91786"
FT                   /db_xref="GOA:B2I7R0"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7R0"
FT                   /protein_id="ACB91786.1"
FT                   /translation="MHNTLLLFGATGDLAQRYLFPSLLQLFTDGLLPQDFRIRALALSP
FT                   HNTTQFRDILRTRLEQALPIANTAHIQALLQRVDYLSVDLNDPTSIAEAVRDLTEHPCI
FT                   SYLAIPPGLYTNTALGLAQGGALQTPHRLMLEKPIGRDSINAREILNTIGTLIDEDRIF
FT                   RVDHYLGKAAVQNLVALRFGNTLLEAVWNRNHIESVHILIAETEGVDGRNAYYARAGAL
FT                   RDMMQSHILQLLCLVAMEPPVSMEADRIRDEKVKVLRALRPLNAQNAAMHSVRGRYSAG
FT                   TINSQPVPAYQPPEGSNVETFVGVTAYIDNWRWAGVPFHLCTGKRLAERSTQIVVTLKP
FT                   VTHWLFERPNRNNAAPNRLCFKLQPQENIELNLMSSLAGPEWGTLELQPLELELSVPTG
FT                   KHRHIAYERLFLDAFNGNPALFVRHDEVTEAWAWIDSISNAWELSDLPLQPYPAGGWGP
FT                   PQAHQFLPPLGIDGHGNNA"
FT   gene            438010..439104
FT                   /locus_tag="XfasM23_0339"
FT   CDS_pept        438010..439104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0339"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: xcv:XCV2238 sugar ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91787"
FT                   /db_xref="GOA:B2I7Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q6"
FT                   /protein_id="ACB91787.1"
FT                   /translation="MAKVQLEAIRKVYDNGQVVVPGISFEVNDGELMVLVGPSGCGKST
FT                   LLRMIAGLEDISSGTLRIGERVVNDVPPKDRNVAMVFQSYALYPHMTAAENLAFGLKLR
FT                   GYSTEAIAERIKNVAEMLGLTSLLDTLPKAMSGGQRQRVALGRAMVRESAVFLLDEPLS
FT                   NLDAKLRNSVRSDITRLHRKLGTTMIYVTHDQVEAMTLGHRIVLLKDGVIQQIDTPMVL
FT                   YDHPANLFVAGFLGNPAMNMLSGRLEAVAGGMELHLVSGERVMFAGAIPKSVWFGRDVV
FT                   LGVRPEHIRPAGLGEPVALEATIEALEPVGNEVFLHLRCGALALILRVPPQELPGIGES
FT                   LPLAVQPDRLHVFDAVSGECLAGH"
FT   gene            complement(439249..440166)
FT                   /locus_tag="XfasM23_0340"
FT   CDS_pept        complement(439249..440166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0340"
FT                   /product="putative aminomethyl transferase"
FT                   /note="KEGG: xcv:XCV2239 putative aminomethyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91788"
FT                   /db_xref="GOA:B2I7Q7"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Q7"
FT                   /protein_id="ACB91788.1"
FT                   /translation="MRSIPIILFKPAAILFLSPVTDNLQSNGQTLFPLPSYEMLRISGA
FT                   DTLSFAHAQFSSDAQGLAIGKWHWSAWLTPKGRVTALFALYRPAENELLLILPDGEAVM
FT                   MATQLQRYIFRRKVQIAVERNLITTATYDTPVHATGTQAAQLDGITELDVSGITLPRRL
FT                   LLVPAAAMPPRVPAFEAQWRAADLRLGLPRLDASQRDQWTPQQIGLDGLNAYSIRKGCY
FT                   PGQEIVARTHFLGKAKRRAQLLAINTHVQPGETVKSAEGDIGQVASVAEGLALAVLPID
FT                   TEYGELRVAGTLATPLPFVAGLAR"
FT   gene            440367..440585
FT                   /locus_tag="XfasM23_0341"
FT   CDS_pept        440367..440585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0341"
FT                   /product="protein of unknown function DUF1674"
FT                   /note="PFAM: protein of unknown function DUF1674; KEGG:
FT                   xcv:XCV2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91789"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z1"
FT                   /protein_id="ACB91789.1"
FT                   /translation="MMSGSGLSEFQNFIGEKRMFSVCSAPEDSQEIAKNATADLKQRSN
FT                   LEEVGGRGGLDPVRYGDWEKDGRCIDF"
FT   gene            440643..441038
FT                   /locus_tag="XfasM23_0342"
FT   CDS_pept        440643..441038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0342"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: xcb:XC_1981 succinate dehydrogenase membrane
FT                   anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91790"
FT                   /db_xref="GOA:B2I7Z2"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z2"
FT                   /protein_id="ACB91790.1"
FT                   /translation="MATRERPLSPHLQVYRWQMQMVTSILHRATGVFLSLGVLVIAAGL
FT                   LALMFGPEPWDYFRSCLNLWYGQCFLLVWTWCFGYHLCNGIRHIAQDFGCGFAISSFLR
FT                   SSWASVLGSIVITAGVWGYVVVGRGTV"
FT   gene            441035..441418
FT                   /locus_tag="XfasM23_0343"
FT   CDS_pept        441035..441418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0343"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: xom:XOO_2187 succinate
FT                   dehydrogenase membrane anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91791"
FT                   /db_xref="GOA:B2I7Z3"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z3"
FT                   /protein_id="ACB91791.1"
FT                   /translation="MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFL
FT                   LTLLGVDYAAAVAAVAKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTM
FT                   VRFIAVLGAVASVFAVVRIALGN"
FT   gene            441426..443216
FT                   /locus_tag="XfasM23_0344"
FT   CDS_pept        441426..443216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0344"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: xcv:XCV2243 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91792"
FT                   /db_xref="GOA:B2I7Z4"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z4"
FT                   /protein_id="ACB91792.1"
FT                   /translation="MSAYTITEHKYDMVVVGAGGAGLRATFGLAHKGLQTVCLTKVFPT
FT                   RSHTVAAQGGISAALGNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAVIELEH
FT                   YGVPFSRTAQGKIYQRPFGGMTTRYGEGPRAERTCAAADRTGHAMLHTLYQQALAHDAR
FT                   FMIEYFALDLIFDSEGLCRGVLALDMAEGSLHLFRAHGVVLATGGYGRTYFSATSAHTC
FT                   TGDGGGLVMRAGLPMQDMEFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYA
FT                   PHYKDLASRDVVSRSMIIEIREGRGVGEHKDHILLDLTHLGPSMIQEKLPGIAESARIF
FT                   AGVDVTKQPIPVLPTVHYNMGGIPTNYHGEVVRKVGNDPDAVVPGLYAVGEAACVSVHG
FT                   ANRLGSNSLLDLVVFGRAVANRCSETIKPNQPHKVLPSDSCDKALGLLDKLRHADGSTP
FT                   TAVIRDTMQRTMQSDASVFRTSKTLQEGCEKMNEIFALFDDVKVSDRSLVWNSDLIETY
FT                   ELHNLLLNALATINSAEQRKESRGAHAHEDYPDRDDENWLKHTLVSVDEKGSCSFDYRP
FT                   VHMYTLSKDVDVIPPKPRVY"
FT   gene            443237..444022
FT                   /locus_tag="XfasM23_0345"
FT   CDS_pept        443237..444022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0345"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: xcb:XC_1985 succinate dehydrogenase
FT                   iron-sulfur subunit; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91793"
FT                   /db_xref="GOA:B2I7Z5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z5"
FT                   /protein_id="ACB91793.1"
FT                   /translation="MAEFTLPKNSKIGKGTHFPAKSGTKNARTFKVYRWNPDDDANPRT
FT                   DTYEIDLDTCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGTNTLACTKAI
FT                   SACTISEIPIYPLPHMNVIKDLIPDLTHFYAQYASIKPWIRTQTPPPPDRERLQSPVDR
FT                   KKLDGLYECILCACCSTSCPSYWWNGDRYLGPAILLQAYRWIIDSRDEDTGARLDDLED
FT                   PFKLYRCHTIMNCTRTCPKGLNPAQAIAEIKKLMMLRRA"
FT   gene            444143..444391
FT                   /locus_tag="XfasM23_0346"
FT   CDS_pept        444143..444391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0346"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   xac:XAC2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91794"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z6"
FT                   /protein_id="ACB91794.1"
FT                   /translation="MDKPAELNKLRWRSRRGMRELDHLFDRYLSHCWAQASEAERGVFL
FT                   RFLDCEDDKLWRWLMGYEVCQDASFAALIVTMRALPA"
FT   gene            444414..444794
FT                   /locus_tag="XfasM23_0347"
FT   CDS_pept        444414..444794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91795"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z7"
FT                   /protein_id="ACB91795.1"
FT                   /translation="MVALFALTLLACVALLRCDLNLTLRWSGVLLAACGGAWELRRVVC
FT                   HPCCVLLIPSGDEPPLFNQMPVKELHVSWYGPLVTVSWRVPDSCRMYLLFWPDTLSVAM
FT                   RRQLRLVMQARQLSSQVPSMAP"
FT   gene            444820..446061
FT                   /locus_tag="XfasM23_0348"
FT   CDS_pept        444820..446061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0348"
FT                   /product="lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family"
FT                   /note="TIGRFAM: lipoprotein releasing system, transmembrane
FT                   protein, LolC/E family; PFAM: protein of unknown function
FT                   DUF214; KEGG: xcv:XCV2248 ABC transporter-type
FT                   lipoprotein-releasing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91796"
FT                   /db_xref="GOA:B2I7Z8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z8"
FT                   /protein_id="ACB91796.1"
FT                   /translation="MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTL
FT                   AVMSGFQKEIRDRLLQMSAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALL
FT                   QGERHQPAMMRGIVPNQETKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGD
FT                   SVIVLLSQTQTTPVGTMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDGVTG
FT                   VRLKLHDMDHAWDVASDLAVRLNGPYLVSDWTRENANLYSSLKMEKTVMGILLSLIIAM
FT                   GAFNLVSSQVMLVTDKQADIAILRTLGLSPAGVMRVFMVQGSLIGIIGTLSGVIGGVVL
FT                   TWNLERILKLIESTFNITLLPEDVYYITGLPTDMQFPDVVVITLMALAMSFIATLYPAW
FT                   RAARIQPAEALRYE"
FT   sig_peptide     444820..444933
FT                   /locus_tag="XfasM23_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.271 at
FT                   residue 38"
FT   gene            446054..446776
FT                   /locus_tag="XfasM23_0349"
FT   CDS_pept        446054..446776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0349"
FT                   /product="lipoprotein releasing system, ATP-binding
FT                   protein"
FT                   /note="KEGG: xom:XOO_2181 ABC transporter ATP-binding
FT                   protein; TIGRFAM: lipoprotein releasing system, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91797"
FT                   /db_xref="GOA:B2I7Z9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I7Z9"
FT                   /protein_id="ACB91797.1"
FT                   /translation="MNERSTPQALTGPVIRAESLGKTYSEGKLLTQVFDGLDLQVMRGE
FT                   TVAIVGASGAGKSTLLHLLGGLDVPTAGEVYVAGQRMSALSDGDRGRLRNKTLGFIYQF
FT                   HHLLPEFTALENVMMPVLLSGQSVCSAKMRAQMLLEAVELGHRLNHKPSELSGGERQRA
FT                   AVARALANSPDCVLGDEPTGNLDNRTASTVFELMLELNRAQRTSLVLVTHDRGLARCLD
FT                   RVLELYQGGLRELTSAEV"
FT   gene            447124..449592
FT                   /locus_tag="XfasM23_0350"
FT   CDS_pept        447124..449592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0350"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="TIGRFAM: DNA internalization-related competence
FT                   protein ComEC/Rec2; PFAM: beta-lactamase domain protein;
FT                   ComEC/Rec2-related protein; KEGG: xcb:XC_1992 DNA
FT                   uptake/competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91798"
FT                   /db_xref="GOA:B2I800"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2I800"
FT                   /protein_id="ACB91798.1"
FT                   /translation="MDDMKPEQRHMLQRCWVDVLSVIRHAACLRYLAFPALLPSAVALL
FT                   LGCLAALTLPRLPPVWVLWIFLFVGVMLAVVVRRVAWCGVVLFGFANCCLHGQFGLRHQ
FT                   LSFALEGRDLVLRGRIVSLPVPETRRTRFLLRVDTDQDQEPALRGRLLQLSWYDENKAV
FT                   VPGPRSALHAGSVWQLHVRLRAPHSLMNPGGFDSERYALAQGIVATGYVRMPTMARELA
FT                   AATGINAWRERMSARIADAVLLEASVYLRALALGDTRGLSQQDWEVLRATGLTHLIAIS
FT                   GFHVGMVAGACALLVSLLWRDLAWRWPRPIAMALIAVPAAAGYTVLAGASLPTVRTALM
FT                   IGIVALARLTRRRAMPGHVLGLALLVVLVWDPLAILSAGFWLSFAGVAWLMWCMQDGHA
FT                   ASCRGFLSAQGVATLGLLPFTVALFGQVSFVGPLANLIAIPLWTFVVVPLALLGTALEA
FT                   LVPGWGSPMWRLGGNFFQWSWQLFEYLAQTDFALWWLPESDGVALGLALLGAFWLLLPR
FT                   GTPGKWLALLLWLPLLWPERERPRPGEFEMQMLDVGQGLSIVVRTSGHTLLYDAGPAVN
FT                   DGFDAGERVVVPALRASGIRRLDALVASHADSDHVGGLPAVLKAYPVDISYAPPDAPLD
FT                   VERRCSAGDSWLWDGVQFRFLHPAPHSRYLGNESSCVLRIDTRWGSALLTGDIGKVVER
FT                   GLLSQDRESVRADVVVVPHHGSAGSSSLGFVRAVNARLALVSSGDGNRFGHPRCSVVES
FT                   WSETADVLLTAHSGAVRIWVGQQGLQLRERRVWRRRFWDAVERRRSAAILSATEDVSKE
FT                   RRRNETCWNW"
FT   gene            449577..450239
FT                   /locus_tag="XfasM23_0351"
FT   CDS_pept        449577..450239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0351"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   xcb:XC_1993 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91799"
FT                   /db_xref="GOA:B2I801"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B2I801"
FT                   /protein_id="ACB91799.1"
FT                   /translation="MLELVKAGGWPMLPLLMLGVVALAIVLERLWTLRRNEVLPSGLGR
FT                   EVREWVRRGKLDQNHLESLRRNSPLGALLAAALDVKGGVREMIRERIEDTGRHLVHRME
FT                   RFLNALGTIASAGPLLGLLGTVVGMIQMFLGILDYGVGDVNQLAGGIGKALVCTATGMI
FT                   IAIPALIFHRYFKGRITGYVIEMEQEAMLLLDAIDGLQIAIQGRNAEVAHPNAVTKD"
FT   gene            450244..450681
FT                   /locus_tag="XfasM23_0352"
FT   CDS_pept        450244..450681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0352"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xom:XOO_2176 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91800"
FT                   /db_xref="GOA:B2I802"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2I802"
FT                   /protein_id="ACB91800.1"
FT                   /translation="MRIGNQRLEDEPHIDLVPLIDVILVLIIFFVVTTTFDARSTLQLQ
FT                   LPNASDQHKSVPSKALSILVNADGHYFINDHEVLRTDVESLKRSIADVAGDDREQTVLL
FT                   RADARTPYQAVVTVQDALGQLGFRHIAIATAPDANKVGTAR"
FT   gene            450699..452447
FT                   /locus_tag="XfasM23_0353"
FT   CDS_pept        450699..452447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0353"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: xcv:XCV2254 lipid A export
FT                   ATP-binding/permease protein; TIGRFAM: lipid A ABC
FT                   exporter, fused ATPase and inner membrane subunits MsbA;
FT                   PFAM: ABC transporter transmembrane region; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91801"
FT                   /db_xref="GOA:B2I803"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2I803"
FT                   /protein_id="ACB91801.1"
FT                   /translation="MRYATPWRTYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALM
FT                   KPITNETFIERNREVALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTK
FT                   YFRLPGSRFDGEPVASMLVRLGSDSEQVAHAVIDAMKVMVQQTLQVIGALVVMLWYSWT
FT                   VTLAILLVAPLLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAAQES
FT                   ELERYARLANINLGLAVKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRLSPGDF
FT                   VSLMTSMIAVIPALKQLTNVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGRARGLIE
FT                   FRGITARYPGRSAPVLDSVSFVAAPGTVTAIVGRSGSGKSSLIKLIPRFYEPESGQILL
FT                   DGHPLQDYLLADLRRQIALVGQQVMLFDGSIADNIAYGEMRQVVSEEIERVVVDANAQD
FT                   FVNQLPEGLQFQVGVKGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQ
FT                   DALQRLMPERTTLVIAHRLSTIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQ
FT                   FRERPT"
FT   gene            452444..453463
FT                   /locus_tag="XfasM23_0354"
FT   CDS_pept        452444..453463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0354"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: xac:XAC2088 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91802"
FT                   /db_xref="GOA:B2I804"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I804"
FT                   /protein_id="ACB91802.1"
FT                   /translation="MSSGRGSRIPEYWYGQVPVPPFMRFMEVIYAGAVSLRRLAYRRGW
FT                   RRRYGVAVPVVVIGNLVAGGTGKTPLTIEIVARLREAGWTPGIASRGYGRRDPKTPRWI
FT                   QPDTPIELAGDEPAMIAWKTGMRVRVDVDRSAAARALVAEGCDIVVCDDGLQHYRLMRD
FT                   IEIEVIDGQRRYGNGHLLPAGPLREPMVRGRLCDFRVLNAGQYSDRPTSGFGPSDWQMR
FT                   LHIDHAQSLQGSRRRSLDAFSGQRVHAVAGIAHPERFFSMLRQRGIGVVPHAFPDHHFY
FT                   RAEDFTFGSRLPVLMTEKDAVKCRAFADDWFFSVPLRVELPTVFWTALFDRLERLVSC"
FT   gene            complement(453870..454559)
FT                   /locus_tag="XfasM23_0355"
FT   CDS_pept        complement(453870..454559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0355"
FT                   /product="late control D family protein"
FT                   /note="PFAM: late control D family protein; KEGG:
FT                   sit:TM1040_1278 phage late control D"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91803"
FT                   /db_xref="UniProtKB/TrEMBL:B2I805"
FT                   /protein_id="ACB91803.1"
FT                   /translation="MAAEHGMTWAISPSLTGVALPHIDQTEESDINVLLRLAQRYDAIA
FT                   KPAGGRLIFAKRGEAKSVTGIDMPRITLTPDEIASWQMTYATRDSPGTVIAFYRLARRA
FT                   ELHQVSVGDGHPVHRIKQYLPDAAAAIAAARGELSRRARAETKLTLEMAGRAELSAEAV
FT                   LTLNGWREGVNGDWLVTRVQHGLDKNGYRCSIEAERPNNHPDVAAAINTQVRDQVVRPS
FT                   RTHHQKT"
FT   gene            complement(454489..455460)
FT                   /locus_tag="XfasM23_0356"
FT   CDS_pept        complement(454489..455460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xoo:XOO1698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91804"
FT                   /db_xref="UniProtKB/TrEMBL:B2I806"
FT                   /protein_id="ACB91804.1"
FT                   /translation="MTPLQITITPQGRAALVNAQHHGTVPVRLASVGLTAQHFDPTAAT
FT                   MPDESKRLTTFSGGVVAADTIHITIRDATSDQYDVRGFGVYLDDGTLFATYSQQDIILS
FT                   KSASAMLLLAIDVRFVDTDATQLTFGETSWNNPPATQTVAGVLTLSSNAQAIAGLEDRS
FT                   AIPPTALKATLDHRLGEAAPSDYAKTLLASADAPTLRHLLGLGDAAVMDTGSGKNLDAD
FT                   LLDGYHGTYYLQWRNLQNTPQTYPPSAHQHASSDIPELASQLDTLVKKTGSLMTGSLQS
FT                   QGTLIGDSHRNHTRCHAIHNGCRTWHDLGDLPVAHRRRATPH"
FT   gene            complement(455468..455977)
FT                   /locus_tag="XfasM23_0357"
FT   CDS_pept        complement(455468..455977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0357"
FT                   /product="phage tail protein I"
FT                   /note="TIGRFAM: phage tail protein I; PFAM: tail protein I;
FT                   KEGG: xac:XAC2656 phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91805"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B2I807"
FT                   /protein_id="ACB91805.1"
FT                   /translation="MRTLEQVMARMADIPIPFKQLWDPHTCPEPLLPWLAWSLSVDTWR
FT                   STWPVHIKRARIAAAIEIQRCKGSVKSVRDVVRSFGGDVLITEWWQQNPPAAPHTFTLL
FT                   LTLSGQGGSQSTAEFVADVITEVIRTKPVRSHFTFTQGVHTIGQIGLLGGAQITAYRRL
FT                   HLTQAA"
FT   gene            complement(456018..456911)
FT                   /locus_tag="XfasM23_0358"
FT   CDS_pept        complement(456018..456911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0358"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG: xac:XAC2655
FT                   phage-related baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91806"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5E4"
FT                   /protein_id="ACB91806.1"
FT                   /translation="MDNTLTAIDISKLPMPDVIRQVAADVILQEMLADLAARDPTLKNL
FT                   LPSDPIYTLLEVAAYREAVRRYQSNEDAKAVMVALASDADLDHLAALFRVKRLVLEAGD
FT                   PTQGIPPRMESDAAFRRRIVLAPEGYSVAGPEGAYIYHAISAHPDVLDVSATSPTPGDV
FT                   IITVLSRSANGQPSQDVLDAVMAAVNQESVRPMTDHVTVQPAQITDYQVHARLHTYAGP
FT                   DAAVVLSEAHRRITAYTTDTFRLGRDIALSGLYAGLHVEGIQRVELITPQQGLTMDRTQ
FT                   AARCTNITVVHGGVDE"
FT   gene            complement(456911..457249)
FT                   /locus_tag="XfasM23_0359"
FT   CDS_pept        complement(456911..457249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0359"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein; KEGG:
FT                   syf:Synpcc7942_0739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91807"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5E5"
FT                   /protein_id="ACB91807.1"
FT                   /translation="MRGMNMHTGKPLDGIDHLRQSVQNILSTPLGSRIMRRDYGSRLPH
FT                   LLDAPITRALTMDLYAATAQALAAHEPRITLRQVTARATASGTVTLVLTAHYLPEGKTV
FT                   TLDGIQVR"
FT   gene            457447..457728
FT                   /locus_tag="XfasM23_0360"
FT   CDS_pept        457447..457728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0360"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   plu:plu0866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91808"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2I810"
FT                   /protein_id="ACB91808.1"
FT                   /translation="MIKSFRHKGIQQFFLKGSTAGIQTKHAAKLRIQLTALESAKRPED
FT                   MNAPGWKLHPLKGADLKGHWSIWVNGNYRLTFAFEGEDAILVDYQDYH"
FT   gene            457739..458014
FT                   /locus_tag="XfasM23_0361"
FT   CDS_pept        457739..458014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0361"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="TIGRFAM: addiction module antidote protein, HigA
FT                   family; PFAM: helix-turn-helix domain protein; KEGG:
FT                   csa:Csal_2342 plasmid maintenance system antidote protein,
FT                   XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91809"
FT                   /db_xref="GOA:B2I811"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:B2I811"
FT                   /protein_id="ACB91809.1"
FT                   /translation="MKRMHNPAHPGEVLREYLGELTVTNAAAKLGVSRVALSRILNGTN
FT                   GISADMALRLEDALGTSAEMWAAMQFKYDLWVASQQPRPKITRLHV"
FT   gene            458102..458404
FT                   /locus_tag="XfasM23_0362"
FT   CDS_pept        458102..458404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91810"
FT                   /db_xref="GOA:B2I812"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:B2I812"
FT                   /protein_id="ACB91810.1"
FT                   /translation="MEKGTSHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCT
FT                   VVLALTSADFYKSMTTYADHTVFQDVYHAKTASGDEVYLKLTVIDDVLIVSFKEL"
FT   gene            458407..458808
FT                   /locus_tag="XfasM23_0363"
FT   CDS_pept        458407..458808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0363"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   pol:Bpro_5547 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91811"
FT                   /db_xref="GOA:B2I813"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:B2I813"
FT                   /protein_id="ACB91811.1"
FT                   /translation="MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVL
FT                   DREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRKLDLDQRQAAELFGGGVNAFSRYEN
FT                   GKTKPPLSLVKLFKLLDRHPDLLNEVKSS"
FT   gene            complement(458877..459464)
FT                   /locus_tag="XfasM23_0364"
FT   CDS_pept        complement(458877..459464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0364"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; PFAM:
FT                   baseplate assembly protein V; KEGG: pna:Pnap_3300 phage
FT                   baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91812"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="InterPro:IPR040629"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5E8"
FT                   /protein_id="ACB91812.1"
FT                   /translation="MRQTLNEHTRQLAHLILQGTVAELDPATACVRIEAGELLTDWLPV
FT                   MASRAGADRSWWLPHLGEQVIALCPNGDSALGIVLPGSLYQETFPAPSNTAHQPCLLFG
FT                   DGTRITYDRQAHALTVDASAASGTVTLICATATLNASDRLTLDTPSLHLTGNLTVDGTI
FT                   HAQGDITAADIGLQRHHHTAQGPNAPTTPAQG"
FT   gene            complement(459461..460003)
FT                   /locus_tag="XfasM23_0365"
FT   CDS_pept        complement(459461..460003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91813"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5E9"
FT                   /protein_id="ACB91813.1"
FT                   /translation="MADTHTDISLETLHTAIRDQIAAHFPDLATVAFYQDDEDHQLPMP
FT                   ACLLTLSEIEPAPENDAGTGQFPALLRFQARLVLGHRGPSTHLQARLAAAALGTWLYQR
FT                   RWRGVPTDPCRVIAIYPDEFNAALDRYVVWTVEWQQPVFLGNSAWTHAGTLPTNLWLSF
FT                   TPQTGPSVQDSYHQIAP"
FT   gene            complement(459979..460500)
FT                   /locus_tag="XfasM23_0366"
FT   CDS_pept        complement(459979..460500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1296 prophage LambdaW5, minor tail
FT                   protein Z, putative"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91814"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5F0"
FT                   /protein_id="ACB91814.1"
FT                   /translation="MIGIHIHPHSLTAIAQALNATETQMEQALRSAKIKMAAWLRTRSV
FT                   RGLSDALQLQQKIVRRRLRTYRQRDQMKVWYGLNPVPLLWLNPKATPSGVSALGGRQIK
FT                   GAFIATVRGKRQVLKRLGRARYPVAVQKADIYAPSMTYIENGLLDTATFEARFYTLFEH
FT                   ELQWRTHTPT"
FT   gene            complement(460497..460820)
FT                   /locus_tag="XfasM23_0367"
FT   CDS_pept        complement(460497..460820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91815"
FT                   /db_xref="UniProtKB/TrEMBL:B2I817"
FT                   /protein_id="ACB91815.1"
FT                   /translation="MHHPSWDDLDAFLETDDFAVTAQLHSEKTGRVHQCTIVFDATYID
FT                   ADIGDYRMNAPEPSFTCKESDVMDFKKHDYARIEDRHYRLTHDPQPDGTGMALVRLAPM
FT                   APP"
FT   gene            complement(460820..461080)
FT                   /locus_tag="XfasM23_0368"
FT   CDS_pept        complement(460820..461080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91816"
FT                   /db_xref="UniProtKB/TrEMBL:B2I818"
FT                   /protein_id="ACB91816.1"
FT                   /translation="MPTTTNTLKISAAVVIQGLIYRPGTIVQIPTALAHDLMRRGRAEL
FT                   AGDADGPVAVIIDPPSGGAPTPNTLTPTETNEKPAPRGSRR"
FT   gene            complement(461098..462972)
FT                   /locus_tag="XfasM23_0369"
FT   CDS_pept        complement(461098..462972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0369"
FT                   /product="peptidase U35 phage prohead HK97"
FT                   /note="PFAM: peptidase U35 phage prohead HK97; KEGG:
FT                   sit:TM1040_1299 peptidase U35, phage prohead HK97"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91817"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B2I819"
FT                   /protein_id="ACB91817.1"
FT                   /translation="MTTATEVVRDLRKGGTQYRHADVLSIDAPARTLELAFSSEAAEVQ
FT                   TRSGVEILGHRINEVRMHRLDNGAALLLDHNPREHIGVVESASIDSDHRGRAIVRFGRS
FT                   PRAEEILRDVLDGIRKHVSVGYLVHQVEVIGQRDAGPLYRATDWEPIEISIVSIPADPS
FT                   VGIGRALENLPQDTATVSQHTPSTPEDQTMTEPSPPAHADTTNTPQPTSNATDTPNSVD
FT                   AERTRVRHIADLGKTYGHLELAHDYITQGHSPEAFQRALLTKLTDKAPMPQSEPHTETG
FT                   IGLSTQEIRHYSIVRAVRALLPNASQTDRNAAAFEIACSAAAEKTYGKQARGLLIPSDV
FT                   LNRAFSTTTPTDGPGSNIIATELHASSFIEILRNKTWVMQRATVMGGLVGNVDIPRQKG
FT                   TTQAYWVGEGDSPEKSKPALDQIHFTPKSLAAYTDITRRLLLQSTPDAEQIVRSDLLNV
FT                   MALEVDRAAIYGSGSDMQPTGVKHHSGINAVSFAQKGQPTFAELVQMETQIALNNADVN
FT                   AMSYAFNAGIRGYAKTALKFPQTAASGTIWESGNTVNGYPASVSNQIKAGDVFFGNWAD
FT                   LIIAMWGGLDITVDPYSLSTSGGTRIVVFQDVDFNIRRTESFCYGAAA"
FT   gene            complement(462969..463601)
FT                   /locus_tag="XfasM23_0370"
FT   CDS_pept        complement(462969..463601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0370"
FT                   /product="putative phage related protein"
FT                   /note="KEGG: nmc:NMC0857 putative phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91818"
FT                   /db_xref="GOA:B2I820"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B2I820"
FT                   /protein_id="ACB91818.1"
FT                   /translation="MNAGPLAIHELPQGAEFQDWNPQYPSGEFGLFTKAAKQSLAAGMD
FT                   LSYHALSGDLADVNYSSIRQGTLDERERWKEDQQFFIESLHTPVFEAALKVALLSGQIR
FT                   VHGKPLPAEHYDRYRRVSWQGRRWAWVDPRTDVESALTCIRGGLTSTSQVILEQGRDPQ
FT                   DVFREIAQDLKEMQASGIPNDYLKYLLYGADLTTANTTPTQKEPTPP"
FT   gene            463652..464116
FT                   /locus_tag="XfasM23_0371"
FT   CDS_pept        463652..464116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0371"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: dac:Daci_3411 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91819"
FT                   /db_xref="GOA:B2I821"
FT                   /db_xref="UniProtKB/TrEMBL:B2I821"
FT                   /protein_id="ACB91819.1"
FT                   /translation="MQCAVTDAIGHPETAHTCCGITVQYSRAWLRLRLPSGRVLYYAAP
FT                   RVDEHGALSYMGTHPVTRKWTRITTYGGKLVENITQAVSRDVLAACMPAIEAAGYAIVL
FT                   TVHDEIITEADDNAAFNAAHLAALMATPPPWAQGLPLAAEGFETHRYRKQ"
FT   gene            464113..464391
FT                   /locus_tag="XfasM23_0372"
FT   CDS_pept        464113..464391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0372"
FT                   /product="VRR-NUC domain protein"
FT                   /note="PFAM: VRR-NUC domain protein; KEGG: drm:Dred_1197
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91820"
FT                   /db_xref="GOA:B2I822"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:B2I822"
FT                   /protein_id="ACB91820.1"
FT                   /translation="MMTIPRERTIERYLVAQVRAKGGEIRKVKWEGRHGAPDRIAMLPN
FT                   GRTLWVELKAPGQQCTPHQVREHERMRGMGQRVVVVDSLKGVDEVLA"
FT   gene            complement(464393..464701)
FT                   /locus_tag="XfasM23_0373"
FT   CDS_pept        complement(464393..464701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91821"
FT                   /db_xref="GOA:B2I823"
FT                   /db_xref="UniProtKB/TrEMBL:B2I823"
FT                   /protein_id="ACB91821.1"
FT                   /translation="MTSVAFDTLKFANRLKTAGVPAAHAEAEAEALAEVLEINLKGLAE
FT                   SESKNGKALARLEADMKEGFAQVNTRFAEIKGEMLLLKWMLGVLVAGVAALIIKAFF"
FT   gene            464786..466204
FT                   /locus_tag="XfasM23_0374"
FT   CDS_pept        464786..466204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0374"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; SMART: DEAD-like
FT                   helicases; KEGG: sdy:SDY_2798 hypothetical bacteriophage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91822"
FT                   /db_xref="GOA:B2I5P9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B2I5P9"
FT                   /protein_id="ACB91822.1"
FT                   /translation="MNLRPYQHTIVDFILTHPRCNLFVPMGLGKTVATLTALDVLLVVE
FT                   DIAPILVIAPLRVAATTWPDEVAKFPHLRHLRVSVVVGSAAARRHALEQEADIYCINYD
FT                   TLKWLVEFYKDRWPFRMVVADECSKLKGFRLRQGTRRARALATHVHTKVERYVGLTGTP
FT                   APNGLQDLWALMWMVDRGARLGTHFKAFIDRWFRAMQIGSDPHAVRFAPTPHASQEIQD
FT                   KIRDLCLSLDPQAYFDLRQPIVNTIRVALPAHAQRLYKAMEQDMFIALECGAEVEAFNA
FT                   ASKTIKCLQLANGALYTDDTRQAWEVVHDAKLEALHDIIEEAAGMPVLVAYHFKSDVAR
FT                   LQRAFPKGRALDKHPDTIRDWNAGNIPVLFAHPASAGHGLNLQDGGNILAFFGHWWDLE
FT                   QYQQIIERIGPTRQAQAGHTRPVFIHHIVAAGTVDELVMARRESKREVQDLLLEAVKRR
FT                   ETGKPLTSQGAMTR"
FT   gene            466201..466455
FT                   /locus_tag="XfasM23_0375"
FT   CDS_pept        466201..466455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91823"
FT                   /db_xref="InterPro:IPR025319"
FT                   /db_xref="UniProtKB/TrEMBL:B2I825"
FT                   /protein_id="ACB91823.1"
FT                   /translation="MSAPSKQTCGMPPAAGLCLSRSEVAELCGTPQRARQAAFLRKNGI
FT                   RHYLDAHDWPVVLRAAIDAMPPSAVVRPVWKSNKVAYGT"
FT   gene            466445..467464
FT                   /locus_tag="XfasM23_0376"
FT   CDS_pept        466445..467464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0376"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: net:Neut_1498
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91824"
FT                   /db_xref="GOA:B2I826"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2I826"
FT                   /protein_id="ACB91824.1"
FT                   /translation="MGRKPIKAGAIPRFRVRPQKSGVVYYYYDHGGKPRKETPLGRDYG
FT                   LAIKRWAELEHAQITPAIAVTFRHVAERYRAEVIPTKAYNTQRMHHVYLNYLLQFFDDP
FT                   PAPFESIKPVNIRQYLDWRPFKVSANREVALFSHLWNWARSKGITDLPNPCGGIRRNKE
FT                   RGRDVYIDDTTYRAVYQAADQTLRDAMDLAYLTGQRVSDVVSMDERHIVNGALEICQAK
FT                   TGVKLAIAITGELAVLIKRIFDRKRGMKLRSTRLIVDEKGLGLNWKKLAYRFRKVRAAA
FT                   GIAKEVFQFRDLRAKAATDKADLAGDMRQAQAQLGHASVTMTEHYVRKRKGAKVTPTR"
FT   gene            468237..468878
FT                   /locus_tag="XfasM23_0377"
FT   CDS_pept        468237..468878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0377"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   xcb:XC_0183 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91825"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I827"
FT                   /protein_id="ACB91825.1"
FT                   /translation="MKTFVVAGSKGGVGKTTIATNLAAQAALRGVRTVLADADPQKSST
FT                   RWTERRADLDSQVLSINANAANGSHRWRNDLPANTDLLIVDAPAGMFADDLEGFLEHAD
FT                   AVIVPVMASALDIEAVVGFLNTMAKVPRVHQRKLPVGLVLNRARSRTQTTQQAMQMLGD
FT                   WPYLLVAQLRDSQFYVVLAGQGRSVFDYRSAQAREHQQDWKPLLQWLHKL"
FT   gene            468906..469382
FT                   /locus_tag="XfasM23_0378"
FT   CDS_pept        468906..469382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0378"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: xcb:XC_0184
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91826"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2I828"
FT                   /protein_id="ACB91826.1"
FT                   /translation="MRELILLRHAHAEPTGIGQTDFDRSLSQQGMIEAEAAGHWLCKQH
FT                   LIPDRVLCSPARRTRETLEAIVAVLGDVEQRLEERLYEATVGTLMALADECRDVDRLLL
FT                   VGHNPSMERLVSLIHSNKTSDDVGMSTGSIALLTLPLKTGIELDTICLTALWWP"
FT   gene            469387..469959
FT                   /locus_tag="XfasM23_0379"
FT   CDS_pept        469387..469959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0379"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xcb:XC_0185
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91827"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B2I829"
FT                   /protein_id="ACB91827.1"
FT                   /translation="MSAMVWISILFSVLPVSWATAQQRLTLDSVHSYFEFEVRTRLGQS
FT                   IDGVFPRLEGEVVILPEGREKVRLHLYAGDALIPGRTHYTDWVRGEHFFDVQHYPTIEF
FT                   ESQPYSSRVILQGGKISGSLTIRGISRDETLQIQPAACARPGYDCDLVGTGVVLRERYG
FT                   IDGWRLILGNRVTFRWHGRLIEGPPSH"
FT   sig_peptide     469387..469446
FT                   /locus_tag="XfasM23_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.563 at
FT                   residue 20"
FT   gene            469956..471914
FT                   /locus_tag="XfasM23_0380"
FT   CDS_pept        469956..471914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0380"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   xcb:XC_0186 cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91828"
FT                   /db_xref="GOA:B2I830"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2I830"
FT                   /protein_id="ACB91828.1"
FT                   /translation="MNIFIRLLLLAAVLLGSGCASLSHAQLDYAASVAVAARPATLDCD
FT                   RPNRCALDSPLYALGSRALSESTPVTPLHYVTILDKGESALVARINLIRSATRSIDMQT
FT                   YIFDKDDSARLIMDELLTAARRGVRVRLLIDQLSAISDLNILGALAGAHVNFQLRIYNP
FT                   IFGKAKLNYGDYVASVLCCFRRFNQRMHNKLLVIDEMIGVVGGRNYQDDYYDWDLEYNF
FT                   RDRDVLVAGPAVLQMAVNFDAFWAAERSVPVERLRDVGRMVLQDGVPMLPSAVFNLLER
FT                   VQRVTAEANDPDYVKRTFVDAALAVNKVQYVADLPQKHRYEHNANPVSIGPRLDSLISN
FT                   ARHEVILQTPYLVLSKPALNIFRRLNRTQDKPRVVVVTNSLAATDNPIVYALFYKYKRR
FT                   NMRDLGFDIYEYKPFPENPPIDLTGVVPIEGWNNDSLQRRQDLLAAAKVSDDSDNARQL
FT                   PQLENKGQVDRRVLRTETRPPFWRIHTVNKPLPVTRPGARMGLHAKSLVVDRKVGVIGT
FT                   HNFDPRSESYNTEAVVVIEDPAFAGLLASSIEGDIAPGNAWVVAPRKKLPGLYKLNYSV
FT                   GKLSEALPVLDLWPWRYATNYEFKPGLDCPIPLPRRDPNFMQCYEPVGDFPEVNVGPKW
FT                   LLVRMLIAFGAGLVPIL"
FT   sig_peptide     469956..470033
FT                   /locus_tag="XfasM23_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(472847..473236)
FT                   /locus_tag="XfasM23_0381"
FT   CDS_pept        complement(472847..473236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91829"
FT                   /db_xref="GOA:B2I831"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2I831"
FT                   /protein_id="ACB91829.1"
FT                   /translation="MPTKKKDSYAIAVGERLAAARKAVVPAMTQSKAAELLSKSLGKHI
FT                   TAATISGYESGHRLPHVFLVNALCSIYGTLTPAYVFHFDNAAETMQESNLLKYFRSADA
FT                   RDKRNITNLALHALNGLYPKSTDSE"
FT   gene            473559..473924
FT                   /locus_tag="XfasM23_0382"
FT   CDS_pept        473559..473924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbr:Tb09.160.5290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91830"
FT                   /db_xref="GOA:B2I832"
FT                   /db_xref="UniProtKB/TrEMBL:B2I832"
FT                   /protein_id="ACB91830.1"
FT                   /translation="MWRADGTIKAYDNAKFFSIEQRPLNNLHDVVTLLSQLEHDPCACV
FT                   PVCLCACVPVCLCACVPVCLRDAEMRSRRHMIRTAIRSVITTAVHCVETPANESQERID
FT                   TLFCLVTNRVGGIGYFL"
FT   gene            complement(474539..475024)
FT                   /locus_tag="XfasM23_0383"
FT   CDS_pept        complement(474539..475024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0383"
FT                   /product="asparaginase"
FT                   /note="KEGG: xcv:XCV0963 asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91831"
FT                   /db_xref="GOA:B2I833"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:B2I833"
FT                   /protein_id="ACB91831.1"
FT                   /translation="MEDLLIVTTGGTIDKIYFDEKSHYQVGDPQITQILEALGIAFRFN
FT                   VIPIMRKDSLHMVEADRELIHNTITAHSCQHVLITHGTDSMVETGKRLQSIQNKTIVIT
FT                   GALNPARFHGSDAHFNIGCAIGALQSLSSGVYIAMNGRIWHPDKVRKNIIKNCFETI"
FT   gene            complement(475267..475866)
FT                   /locus_tag="XfasM23_0384"
FT   CDS_pept        complement(475267..475866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0384"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: NADPH-dependent
FT                   FMN reductase; flavodoxin/nitric oxide synthase; KEGG:
FT                   xcb:XC_3371 tryptophan repressor binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91832"
FT                   /db_xref="GOA:B2I834"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2I834"
FT                   /protein_id="ACB91832.1"
FT                   /translation="MTDILVLYYSHSGSVARLARQIARGIAEVPGMAARLRTVPPVTAV
FT                   TQALAPVVPEDGAPYVLPTDLTECAGLLLGSPTHFGNMAAPVKYFLDSLGTDWANGTLV
FT                   GKPAGVFTSTGSMHGGQEATLLSMHLPLLHHGCLIVGIPFTERALSHTRSGGTPYGASH
FT                   VANATNDTQPTDEETLLARALGRRVADLAQRLTQQR"
FT   gene            476441..477625
FT                   /locus_tag="XfasM23_0385"
FT   CDS_pept        476441..477625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0385"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="KEGG: xac:XAC3521 nicotinate
FT                   phosphoribosyltransferase; TIGRFAM: nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91833"
FT                   /db_xref="GOA:B2I835"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:B2I835"
FT                   /protein_id="ACB91833.1"
FT                   /translation="MEFIIKSLLDTDLYKFTMMQAVLHQYPGAQVEYRFKCRTPGVDLA
FT                   RFINEISHEIDGLCGLCFSKEELDYLRGLRFMKPDFVDFLGLFHLDRKYLQLRASSQVP
FT                   GEIELDIRGPWLHTILFEVPLLAIINEVWFRNTSVLNLDVGRDRLDAKVRLLKDESGYE
FT                   ECSIADYGTRRRYSRQWHAELLPLLAQGLGSNFVGTSNVYFAKQYGYTPLGTMAHEYLQ
FT                   AFQALGPRLRDSQVAGLEAWAREYRGDLGIALSDVVGLDAFLGDFDLYFCKLFDGMRHD
FT                   SGDPFKWGERIIMHLESHRIDPRTKVLVFSDGLDMNKVMRLYQHFRGRCRLAFGVGTSL
FT                   TNDLGPTPLQIVIKMVRCNGQPVAKLSDSPGKSMCDDPGYLHYLRQVFGVSADV"
FT   gene            complement(477813..478388)
FT                   /locus_tag="XfasM23_0386"
FT   CDS_pept        complement(477813..478388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91834"
FT                   /db_xref="GOA:B2I836"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2I836"
FT                   /protein_id="ACB91834.1"
FT                   /translation="MNTRIFLARIISILGHPGVLGSFAIATKLSNTPTSTHVKTVVIST
FT                   MLLVTVLGLAYSVWQVQRGYWSHIDASKPNERAQLLPILLLLLGIATLSLWALDMPKQV
FT                   VSGPIAGIALVLAAHSVRHWMKPSLHVGFGILATGLNNTLPVDVSLLAATALVGWSRLA
FT                   LGRHTRREVAVGAALGAATAALFRSMSE"
FT   gene            478784..478909
FT                   /locus_tag="XfasM23_0387"
FT   CDS_pept        478784..478909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91835"
FT                   /db_xref="UniProtKB/TrEMBL:B2I837"
FT                   /protein_id="ACB91835.1"
FT                   /translation="MMFFNGMRLDVLLIGLPKVACAKSTFYLDEWRLLRLFYSIF"
FT   gene            479255..479464
FT                   /locus_tag="XfasM23_0388"
FT   CDS_pept        479255..479464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91836"
FT                   /db_xref="GOA:B2I838"
FT                   /db_xref="UniProtKB/TrEMBL:B2I838"
FT                   /protein_id="ACB91836.1"
FT                   /translation="MFGIGLYVVSVYIFTFSMSFMMRWLFYAKSLYVCESKDLNMQLQS
FT                   NIFGDVPCVQRIVIVVLMYKGNVS"
FT   gene            complement(479742..480035)
FT                   /locus_tag="XfasM23_0389"
FT   CDS_pept        complement(479742..480035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_4005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91837"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:B2I839"
FT                   /protein_id="ACB91837.1"
FT                   /translation="MKHAPLILLSLLIFSGCSTKGDIHADAPLKLHGAVITTKIMGNGD
FT                   RVDEFRVSGQLRMVKITPKHAPAYYLYDRNGDGHLDGDRNIVSPVYWNIYSW"
FT   sig_peptide     complement(479973..480035)
FT                   /locus_tag="XfasM23_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.703 at
FT                   residue 21"
FT   gene            480120..482891
FT                   /locus_tag="XfasM23_0390"
FT   CDS_pept        480120..482891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0390"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xcb:XC_4109 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91838"
FT                   /db_xref="GOA:B2I840"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2I840"
FT                   /protein_id="ACB91838.1"
FT                   /translation="MSKLVLIDGSSYLYRAFHALPPLSNAAGEPTGALFGVVNMLRTTL
FT                   KERPDYAAFVIDAPGKTFRDALDSEYKMHRPPMPDDLRMQVEPMRGIVHALGIDILCID
FT                   GVEADDVIGTLALAAVADGIAVTISTGDKDFAQLVRPGVELVNTMTGSRMDSAMAVINK
FT                   FGVAPDQIIDFLALMGDSVDNVPGVDKCGPKTAAKWLAEYGSLDAVIANADKIKGKIGD
FT                   NLRVVLPRLLLNRALITIKTDVVLEKRPQDLALRERDTEALRDFYQRYGFTQALKELDG
FT                   GSVAVTVAEQEPGRGRNAGFHVAPDASVAMEINPALSASGEYETIFTIEQLQDWIVRLR
FT                   VAGQFALDTETDSLDPMQAVLIGLSFASEVGCAAYLPFGHDYPGAPVQLDRGQALALLQ
FT                   PLLEDAAVRKVGQHGKYDMHVLRRYGIVLAGYADDTLLESFVLTSGHARHDMDTLARRH
FT                   LGYETMKYVDLVGKGAKQIPFSHVGVQEATQYAAEDADITLRLHCVLAPKLLAEPRLER
FT                   VYREIEMPLVAVLERIEANGVQIDAEELYKQSADLSRRMVIAQQKAMDLAGRHFNLDSP
FT                   KQLQVLLFDELKLPVVVKTPKGQPSTNEEALEAIVDQHALPRVILEYRSLAKLRNTYTE
FT                   KLPEMIHPHTGRVHTNYHQAGAATGRLSSSDPNLQNIPIRTDDGRRIRRAFVAPSGRKL
FT                   IACDYSQIELRIMAHLSGDAGLVDAFESGVDVHCAIAAEVFGRGIDEVTPNERRAAKAI
FT                   NFGLIYGMSAFGLARQLGISRGEAQDYIALYFDRFAGVRDFMENTRQQARDRGYVETVF
FT                   GRRLYLNSIASGNQTQRAGAERAAINAPMQGTAADIIKRAMVAVDGWLGVGGHRERALM
FT                   ILQVHDELVFEADEGFVPTLVHEVSARMAAAAQLRVPLVVDVGVGHHWDEAH"
FT   gene            483541..484251
FT                   /locus_tag="XfasM23_0391"
FT   CDS_pept        483541..484251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0391"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   xom:XOO_2741 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91839"
FT                   /db_xref="GOA:B2I841"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I841"
FT                   /protein_id="ACB91839.1"
FT                   /translation="MDSFLRLLIHGASGRMGQSLLRLASEDPSFQVTAAVVGNAPHRHV
FT                   SDGVPFFAAAELAAVPAFDVAIDFSLPQGFSSLLALCVARAVPLVSGTTGLDSRQHEAL
FT                   VMAGARIPLVWGSNFSVGMAVLVNLVERAGDALSGWDCDIVESHHVHKQDAPSGSALTL
FT                   GEAVACKGIAPRYTSLRAGDIIGDHLVQFTGLGERIELVHRASNRDVFARGALSVARRV
FT                   VGRVPGCYRVRDLM"
FT   gene            484374..485573
FT                   /locus_tag="XfasM23_0392"
FT   CDS_pept        484374..485573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0392"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG:
FT                   xom:XOO_2740 carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91840"
FT                   /db_xref="GOA:B2I842"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B2I842"
FT                   /protein_id="ACB91840.1"
FT                   /translation="MFELSCNLISGGGIGVPGSQSETQPVTEHAILVLEDGTVFEGDAV
FT                   GANGLSVGEVVFNTALTGYQEILTDPSYAYQLVTLTYPHIGNTGCTDQDDEANKVWAAG
FT                   LIVRDVPRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMAGEID
FT                   VGKAQDAAHQFAGIKGMDLAKVVSTKQGYSWYEGQLDLDRNECKRAAPQYKVVAYDYGV
FT                   KLNILRMLAERGCDLTVVPAQTPADEVLALCPDGVFLSNGPGDPEPCDYAVAAIKTFIM
FT                   RRVPIFGICLGHQLLAQAVGARVVKMSHGHHGANHPVQDLRSGRVMITSQNHGFAVDEA
FT                   TLPNNVRVTHRSLFDGTNQGIELLDVPAFSFQGHPEASPGPHDVDVLFDRFITMMAAQS
FT                   "
FT   gene            485772..489014
FT                   /locus_tag="XfasM23_0393"
FT   CDS_pept        485772..489014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0393"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; MGS domain protein; KEGG: xcb:XC_2346
FT                   carbamoyl phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91841"
FT                   /db_xref="GOA:B2I843"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B2I843"
FT                   /protein_id="ACB91841.1"
FT                   /translation="MPKRTDLRTILIIGAGPIVIGQACEFDYSGAQACKALRAEGFRVV
FT                   LVNSNPATIMTDPDMADAVYIEPIHWRTVEKIITKEKPDALLPTMGGQTALNCALDLAD
FT                   HGVLEKYGVELIGAKREAIRMAEDRELFRVAMQEIGLECPKAEVAKSLERALEIQAKVG
FT                   FPTIIRPSFTLGGTGGGIAYNRQEFEEIIKRGLELSPVHEVLVEESVLGWKEFEMEVVR
FT                   DASDNCIIVCSIENLDPMGVHTGDSITVAPAQTLSDKEYQRLRDASIAVLRKIGVDTGG
FT                   SNVQFGIDPQTGRVVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELKNEIT
FT                   GGKTPASFEPSIDYVVTKIPRFAFEKFPQADARLTTQMKSVGEVMAMGRTFAESLQKAV
FT                   RGLETGKVGLEPTGLDLSSEDDLVVLKRELKAPGAERLFYVADAFRAGFAVADVYALSY
FT                   IDPWFLDQIEEIVAAEGRLVTDGLGSIDGARLRQLKRIGFSDARIAQLTGTNEVAVRTL
FT                   RRVLKVKPVYKRVDSCAGEFATGTAYLYSTYEEECEAAPSDRRKIMILGGGPNRIGQGI
FT                   EFDYCCVHAALALREDGFETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVEVEHP
FT                   VGVIVQYGGQTPLKLAKALEANGVPVIGTSPESIDLAEDRERFQRLVQQLGLRQPPNCT
FT                   ARTADEALVLAREIGYPLVVRPSYVLGGRAMEIVYSEADLARYVRDAVKVSNDSPVLLD
FT                   RFLDNAVEVDVDIIADPEGQVLIGGVMEHIEEAGVHSGDSSCSLPPYSLSAATQDDLRR
FT                   QVIRLAQALNVIGLMNTQFAIQSNDDGSDIVYLLEVNPRASRTVPFVSKATGVPLAKIA
FT                   ARCMTGKTLAEQSVTCEVVPAYYAVKEAIFPFAKLQGVDPILGPEMRSTGEVMGVGRSF
FT                   AAAFARAQEAGDIRAPQPGRAFVSVRDPDKKRVLPVVLALVERGFGVVATAGTYAWLQQ
FT                   NGVACEVVNKVAEGRPHIVDLIKNGEIVYIINTTEGRAAIADSFSIRREALQHCVTYST
FT                   TIAGAKALVNSLEFRGTGPVWSLQELHKELQV"
FT   gene            489011..489487
FT                   /locus_tag="XfasM23_0394"
FT   CDS_pept        489011..489487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0394"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: xac:XAC1863 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91842"
FT                   /db_xref="GOA:B2I844"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I844"
FT                   /protein_id="ACB91842.1"
FT                   /translation="MRAPMTLKGVRRLRDELEHLKSVKRPEIINAIAEARAHGDLKENA
FT                   EYHAAREQQSFIEGRIKQLEGELSHAEVIDVAKLNAGTKIVFGATVTLADLGTDEESRY
FT                   QIVGDLEADIKQGLVAISSPVARALIGKQEGDTIVIEAPAGRREYEVVAVEYIS"
FT   gene            489495..490415
FT                   /locus_tag="XfasM23_0395"
FT   CDS_pept        489495..490415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0395"
FT                   /product="regulatory protein"
FT                   /note="KEGG: xac:XAC1864 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91843"
FT                   /db_xref="InterPro:IPR016631"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:B2I845"
FT                   /protein_id="ACB91843.1"
FT                   /translation="MSSVTLLLPERHCLLGTLRGDAVVRALARADRITGGCGERAQLGR
FT                   HFELVPASWPVAALTRQIDVGDAAGAAWVRADPAYVVPDMGAARLVACGEMLALDAKDQ
FT                   AALLPELQTLFSEAGLLLDAPTPARWYVQLTPEACLPAFSAPEDVLGDDLFNHLPDGDM
FT                   GRCWRALLTEVQVLLHQHAWNVERVARGKQMINSLWFWGAGVLPHTVMTPHRQVRSRDV
FT                   LLHALAKASGSDTDSLHMVDALVDLRHLCSLTQFSDEVVAPLLAAMGRGELKQLVLDFR
FT                   DGEIFTMTRAHRWRFWCGVRTQLAD"
FT   gene            490418..492226
FT                   /locus_tag="XfasM23_0396"
FT   CDS_pept        490418..492226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0396"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: xcc:XCC1846 putative single
FT                   stranded DNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91844"
FT                   /db_xref="GOA:B2I846"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B2I846"
FT                   /protein_id="ACB91844.1"
FT                   /translation="MPKIIRRLSLPLVVWPDNVPPLLRRVYTARGCADPVTAQPCLAQL
FT                   LSPAMLSNMQAATVLLTEVIKANGRILVVGDFDCDGATACAVAVRGLRLLGARNVMHAV
FT                   PNRMVHGYGLSSALVEELAPLQPALLVTVDHGIACHAGIAAAKARGWKVLVTDHHLPGE
FT                   TLPAADVIVNPNLPGDLFPSKTLAGVGVIFYVLLALRARLYPAARAECEGQETRIHSSI
FT                   SQKNRPDLTSLLDLVAVGTVADLVPLDTNNRALVAAGLRRLRRGQGCLGLRALIEVSGR
FT                   DESQLTATDIGFALSPRLNAAGRLEDMALGIELLLTEDWTRARAIAAMLEEINAARRVV
FT                   QQGMSDDAEQAVAQAMAQSGGVLPMAVCLFDPDWHPGVIGLVASKMKDKMHRPVVALAP
FT                   AEPGGTVLRGSARSIPGLHIRDVLVALDSGYPGMIQKFGGHAMAAGLTLDAEVLPVFER
FT                   VFRAQVEMMVDKNVLQAELYSDGELAADELDALHARALRLGGPWGQGFPEPLFDGEFEV
FT                   LQWRVLKERHLKMEVRYSGRHDALNAIYFNGWQGDPPARRLRLAYRLVCDDYRGGDAIQ
FT                   LIVEYAEVIECDVLGSQAISSGLLDP"
FT   gene            493109..494017
FT                   /locus_tag="XfasM23_0397"
FT   CDS_pept        493109..494017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0397"
FT                   /product="peptide chain release factor 2"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   xac:XAC1875 peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91845"
FT                   /db_xref="GOA:B2I847"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B2I847"
FT                   /protein_id="ACB91845.1"
FT                   /translation="MLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQR
FT                   MFSGKMDGANAFVDIQAGAGGTEAQDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGI
FT                   KSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVFVSPEVDDNIDIEIN
FT                   PADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAK
FT                   LYESEIQKRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDL
FT                   DEFIEASLKAGLEAGAKRADA"
FT   gene            494199..495719
FT                   /locus_tag="XfasM23_0398"
FT   CDS_pept        494199..495719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0398"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: xac:XAC1876 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91846"
FT                   /db_xref="GOA:B2I848"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I848"
FT                   /protein_id="ACB91846.1"
FT                   /translation="MTEHLPASQVSFDENALIAERRAKLLALRAQGVAYPNDVKREHYA
FT                   ADVQAAFANVETWTAETLEASSHRVRMAGRLMAKRLMGKASFAQIQDESGRIQLLIQSN
FT                   VLGEDSYAAFKVLDVGDIIAVEGGLTRTRTGELSVKVNVLRLLTKALRPLPDKWHGLTD
FT                   VEQRYRQRYVDLIVTPESREIFIKRSKIIRALRTWLDARLFLEVETPMMHYIPGGAAAK
FT                   PFVTYHNALDLELYLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLEL
FT                   YEAYSTYHEVMDLAETMIRDTAQSVLGTTQVIWDGAQIDLGPIFRRWRMDEAVCHHNPE
FT                   MSVAECTDRDALLLHCERLKIKVKSSYGWGRLLLSIFEATVEHTLIQPTFITDHPVEIS
FT                   PLARESDIESGYTDRFELFINGKEIANGFSELNDPEEQAMRFQKQVEAKEGGDDEAMYY
FT                   DADYIRALEYGMAPTGGLGIGVDRLVMLLTGSTSIRDVLLFPYMRPER"
FT   gene            495857..497011
FT                   /locus_tag="XfasM23_0399"
FT   CDS_pept        495857..497011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0399"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: response regulator receiver; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: xcv:XCV1917 two-component
FT                   system response regulator RpfG"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91847"
FT                   /db_xref="GOA:B2I849"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2I849"
FT                   /protein_id="ACB91847.1"
FT                   /translation="MHDVFAMQSGELSSLQHLDSCDAVHVVLNIVIVDDQMSARTMLRH
FT                   VIEDIAPHLQVFDFGDPSEALAWCEVSQVDLLLLDYRMPDMDGLEFAMRLHQLPNRRDI
FT                   PILLITIVGDEPIRQAALDAGVIDFLIKPIRPRELRARCNNLLQLRQHSERAKQRVLSL
FT                   EQRLRAVMSEFEERERETVSRLARAVEYRHISSSTYLERMSQVAGLIAEQLGLSEEEVR
FT                   LIQSAAPLHDIGKIAIPDAVLLKRSTLNEEEMAMMRRHPRIGCELLSGSQNRCIQLGAL
FT                   IALRHHERYDGSGYPDGLVGEAIPLEARIVALADVFDALISLRPYKQAWTMEAAITYLY
FT                   AQRGRLFDPHCVDALIRGRDQLQRICVKFSTALARPGVWDAKES"
FT   gene            496995..499148
FT                   /locus_tag="XfasM23_0400"
FT   CDS_pept        496995..499148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0400"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Hpt domain protein; KEGG: xcb:XC_2333 RpfC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91848"
FT                   /db_xref="GOA:B2I850"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I850"
FT                   /protein_id="ACB91848.1"
FT                   /translation="MLKKAKWICSRLSQRPDSEHVQNLIRFLIASLFIIYLSVCWHGET
FT                   DLNTSRVIWLVLLSDLGVSLALMLAIVMHPQISHVRRCIGIIADYTSLTVLMLLMGEAG
FT                   SPLYVLCLWVTIGNGLRYGSVYLLVTTTLGALSFLTVILVSAYWKSNPFLAWGLLIGLI
FT                   AIPWYFQSLLKALIQALNDARHANEAKSRFLANMSHEFRTPLNGLSGMTEVLATTRLDA
FT                   EQRECLKAIQASVHSVLSLIEEVLDISRIEAGKIRILHDTFSLKEVIGSVGLILQPQIR
FT                   NKALEYRVDVGLDVPEWLFGDAGYVRQVLLNIVGNAVKFTERGRITLCVSVLNRSRQHS
FT                   VVLRFEVADTGIGVPLGMRNRLFDVFEQADVGLDRRYQGSGLGTTIAKGLIELMGGSIG
FT                   FEENVPCGSLFWFELPFELAKKQVVAQEVSEASQCTEPSNVIAFSNPFLRHRARVKSMR
FT                   VLVADDHETNRMVLSRILDKAGHKLLCVDGAEAVLDCLISMEFDVVIIDLHMPGMSGLD
FT                   MLKQLRVMQSSSLPYTPVLVLSADATSDSIRCCEEAGARAFLSKPVLATKLLDVLAEIA
FT                   EGDGGALPYAALSQSSVQQHQVFDPAGLDDLAELNMDDDFEERFIVQSFRDAEHCQQTM
FT                   LSAAETNQWQEVREEAHALRGVLGHLGLMRASSLAAELMRIPDWQLQLEWCALVQMLDE
FT                   ALLCGRDALEARRQERRRSGVLR"
FT   gene            complement(499171..500043)
FT                   /locus_tag="XfasM23_0401"
FT   CDS_pept        complement(499171..500043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0401"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xcv:XCV1920 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91849"
FT                   /db_xref="GOA:B2I851"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2I851"
FT                   /protein_id="ACB91849.1"
FT                   /translation="MSAVHPIPHPICESSIRIIEETHRNVYWIYMHAHLARTTGAAYFS
FT                   LKLIDDIMNYQSVLRQRLKEQTVQLPFVVLASDSNVFNLGGDLQLFCDLIRRKEREALL
FT                   DYACRCVRGAYAFHAGLNANVHSIALLQGNALGGGFEAALCCHTIVAEEGVMMGFPEVL
FT                   FDLFPGMGAYSFMRQRISPKLAERLILEGNLYSSEELLAIGLIDKVVPRGKGIEAVEQI
FT                   IRDSKRRQYTWAAMQEVKKIAHEVSLEEMIRITELWVDSALKLSNKSLRTMERLIRAQQ
FT                   THKNTALKN"
FT   gene            500323..502929
FT                   /locus_tag="XfasM23_0402"
FT   CDS_pept        500323..502929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0402"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; aspartate/glutamate/uridylate kinase;
FT                   KEGG: xcv:XCV3056 bifunctional aspartate
FT                   kinase/diaminopimelate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91850"
FT                   /db_xref="GOA:B2I852"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011246"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2I852"
FT                   /protein_id="ACB91850.1"
FT                   /translation="MSASPTAERWIVLKFGGTSVSRRHRWDTIAMVVRKRLEEHGTRVL
FT                   IVVSALSGVTNELTAIAQGVVDSAKRVTALEQRHRDFLVELGLDAQAVLGTRFAMLSDL
FT                   LQDARAVTRSLDWQAELLGQGELLSSTLGAAYLGASGIDIGWMDARDWLTALPPQPNQS
FT                   EWSQRLSVSCQWKSDVEWRTRFDAQRAQVLITQGFISRHQDGGTAILGRGGSDTSAAYF
FT                   GALLGAACVEIWTDVPGMFSANPKEVPDARLLTRLDYYEAQEIATTGAKVLHPRSIKPC
FT                   RDTGVPMLILDTERPDVLGTRIDAEVEPVLGVKAISRRDGIVLVSMEGIGMWQQVGFLA
FT                   DVFTLFKKHGLSVDLIGSAETNVTVSLDPSENLVNTDVLTALSTDLSQICKVKIIVPCA
FT                   AITLVGRGMRSLLHKLSEVWATFGKERVHMISQSSNDLNLTFVIDETDADGLLAVLHFK
FT                   LIESGAMPVQDRAVFGSPWREIIGHVRTRVMPWWHSARMRLLAMRDEEGIGPCYVYHLP
FT                   TVRERARQLNAVAAVDQCYYAIKANPHPAILRTLIEEGFGLECVSLGELRHVFEVVPHL
FT                   VPSRVLFTPSFASRVEYEQAFLLGVNVTLDNVEALRLWPEVFRERTLWLRIDLGYGDGH
FT                   HEKVTTGGKTSKFGLSVTRIDEFIDVAKTLNITVTGLHAHLGSGVESGNHWSRMYDELA
FT                   GFASRIGSVSTLDIGGGLPIPYRPDDEPFDVGAWGASLAEVKALHPKFQLVIEPGRFLV
FT                   AEAGVLLTRVTQVIEKDDILRVGLEAGMHTLIRPALYDAWHGVENLTRLDETPHVLCDV
FT                   VGPICESSDVFGRRRHLPAATASGDLMLIADAGAYGFSMASTYNLRGLPAEVVLDA"
FT   gene            503020..504381
FT                   /locus_tag="XfasM23_0403"
FT   CDS_pept        503020..504381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_1319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91851"
FT                   /db_xref="UniProtKB/TrEMBL:B2I853"
FT                   /protein_id="ACB91851.1"
FT                   /translation="MTSTFDTSQISAFRFVRCTLDAQTGVVSLVYAFDQGPEFVEKIMV
FT                   PGAPFALEGQRAEAVRQALRLLHLIAGVSYYKAIVPSTVTMDDDSIDAETAALVEEVYL
FT                   YGLSEFAYRNGLNLHGRFQLPVQATGAMAPAPQLGLREHALVAIGGGKDSLVSIEALRV
FT                   AGMQQTVVWIGASQLIRACAERSELQMLNVGRTLAPELFALNRKGAWNGHIPVTAINSA
FT                   ILVLVALLHGVDQVVFSNERSASYGSVIPGTGEVNHQWSKSWAFEQHFSDYVQRRVAAD
FT                   LRYYSLLRPLSELAVARQFAHCARYDAYFSSCNRNFHILGERPAHRWCGQCPKCHFVFL
FT                   ALAPFMPKTRLVGIFGRNLLDDASQASGFDALLEWQDYKPFECVGEARESRTALAVLAT
FT                   RAEWKEDALVMRFMREIQPHLDPAQLQLDPLLTLSDEHRIPASLWESMSAHFRT"
FT   gene            504362..505768
FT                   /locus_tag="XfasM23_0404"
FT   CDS_pept        504362..505768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0404"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   xac:XAC2908 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91852"
FT                   /db_xref="GOA:B2I854"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2I854"
FT                   /protein_id="ACB91852.1"
FT                   /translation="MRISALEGCRVALWGWGRESRAAYRAFRAAFPKQPLTLFCTIAEA
FT                   TEVQALADPVLSIETEVSVPRLAAFDVVIKSPGISPYSPLAVAATAAGAHFIGGTQLWF
FT                   AAHADTDGVVPGAVCVTGTKGKSTTTALLAHLLRAAGHCTALAGNIGLPLLELLTPQPA
FT                   PEYWAIELSSYQTADVAGSGARPALALVLNVFPEHLDWHGGEQRYINDKLSLVTVARPP
FT                   IALLNAADPRLASLVLPQSDLRWFNQRDGWHVRGQVVYRGEQAVLDTALIPLPGAHNGS
FT                   NVCAVLATLEALGLNAVALAPAACNFRPLPNRLQFLGERDGILWVNDSISTTPHATLAA
FT                   LDCFLGRRRVAVLVGGYDRGVNWECFAARITRKVPLDIVTMGANGPHIQALLAPLAAGR
FT                   FGLHAAVDLPHAVALARTALGAQGGVLLLSPGAPSFGAYQDYVERGRHFAILAGFDPEV
FT                   ISSISGLGIA"
FT   gene            complement(506045..506129)
FT                   /locus_tag="XfasM23_R0024"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(506045..506129)
FT                   /locus_tag="XfasM23_R0024"
FT                   /product="tRNA-Leu"
FT   gene            506775..507737
FT                   /locus_tag="XfasM23_0405"
FT   CDS_pept        506775..507737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0405"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; thiamine monophosphate synthase; KEGG:
FT                   xcb:XC_3499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91853"
FT                   /db_xref="GOA:B2I855"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B2I855"
FT                   /protein_id="ACB91853.1"
FT                   /translation="MTDSLRSIHVVAAVIADVRGRLLLSRRTENSDMPGLWEFPGGKRE
FT                   SGETSEQALARELYEELGISADVGEWLMEVPQLYPGKRLRLEVRRVRAWKGGLRGREGQ
FT                   ALTWVEPDKLLRYSMPPADQPVVGMLRQPDRYLVTPEPGEQDAEWLDAVEHAYRLGIER
FT                   IQLRMRQHDPVRWSGLVRQAVQRRGRAHVEVLLNRDIALAEALGIGVHLGAEQLAVLDA
FT                   RPLPVGLPVGASCHCLADLCHAQRIGCDFAVLGPVLPTESHPGAVTLGWERFEQLREQV
FT                   ALPIYAIGGMCADQVKEARRHGAQGIAAMRGLWPGGAKQ"
FT   gene            complement(507791..508618)
FT                   /locus_tag="XfasM23_0406"
FT   CDS_pept        complement(507791..508618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0406"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: xac:XAC0791 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91854"
FT                   /db_xref="GOA:B2I856"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B2I856"
FT                   /protein_id="ACB91854.1"
FT                   /translation="MIPISFEFYPPKNDDQRAQLDRTANRLRAFAPEYVSCTFGAGGST
FT                   LSYTSETVRHLSQHHGFDAAPHLSCVGGSRQEIRELLKLYRAIGCQRIVALRGDLPSGM
FT                   GHPGDLRYAADLITFIRAEHGDHFHLEIGAYPETHPQASNTLNDLHYFKAKVDAGADAA
FT                   ITQYFYNPDAYFHFVDAVQRLGVTIPIVAGVMPISNFDQLRHFSEQCGAEIPRWITKKM
FT                   QAYGDDTKSIRAFGADVVTALCERLIAGGAPGLHFYTLNLAKPSTQVLQRLGY"
FT   gene            complement(509109..509837)
FT                   /locus_tag="XfasM23_0407"
FT   CDS_pept        complement(509109..509837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0407"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   xcv:XCV2929 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91855"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B2I857"
FT                   /protein_id="ACB91855.1"
FT                   /translation="MRIALPPVLIALSLFTGLATRAHAHDSSSCNLPNDATLLSISTEG
FT                   ESKRTPDTANLSASVFTKDPSSNAAMSQNAERMSRVMAGIKAAGIPNNDVQTSSISLYP
FT                   QYVYQEKLGQKLTGYQASNTINIKVRDLTKLGKIIDILTTNGVSQLNGPSFEIDQIESA
FT                   YDEARLSALQKAQAQAKSYADRLGLKVRRVIDISESRGGDSRPMKVMFTRAMKDNTETP
FT                   ISLGENSIGVSLNIKFELGK"
FT   sig_peptide     complement(509763..509837)
FT                   /locus_tag="XfasM23_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            509956..510525
FT                   /locus_tag="XfasM23_0408"
FT   CDS_pept        509956..510525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0408"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: xcv:XCV2928 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91856"
FT                   /db_xref="GOA:B2I858"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I858"
FT                   /protein_id="ACB91856.1"
FT                   /translation="MLYLASRSLCRRQLLQRLDIPFQVIDLEIPEVRREDELPQDYVRR
FT                   VAQEKAQVGLARVGDAFAPKVLGADTEVVLDGRVFGKPVDLAEAATMLAALSGRTHQVM
FT                   TAVSLVAAGGVAAQVLVVSEVSFALLSQGQIARYVDSGEPMGKAGAYAIQGRGECFVSR
FT                   LVGSYSGVMGLPLQQTAQLLATFEES"
FT   gene            510526..512019
FT                   /locus_tag="XfasM23_0409"
FT   CDS_pept        510526..512019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0409"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: xac:XAC2770 ribonuclease
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91857"
FT                   /db_xref="GOA:B2I859"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2I859"
FT                   /protein_id="ACB91857.1"
FT                   /translation="MSEEILVNVTFGETRVAVVENGLLQELHIERDGCRGVVGNIYKGR
FT                   VQRVMPGMQAAFVDVGMERTAFLHVNDVVRSAPADSSVIDTDETTVPPLSEIPIVELLR
FT                   DGQELMVQVLKEPIGTKGARLTTQISIPSRYLVLLPQSKMVGVSLRIEDEAERARLKAV
FT                   VTDLAAQYGDYGYIVRTNAEGQSADVLVEDIAYLSRLWGVVERRGRELPVCSLLYEDLS
FT                   LSLRSVRDLIRKDVEKIKVDSKEAFAQLQGFVTKYMPVLADKLELYVGDHPIFDLYGVE
FT                   DEIGRALDRQIPLKSGGYLVIEQTEAMTTVDVNTGSFVGKRTLEETVFRTNLEAAQALA
FT                   RQLRLRNLGGIIVIDFIDMQDAEHRCQVLRVLEKALIRDHAKTTVYDFSPLGLVEMTRK
FT                   RTVESLQRQLSETCQTCGGRGTIKTVETVTYEIFRDITRAVRQFDAVRLLVIASPNVVS
FT                   RMTDEESAAVAELEAVLGKAIRFQADPHYLQEQYEVVLL"
FT   gene            512016..512165
FT                   /locus_tag="XfasM23_0410"
FT   CDS_pept        512016..512165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91858"
FT                   /db_xref="GOA:B2I860"
FT                   /db_xref="UniProtKB/TrEMBL:B2I860"
FT                   /protein_id="ACB91858.1"
FT                   /translation="MNDLVPCVVYMVDMWLWMFIMRVSRWVFVSRQMDMMGFHAADFFK
FT                   LAIV"
FT   gene            512167..515991
FT                   /locus_tag="XfasM23_0411"
FT   CDS_pept        512167..515991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91859"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B2I865"
FT                   /protein_id="ACB91859.1"
FT                   /translation="MSSLLRFPRVFRYAAYACVAVFVAVALAMGVVSQLLPVVERHPQQ
FT                   VADWLSVRAGQPVRFDTLSTSWTQRGPLLRLQGVRIGPQGKVGIGQVEMLVAMYTGILP
FT                   GHSLIELRLRGVALTVHRDSAGRWSVYGLPRDVEGDPLEVLRRLGELQVIGGRLSVDAP
FT                   SSGVSTTLSQINLRVRVAGDRLRAGVHGWLDSARAPVTGVVDFDRVSGDGDVYVETLPN
FT                   QLASWSSLLAGVMRGVHLRDGAGHVRVWAQLHRHHVEQVTVQGDLQGVRFEGGRLAGQT
FT                   VVPRVFWPQLQVLVRWQRQGDGWRVVAPRLRMGESRRLQKLDGVVVEGGSFYTVSAPNA
FT                   VDAGAVLAVLALGDWLAPDLRTWLLHARPQLRVAGLHVSKQADGWFWVAGRVEQLGFLP
FT                   VADAPGLSGVRGTLEGDAQGAVLTLDSDASVHLDWPSGFGRRHEIHLAGRIVGWRQGDG
FT                   WKVATPALRVQAADYGANLRGGLWFEGHGTLPRISLAVQLDDVAVPVAKRFWVRSKMSR
FT                   ELIDWLNAALVNGSTSGGFALIEGELKDWPFNNHDGYFEAAGRIHGGVMRFQSEWPVLE
FT                   KLDADIAFIGNGFSIKGRGELAGVPQVQLEAGIEDFEKGDLYVRAHVQSDATRLLGLLR
FT                   RSPLHQHDADTLDSVSASGPASVSFDMHLPLRHEQGADYGHFGGEVSLENVNYIDRRWN
FT                   LAFENVRGPVRYSSDGFSAEGLHVLHQGLEGRLSVRVGDAVDDPAQIFQARLSAAVNVK
FT                   SLLRHAPQMDWLRPYVNGISQWRIGVDLAKSVPDAHRVLGHLTLDSDLVGTALNLPAPL
FT                   DKGSGRVLPAHINVALPMEQGDIALALGKLVAARVRHRDGAGVGVRVVMGGDNVREAPL
FT                   EHGLVVIGHSTSLDAIDWVRLVRGGSAVSSDLPLRLIDLQVDSLLLLGGMFPNTRFQLR
FT                   PVHQGVAVVVDGPALSGQLNIPESIDGTVTGSLGVLHWQAAQAPSVKVSGSVQSAMADV
FT                   DPASIPSLAFEVEDARLGQVKLGRVGLRTRRLSDGIQVDQLQTNSPSQRLSMFATWRGK
FT                   GEAASIRLSARVDSRDLGELAQAIGYGEQLRGGEGQIQLSAGWNGPPVGFQLPSLSGDL
FT                   KVNARNGQLLELKPGAGRVLGLLSVTQLPRRLMLDFRDLFSKGLAFNRFYGEVHFGDGK
FT                   AHTDRLKIEGPAVNIAIRGQSDLSTQTFDQIVDVNPKSGNLLTVVGAVAGGPVGAAVGA
FT                   AANMVLGKSLGAIGSKTYHVSGPWNDPKVQVMNLDSRQRDKPSNSKSEN"
FT   sig_peptide     512167..512253
FT                   /locus_tag="XfasM23_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.753 at
FT                   residue 29"
FT   gene            516116..517573
FT                   /locus_tag="XfasM23_0412"
FT   CDS_pept        516116..517573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0412"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xom:XOO_3127 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91860"
FT                   /db_xref="GOA:B2I866"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2I866"
FT                   /protein_id="ACB91860.1"
FT                   /translation="MKNTALSVAESRLLLPAGLDDGQIDSIFGTLLGPGVDFGDLYFQH
FT                   ARRESWSIEDGIVKDGTHSIEQGVGVRAISGEKTGFAYSDDINRDALLEAAYAARAISR
FT                   SPGDGVQGTHAVLRRHGRELCLYPALDPVGGMDNAEKIAVMRRVDQLLRVADPRVTQVM
FT                   VNLSGGVDVVLIARSDGVLAADVRPLVRLNVQVIVEGHGRRESGYAGGGGRYGYAELFA
FT                   DGRPEAFAREALRQALVNLEAIPAPAGVMPVVLGAGWPGVLLHEAVGHGLEGDFNRKAT
FT                   SVYAGRIGERVASPGVTIVDDGTLDGRRGSLNIDDEGTPTQCTTLIEDGVLVGYMQDTL
FT                   NARLMGVASTGNGRRESFAHLTMPRMTNTYMRAGAHSREEMIRSVKKGLYAVNFGGGQV
FT                   DITSGKYVFSATEAYLIEDGRVTAPIKGATLIGNGPETMQRVRMIGDDLALDAGVGVCG
FT                   KDGQSVPVGVGQPSLLIDGLTVGGTQA"
FT   gene            complement(518068..518637)
FT                   /locus_tag="XfasM23_0413"
FT   CDS_pept        complement(518068..518637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0413"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   xac:XAC2766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91861"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:B2I867"
FT                   /protein_id="ACB91861.1"
FT                   /translation="MWKNGAMRGCNKETGEFLGPSRSQQRRTALEVLVLSEKLAALTPA
FT                   QLAKLPIPERLLPHITETKRITSHIARKRQLAFLAKQMRREDDTTLEAIREKLNASGIQ
FT                   AQREVATLHRTEQWRKRLLEEGDSALTELLNQYPQADCGKLRQLLRNSKTEQARNKAPQ
FT                   AFRELYQVLHGLIITQNSDNQHQTPQ"
FT   gene            518697..520064
FT                   /locus_tag="XfasM23_0414"
FT   CDS_pept        518697..520064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0414"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xom:XOO_3125 PmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91862"
FT                   /db_xref="GOA:B2I868"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2I868"
FT                   /protein_id="ACB91862.1"
FT                   /translation="MNVCSTDLNSVDDSQVRLDVLADIAQRLLERAHACGATQAEVGCS
FT                   EERGLDVNVRMGDVETVESTCDRSIGVTLYFGQRKGSASTVDLQEASLEATVAQACAIA
FT                   RYTEDDPANGLADPVRMATVFPDLDCWHPWTLEAGTAVDLALGCEAAGRAADARIVNSD
FT                   GASVSTRFALSVYANSHGFVGRERMTQHSMSCALIAGDGDGMQRDGWYTNALAREDLEL
FT                   PVAVGRKAAERTVARLQPRSLATTQLPVLFVPEVARSLIGHLLNAVSGGALYRRASFLL
FT                   DSVGTRLFPEWFAINERPHLRRGLRSATFDAEGVATCDAPLVAGGVLQRYVLSSYSARK
FT                   LGLQSTANAGGVHNLEVIANAADLDALVAGLPRGLLVTELMGSGVNPVTGDYSRGAAGF
FT                   WIENGAIAYPVDGLTIAGNLREMFSAIEAVGADVDRRSHVSMGSLLIGRMMVAGND"
FT   gene            complement(520151..521056)
FT                   /locus_tag="XfasM23_0415"
FT   CDS_pept        complement(520151..521056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0415"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rle:RL2353 putative LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91863"
FT                   /db_xref="GOA:B2I869"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2I869"
FT                   /protein_id="ACB91863.1"
FT                   /translation="MQNMFDGVQLFVEVVEAGGFAKAGKRLSLTRSTIGKAIARLEMRL
FT                   GVQLFQRTTRVQSLTEDGQQYYERCLRAIKELRAGEAMLEQGRREVAGRLHVSLPVLFG
FT                   RQCVAPILRTYAREHPQLELELNFSDHHVDLIADGFDLAVRNGPLGNGTTLRARRLGNQ
FT                   RKILCASPTYLAARGKPHTLADLADHDLLTYCRNDRNMAWTLPDATGALVDIPITSRLR
FT                   CNDLEVIADTAVDGMGVAWLPYWLLMERMQRGELIGIWGDRPSAVIECHVVWPAAQHVP
FT                   LRSRLAINLLAAELPKYLEA"
FT   gene            521271..521840
FT                   /locus_tag="XfasM23_0416"
FT   CDS_pept        521271..521840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0416"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   rso:RSc0633 putative TRP repressor binding protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91864"
FT                   /db_xref="GOA:B2I870"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2I870"
FT                   /protein_id="ACB91864.1"
FT                   /translation="MLISIVYDSGYGHTARVAQAVAAGVQEMKGADVRLMAVADGSVDW
FT                   EALERSDAIIFGSPTYNGLISAKFKQFFEDSTKKAWVSQKWRNKIAAGFTNSGAQHGDK
FT                   LNSLMSMVLFAAQHGMIWVGLDLMPGNNSSTGSPDDLNRLGSWLGVMTQSNNDAAPEIA
FT                   PPASDLKTAQHLGLRVAETVRRFQPV"
FT   gene            521873..522186
FT                   /pseudo
FT                   /locus_tag="XfasM23_0417"
FT   gene            522272..523330
FT                   /locus_tag="XfasM23_0418"
FT   CDS_pept        522272..523330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0418"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rso:RSc0632 putative NADP-dependent alcohol dehydrogenase
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91865"
FT                   /db_xref="GOA:B2I871"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I871"
FT                   /protein_id="ACB91865.1"
FT                   /translation="MNVMGFAALSATGPLERFAFGRRAPRPDDVVIDILYCGVCHTDLH
FT                   LARNHSGFTTYPIVPGHEIIGCVREIGKTVTRFKRGDLVGVGCMVDSCQHCQPCLKGWE
FT                   QDCIEGSTFTYNSIDRRDGSITYGGYSDVIVVRDKFVLLLPDGLDPAGAAPLLCAGITT
FT                   WSPLRRWNVGKDSKVAVVGLGGLGHMALKLAKALGADVTLFTRSSGKEGDAFRLGADRV
FT                   VLSSDLEQMKAVYSRFDVIIDTAPYDHDVNPYMPTLVLEGVLVLVGYMGPLSTPVNAGG
FT                   VVRGRRAISGSFIGGVPETQQMLDFCGQHGIVSDVEIIPIQKINEAYERMLKSDVKYRF
FT                   VIDMTSLTSSGA"
FT   gene            523367..523996
FT                   /locus_tag="XfasM23_0419"
FT   CDS_pept        523367..523996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0419"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: rle:RL2351
FT                   putative DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91866"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2I872"
FT                   /protein_id="ACB91866.1"
FT                   /translation="MTSHLIRGDSGEPTGFAMVELTHPLEVFEAAGIPVEIASIRGGHP
FT                   PIDFFDLSDPVNDRFWKNKAVPSLADSFVLGDLDPLRYSAVFFVGGHGTMWDFADSLAV
FT                   QNVVRGIWESDGIVSAVCHGPAALVNAILSDGSYLVAGKEETEVKYANVVPYLLATTLK
FT                   QRGALHQSAPNWVENVVVDGRLITGQNPASAYGVGQRVVDQLKASI"
FT   gene            524424..524642
FT                   /locus_tag="XfasM23_0420"
FT   CDS_pept        524424..524642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91867"
FT                   /db_xref="UniProtKB/TrEMBL:B2I873"
FT                   /protein_id="ACB91867.1"
FT                   /translation="MVTLAKRIVALSKEDYSISEIANLLLYTESNIEGVLALTYVKRKP
FT                   RGSILLQYFHGNVEMLAHWKTMLVGFC"
FT   gene            complement(525417..526790)
FT                   /locus_tag="XfasM23_0421"
FT   CDS_pept        complement(525417..526790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0421"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: xcb:XC_3674
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91868"
FT                   /db_xref="GOA:B2I874"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I874"
FT                   /protein_id="ACB91868.1"
FT                   /translation="MPLSLPLHIVILAAGEGKRMKSALPKVLHPIAGKPMLAHVITTAR
FT                   ALTPDAIHVVYGHAGNQVRAAFADQTDLHWVEQTQQLGTGHAVKQTMSAIPNAANVLVL
FT                   YGDVPLIRAETLQRLPRASTPIAVLVTELANPAGYGHIVRNSEGKVAAIIEDKDADEEQ
FT                   RRIHTVNTGILCAESTALRRWLSKLSNTNMQGEYYLTDIFASATADLTPANMIMVTDAQ
FT                   EVEGVNDLWQLTQLERAWQIRAARALCLQGARVADPARLDQRGTIRIGQNVHIDIDVVL
FT                   EGEIELGDNVVIGPFVRLKNVKLGPGTKVHAHCDLEGVTTTGSALIGPFARLRPETMLA
FT                   DGVHIGNFVETKNTSIGADSKANHLTYLGDAQIGTKVNIGAGTITCNYDGVNKSITLIG
FT                   DGAFIGSHSALIAPVSVGAGATLGAGTVLTHDAPAHQLTVARARQTTLDGWQRPKKKT"
FT   gene            complement(527156..527731)
FT                   /locus_tag="XfasM23_0422"
FT   CDS_pept        complement(527156..527731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0422"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: xac:XAC3647 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91869"
FT                   /db_xref="GOA:B2I875"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:B2I875"
FT                   /protein_id="ACB91869.1"
FT                   /translation="MSLSSLLRHNVHLAAFIISLSLFGYTDQAHSAPSTLTTLLGKVAE
FT                   RNAIGDEVALSKWDTGKPVLDASRETAVLQSVRDQAPQYRLDPDLAARFFSAQIESNKL
FT                   VQYQLLNRWQLRGKAPNRTRPNLIALRDRLDHLQNELLDALAQSMTLREQNNCPSEIAL
FT                   ATEAYARQLNLDNLHHLALIRSLGDFCH"
FT   sig_peptide     complement(527636..527731)
FT                   /locus_tag="XfasM23_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.614 at
FT                   residue 32"
FT   gene            complement(527978..528409)
FT                   /locus_tag="XfasM23_0423"
FT   CDS_pept        complement(527978..528409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0423"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: xac:XAC3648 F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91870"
FT                   /db_xref="GOA:B2I876"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:B2I876"
FT                   /protein_id="ACB91870.1"
FT                   /translation="MASMSTIRCDIVSAEQEIFHGEATFVVATGELGELGIAPKHAPLI
FT                   TRLKPGKVVITTVNGEQLDFAISGGILEVQPQVVTILADSAIRADTIDEVAVRKAKEEA
FT                   ERILANRGETIDVAKAQQQLVEAVVQMQALERLRRTVKH"
FT   gene            complement(528479..529879)
FT                   /locus_tag="XfasM23_0424"
FT   CDS_pept        complement(528479..529879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0424"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: xcv:XCV3767 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91871"
FT                   /db_xref="GOA:B2I877"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I877"
FT                   /protein_id="ACB91871.1"
FT                   /translation="MNQGKIVQIIGAIVDVEFPRNNVPKVYNALKIDGTAIILEVQQQL
FT                   GDGIVRTIALGSTDGLKRNLIATDTGHAITVPVGTGTLGRIMDVLGNPIDEAGPITYTD
FT                   QWEIHRNAPSYEDQASTTELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDSSGKGKDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTANGSITSIQAVYVPADDLTDPSPATTFGHLDSTVTLSRSIAALGIYPAVD
FT                   PLDSSSRQMDPLIIGEEHYNTTQRVQQTLQKYKDLKDIIAILGMDELSEDDKLSVSRAR
FT                   KIERFFSQPFHVAEVFTGAPGKYVPLKDTIRGFKAIVDGEYDHLPEQAFYMVGNIEEVI
FT                   EKANKMTA"
FT   gene            complement(529962..530825)
FT                   /locus_tag="XfasM23_0425"
FT   CDS_pept        complement(529962..530825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0425"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: xcb:XC_3679 F0F1 ATP synthase subunit gamma;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91872"
FT                   /db_xref="GOA:B2I861"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I861"
FT                   /protein_id="ACB91872.1"
FT                   /translation="MASGREIKSKIKSVQNTRKVTRALEMVSASKIRKAQEQMKISRPY
FT                   AQAMKQMIGHLAQANTEYLHPFLIAHKQVKRIGYIVISSDRGLAGGLNNNLFRKMLGEM
FT                   HQWQDNGAEVDIVTIGQKASVFFRRIKVNILGSVTHLGDTPRLEQLIGVIKVMLDAYTE
FT                   EKLDRVYLVYNHFINTMVQKASFDQLLPLLAAKDKVAHHDWDYLYEPDAATVLEHVMTR
FT                   YIESLVYQAMLENIASEHAARMVAMKAASDNANKLIGTLQLVYNKARQAAITQEISEIV
FT                   GGAAAV"
FT   gene            complement(530917..532464)
FT                   /locus_tag="XfasM23_0426"
FT   CDS_pept        complement(530917..532464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0426"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: xac:XAC3651 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91873"
FT                   /db_xref="GOA:B2I862"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I862"
FT                   /protein_id="ACB91873.1"
FT                   /translation="MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFG
FT                   LADAMQGEMIELPNKTYALALNLERDSVGAVVLGDYEHLREGDVAKTTGRILEVPVGKS
FT                   LLGRVVNALGEPIDGKGTLGPTQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGR
FT                   GQRELIIGDRQTGKTAMAIDTVISQKHTGIKCVYVAIGQKSSTIANIVRKLEENDALDH
FT                   TIVVAATASESAALQYISAYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKR
FT                   PPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVS
FT                   AFVPTNVISITDGQIFLETDLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISL
FT                   AQYRELAAFAQFASDLDETTRKQLERGQRVTELMKQKQYTSMSVANQALSIYAVSEGYL
FT                   DDIPVHKVLTFEEGLHAHFSNTQGALIDKINNSGDWDNNIEAAFKQHIEEFKTTGSW"
FT   gene            complement(532514..533041)
FT                   /locus_tag="XfasM23_0427"
FT   CDS_pept        complement(532514..533041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0427"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: xcb:XC_3681 F0F1 ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91874"
FT                   /db_xref="GOA:B2I863"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I863"
FT                   /protein_id="ACB91874.1"
FT                   /translation="MIQALTLARPYARAAFAIACEKGKCMQWSQALTFSAQVANNPIVA
FT                   TLLSHPQLDHEQAAALLSPEGADPAYIRFLEVIAEAHRLDVLLQVAGLYEKLRAEAQHV
FT                   IKAKITSAIELAPNELNNIVTALKKRFDCEIEVTTGVDHSLIGGAVIDTGNVVIDGSIK
FT                   SKLTRLQASLTH"
FT   gene            complement(533045..533515)
FT                   /locus_tag="XfasM23_0428"
FT   CDS_pept        complement(533045..533515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0428"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   xac:XAC3653 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91875"
FT                   /db_xref="GOA:B2I864"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I864"
FT                   /protein_id="ACB91875.1"
FT                   /translation="MDITFTIFAQSLAFAALIWIVATKIWPPLIKVIEERQQKIAEGLA
FT                   AADLGQKELAQAQEEIKKTLKNAHKKANEIIEQAHARAHQIIEAAKAEAIAETNRQQNL
FT                   AQVEIEAAAKRAREELRKHVSILAVNGAEKLLKREIDVNTHKMLLDELAAEI"
FT   gene            complement(533635..533940)
FT                   /locus_tag="XfasM23_0429"
FT   CDS_pept        complement(533635..533940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0429"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   xom:XOO_0663 F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91876"
FT                   /db_xref="GOA:B2I8G5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8G5"
FT                   /protein_id="ACB91876.1"
FT                   /translation="MSLDVLTNFAQIQSFTALAIGIMIGLAALGAGLGLAIMAGKFLES
FT                   AARQPELIPLLQVRMFIAAGLIDAAFIISVAVGLLLAFANPLSSTLLVAVSKALAG"
FT   sig_peptide     complement(533848..533940)
FT                   /locus_tag="XfasM23_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.539 at
FT                   residue 31"
FT   gene            complement(534004..534801)
FT                   /locus_tag="XfasM23_0430"
FT   CDS_pept        complement(534004..534801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0430"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   xom:XOO_0662 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91877"
FT                   /db_xref="GOA:B2I8G6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8G6"
FT                   /protein_id="ACB91877.1"
FT                   /translation="MAGEEATPTSYIQHHLHNLTFQMQDGSKFWVLHLDTLIMAVLMGL
FT                   VMVLAFWSGTCKATSGIPGKWQAFVEVCLEFVDRQVKDTYHGPSKLVTPIAITLFFWIF
FT                   LMNLIKVIPADFIAIPFSWAGVHAWKPVPTADVNATLGMSISVFFLMLFFSFRAKGISG
FT                   FIKEFITTPFGKWMMPFNIVLNIVEWLSKPISLAMRLFGNMFGGEIVFLLIWVLGGAGI
FT                   SGMLASSTFGLAWMLFHLLVIPLQAFIFMMLSIVYLSLSEDSH"
FT   gene            complement(534831..535202)
FT                   /locus_tag="XfasM23_0431"
FT   CDS_pept        complement(534831..535202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91878"
FT                   /db_xref="GOA:B2I8G7"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8G7"
FT                   /protein_id="ACB91878.1"
FT                   /translation="MLTSTYTTKKLALRAAISSLIAVTITSLALLIFDVKYACGATLTG
FT                   LAITLGSWLSAQVALGGRVQGAVAVIARLILAFLLKWVSVITALLLGFCLWRLPALGLL
FT                   SGITIGLFFQALTMTRQQS"
FT   sig_peptide     complement(535113..535202)
FT                   /locus_tag="XfasM23_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.653 at
FT                   residue 30"
FT   gene            536513..536824
FT                   /locus_tag="XfasM23_0432"
FT   CDS_pept        536513..536824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0432"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: xcb:XC_3341 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91879"
FT                   /db_xref="GOA:B2I8G8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8G8"
FT                   /protein_id="ACB91879.1"
FT                   /translation="MADQKIQIRLKAFDCRLIDRSAGEIVETAKRTGAHVRGPIPLPTK
FT                   IERCTILVSPHADKDARDQYETCTYKRVLYIVDPNDKTVDALMKLELAAGVDVQIKLT"
FT   gene            536854..537486
FT                   /locus_tag="XfasM23_0433"
FT   CDS_pept        536854..537486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0433"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: xac:XAC0972 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91880"
FT                   /db_xref="GOA:B2I8G9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8G9"
FT                   /protein_id="ACB91880.1"
FT                   /translation="MGFVGRKAGMSRVFLEDGCSIPVTLIEATANRVVQIKTSDVDGYD
FT                   AVQVTVGSRRSVLVNKPESGHFAKAKVEAGRGLWEFRVEKTQLGSYSVGSEVGLSIFAV
FT                   GQKVDIQGITKGKGFQGTIKRHNFRMGDATHGNSLSHRAPGSLGQRQTPGRVFPGKKMS
FT                   GHMGAVKQSVQNLEVIKIDVERCLIAVRGAIPGASGGDVLIRSASKI"
FT   gene            537496..538104
FT                   /locus_tag="XfasM23_0434"
FT   CDS_pept        537496..538104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0434"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: xac:XAC0973
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91881"
FT                   /db_xref="GOA:B2I8H0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H0"
FT                   /protein_id="ACB91881.1"
FT                   /translation="MDLTIVGSDNTLPVSDVVFGREFSEALVHQVVVAYRNTARSGTKA
FT                   QKSRSQVSGTTKKSKKQKGGGARHGALTAPIFVGGGVAFAAKPRSFSQKVNRKQYRSAI
FT                   CSIFSELNRQGRLKVVDAFDVEVSKTRVFAEKIKSLEVVGSSLLIVSDEISECLSLSSR
FT                   NLPCVDVRSVQALDPVALVGSDVVVLTVGAVKKIEEWLV"
FT   gene            538101..538403
FT                   /locus_tag="XfasM23_0435"
FT   CDS_pept        538101..538403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0435"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: xcb:XC_3338
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91882"
FT                   /db_xref="GOA:B2I8H1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H1"
FT                   /protein_id="ACB91882.1"
FT                   /translation="MNSSCEKIFGVLRSPRVSEKSSRLQEISNVYVFEVSSDATKIDVK
FT                   NAVERLFDVKVGVVRVLNVKGKSKSFRNRGGSRSGWRKAYVRLIDGQSIDVASSV"
FT   gene            538415..539242
FT                   /locus_tag="XfasM23_0436"
FT   CDS_pept        538415..539242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0436"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: xom:XOO_3384 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91883"
FT                   /db_xref="GOA:B2I8H2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H2"
FT                   /protein_id="ACB91883.1"
FT                   /translation="MPLIKFKPTSPGRRSAARVVTPNIHKGSPHAALLESQSKTGGRNH
FT                   HGRITVRHIGGGCKQRYRVIDFKRDKEAIPARVERIEYDPNRTAHIALLCYIDGERCYI
FT                   IAPKGLKEGDKIISGPNVPIKLGNSLPLRNIPVGTTVHAVELKPRKGAQMARSAGSSVQ
FT                   LVAREGVYATLRLRSGEMRRVLAECRATIGEVGNEEHNLRKLGKAGAKRWLGVRPTVRG
FT                   AAMNPVDHPHGGGEAKSGQGNPHPVTPWGVPTKGYKTRKNKRTQQFIIRGRRG"
FT   gene            539250..539519
FT                   /locus_tag="XfasM23_0437"
FT   CDS_pept        539250..539519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0437"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: xac:XAC0976 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91884"
FT                   /db_xref="GOA:B2I8H3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H3"
FT                   /protein_id="ACB91884.1"
FT                   /translation="MPRSTKKGPFFDHHLIKKVESAAGSKRPIKTCSRRSVILPQMVGH
FT                   TIAIHNGKNYHPVVINENMVGHKLGEFSITRVFKGHCGDKKSGK"
FT   gene            539532..539867
FT                   /locus_tag="XfasM23_0438"
FT   CDS_pept        539532..539867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0438"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: xac:XAC0977 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91885"
FT                   /db_xref="GOA:B2I8H4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H4"
FT                   /protein_id="ACB91885.1"
FT                   /translation="MEASAILRGARVSPQKARLVAAQVRGLSADSAVNLLRFSSKKAAC
FT                   LIKKVVESAIANAENNHGSNIDDLRINTIIVDEGRMLKRFMARAKGRSSRIVKRSSHIT
FT                   VVVGPAK"
FT   gene            539886..540605
FT                   /locus_tag="XfasM23_0439"
FT   CDS_pept        539886..540605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0439"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: xac:XAC0978 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91886"
FT                   /db_xref="GOA:B2I8H5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H5"
FT                   /protein_id="ACB91886.1"
FT                   /translation="MGHKVHPIGIRLGISADWNSKWYANKAEFARYLAADLKVRQVLRK
FT                   KMSQAGISKILIERPSNTACVSMHVARPGVVIGKRGEDIEMLRKQVSDIMGVPVHINVI
FT                   EVRKPELDAQLVAESVAQQLERRIMFRRAMKRSVSNAIRLGALGIKISVAGRLNGAEIA
FT                   RSEWYREGRVPLQTLRADIGYGFSEAYTNYGVTGVKVLMYHGDIFSFSSVSQEKQDDGS
FT                   RGDRNADRSSRRSREVR"
FT   gene            540611..541024
FT                   /locus_tag="XfasM23_0440"
FT   CDS_pept        540611..541024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0440"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: xcb:XC_3333 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91887"
FT                   /db_xref="GOA:B2I8H6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H6"
FT                   /protein_id="ACB91887.1"
FT                   /translation="MLQPKRTKYRKMHKGRNCGLSWNANVVSFGQYGLRATAHGQLTAR
FT                   QIEAARRSISRYVKRGGKLLIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIY
FT                   EIEGVSEDVAREAFRLAASKLSVTTAFVVRTVR"
FT   gene            541021..541221
FT                   /locus_tag="XfasM23_0441"
FT   CDS_pept        541021..541221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0441"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: xac:XAC0980 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91888"
FT                   /db_xref="GOA:B2I8H7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8H7"
FT                   /protein_id="ACB91888.1"
FT                   /translation="MMDIQQFRGKSVDDLKAHLIELRKEQFSMRMQVAMGQFQKTHEIR
FT                   RVRRNIARVKYLLSWINRTPA"
FT   gene            541221..541487
FT                   /locus_tag="XfasM23_0442"
FT   CDS_pept        541221..541487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0442"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: xom:XOO_3378 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91889"
FT                   /db_xref="GOA:B2I8H8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H8"
FT                   /protein_id="ACB91889.1"
FT                   /translation="MNDNNERKPLRTIKGLVISNKMQKTVTVLVERQIKHALYGKYIKR
FT                   STKLHAHDADDLCNEGDVVLMTEVAPISKTKNWRVVEIVARSD"
FT   gene            541511..541879
FT                   /locus_tag="XfasM23_0443"
FT   CDS_pept        541511..541879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0443"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: xac:XAC0982 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91890"
FT                   /db_xref="GOA:B2I8H9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8H9"
FT                   /protein_id="ACB91890.1"
FT                   /translation="MIQMQSYLGVADNSGAKEVMCIKVLGGSKRRYASIGDVIKVTVKE
FT                   AIPRGKVKKGEVYDAVVVRTRSGVRRPDGSLIRFDGNAAVLLNNKQEPIGTRVFGPVTR
FT                   ELRSEKLMKIVSLAPEVL"
FT   gene            541895..542212
FT                   /locus_tag="XfasM23_0444"
FT   CDS_pept        541895..542212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0444"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: xom:XOO_3376 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91891"
FT                   /db_xref="GOA:B2I8I0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I0"
FT                   /protein_id="ACB91891.1"
FT                   /translation="MASRIKKGDQVIVIAGKDKGKQGEIIRIDGHRVVVSNVNFVKRHT
FT                   KPNPQRGISGGLIDREAPIHVSNIKILNPMTGKGDRVGFKILGDGCKLRIFRSTGEVIG
FT                   A"
FT   gene            542224..542763
FT                   /locus_tag="XfasM23_0445"
FT   CDS_pept        542224..542763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0445"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: xcv:XCV1011 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91892"
FT                   /db_xref="GOA:B2I8I1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I1"
FT                   /protein_id="ACB91892.1"
FT                   /translation="MTRLENMYKKEVVPALIKRFGYSNPMAVPRLVKITLNMGVGEAAT
FT                   NKKVLENALADMAKISGQKPIVTKSRISVASFKIRNGWPIGCKTTLRRSKMYEFLDRLI
FT                   NISLPCVRDFRGIPPRSFDGRGNFNMGVKEQVVFPEIDFDAVDAIRGMDIAITTTANSD
FT                   AEAKALLDAFNFPFRN"
FT   gene            542780..543085
FT                   /locus_tag="XfasM23_0446"
FT   CDS_pept        542780..543085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0446"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: xcv:XCV1012 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91893"
FT                   /db_xref="GOA:B2I8I2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I2"
FT                   /protein_id="ACB91893.1"
FT                   /translation="MAKISMINRDLKRKRLAKKFADKRLSLKKVISSYASSYEEKIEAS
FT                   CKLQKLPRDSSPTRLRNRCEISGRPRGVYCKFGLGRNKLREAAMRGDIPGLRKASW"
FT   gene            543244..543642
FT                   /locus_tag="XfasM23_0447"
FT   CDS_pept        543244..543642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0447"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: xom:XOO_3373 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91894"
FT                   /db_xref="GOA:B2I8I3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I3"
FT                   /protein_id="ACB91894.1"
FT                   /translation="MSMTDPIADMLVRIKNAASVGKPNVRFPFSKVKLAIALVLKNEGY
FT                   IFDAKVIQSDNSKSDIEVVLKYFEGRPVIRILKRVSRSGLRKYCGKAELPEVLGGLGVS
FT                   IISTSKGIMTDSKARESGVGGEVLCFVA"
FT   gene            543655..544182
FT                   /locus_tag="XfasM23_0448"
FT   CDS_pept        543655..544182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0448"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: xom:XOO_3372 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91895"
FT                   /db_xref="GOA:B2I8I4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I4"
FT                   /protein_id="ACB91895.1"
FT                   /translation="MSRVAKKPISIPKGVEVSVQSDMLTVKGVKGVLTFPKSDNVNVVM
FT                   DGDILTLSANDHSHVSLAGTVRAILSNMIKGVSIGFERKLELVGVGYRASMQGKDLNLS
FT                   LGFSHPLLFVPPEGINLLTPSQTEVVVQGIDKQRVGEVAAKIRNFRPPEPYKGKGLKYA
FT                   TEAIMRKEAKKA"
FT   gene            544269..544628
FT                   /locus_tag="XfasM23_0449"
FT   CDS_pept        544269..544628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0449"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: xcb:XC_3324 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91896"
FT                   /db_xref="GOA:B2I8I5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I5"
FT                   /protein_id="ACB91896.1"
FT                   /translation="MSIGKNVARLRRAKSTRLHIRKLGVPRLSVLRTGRHLYAQIFTAD
FT                   GSKVIAAANTLQSQVKGGLKNGKNSLAAIKVGKLIAERARAVGVDRIAFDRSGYLYHGR
FT                   IKILADAARDAGLKF"
FT   gene            544807..545346
FT                   /locus_tag="XfasM23_0450"
FT   CDS_pept        544807..545346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0450"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   xom:XOO_3370 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91897"
FT                   /db_xref="GOA:B2I8I6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I6"
FT                   /protein_id="ACB91897.1"
FT                   /translation="MAEERSQRSRDRSREEKIDDGMIEKLVAVNRVSKTVKGGRQFTFT
FT                   ALTIVGNGEGSVGFGYGKAREVPVAIQKSMEYARKRMSNVSLNNGTLWHPVKANHGAAS
FT                   VFMKPASEGTGVIAGGAMRAVLEAVGVKNVLAKAIGSRNPINLVRATLKGLEDMQSPTH
FT                   IALKRGKNVRDFSHGS"
FT   gene            545336..545527
FT                   /locus_tag="XfasM23_0451"
FT   CDS_pept        545336..545527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0451"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: xoo:XOO3564 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91898"
FT                   /db_xref="GOA:B2I8I7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8I7"
FT                   /protein_id="ACB91898.1"
FT                   /translation="MVHEYDKTLKVCLVRSLIGVPSRHRLSVRALGLSKVSDMRKVNDT
FT                   PQVRGLINKVHYLVRIQD"
FT   gene            545534..545977
FT                   /locus_tag="XfasM23_0452"
FT   CDS_pept        545534..545977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0452"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: xac:XAC0991 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91899"
FT                   /db_xref="GOA:B2I8I8"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8I8"
FT                   /protein_id="ACB91899.1"
FT                   /translation="MSLRLNDLKPALGASSSRARVGRGIGSGLGKTAGRGHKGSFARKG
FT                   GGKIKPGFEGGQTPMQRRLPKIGFRSRSVANTAEVLSYKLDNLEPGEIDFASLRLAKLV
FT                   PSTAKKAKIVKKGRLTKVFVLKGIESTAGARAMIEATGGSFQE"
FT   gene            545985..547358
FT                   /locus_tag="XfasM23_0453"
FT   CDS_pept        545985..547358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0453"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: xcb:XC_3320 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91900"
FT                   /db_xref="GOA:B2I8I9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8I9"
FT                   /protein_id="ACB91900.1"
FT                   /translation="MSQPGLGNFGNRFAKSIELRNRLLFLLGALIVYRVGCYVPVPGVN
FT                   PEAMLALMQKQGGGIVDMFNMFSGGALHRFSIFALNVMPYISASIVVQLATHIFPSLKA
FT                   MQKEGESGRRKITQYSRIGAVILAVIQGGSIALALQNQTAPGGAAVVYAPGAAFVMTAI
FT                   VALTAGTVFLMWVGEQVTERGIGNGVSMIIFAGIVAGLPGSVLQTIDAFRSDALSLISL
FT                   LIIVFIVLSFTFFVVFVERGLRRITVNYARRVEGRNSYMNKSSFLPLKLNMAGVIPPIF
FT                   ASSILAFPVTLSMWSGQASSNTLFGAWLQRVSSALGPGEPLHMILFAVLIIGFAFFYTA
FT                   LVFSSQETADILKKSGALIPGIRPGKATSDYVDGVLTRLTAVGSLYLVIVCLLPEFMQS
FT                   RMGASFHFGGTSLLIAVVVVMDFISQIQVHQASNQYDGVSFFNKANLKGVSKKRRFVN"
FT   gene            547499..547855
FT                   /locus_tag="XfasM23_0454"
FT   CDS_pept        547499..547855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0454"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: xom:XOO_3366 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91901"
FT                   /db_xref="GOA:B2I8J0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J0"
FT                   /protein_id="ACB91901.1"
FT                   /translation="MARIAGVNLAIQKHVWIGLQSIYGIGRTRSRKVCDAANVAIYTKI
FT                   RDLSESEIERLRVEVGKYVIEGDLRREVGMAIKRLMDLNCYRGLRHRRCLPLRGQRTRT
FT                   NARTRKGPRKAIKK"
FT   gene            547871..548263
FT                   /locus_tag="XfasM23_0455"
FT   CDS_pept        547871..548263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0455"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: xac:XAC0994 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91902"
FT                   /db_xref="GOA:B2I8J1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J1"
FT                   /protein_id="ACB91902.1"
FT                   /translation="MSKQSVVKTKKRVKRVITDGVAHICASFNNTIVTITDRQGNSLFW
FT                   CTSGASGFRGSRKCTPFAAQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLSNV
FT                   GYKITNIIDVTPIPHNGCRPPKKRRV"
FT   gene            548278..548904
FT                   /locus_tag="XfasM23_0456"
FT   CDS_pept        548278..548904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0456"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: xac:XAC0995 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91903"
FT                   /db_xref="GOA:B2I8J2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J2"
FT                   /protein_id="ACB91903.1"
FT                   /translation="MARYIGPSCKLARREGADLSLKSPSRALDSKCKLEQRPGQHGAVR
FT                   KSKLSDYASQLREKQKVKRIYGVLERQFRNYYKNASTKKGNTGENLLQLLETRLDNVIY
FT                   RMGFAVTRPAARQLVSHRSVLVNGKMVNLPSYHVKPGDVVALSQRAQKYLCVQESLTIK
FT                   DQHGSAFSWIEVDSEKFSGVFKALPDRADLPSDINEALIVELYSK"
FT   gene            548959..549957
FT                   /locus_tag="XfasM23_0457"
FT   CDS_pept        548959..549957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0457"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: xom:XOO_3363 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91904"
FT                   /db_xref="GOA:B2I8J3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J3"
FT                   /protein_id="ACB91904.1"
FT                   /translation="MTVTVSQVLRPRGPQIERLTENRAKVVLEPLGRGYAHTLGNALRR
FT                   VLLSSIPGFAITEVEIDGVLHEYTTVEGLQEDVLEVLLNLKDVAIRIHSGDTATLSLFK
FT                   QGAGVVTAADIKTDHNVEIINDGHVICHLTKDTTINMRLKIERGFGYQPAVVRRRPDDE
FT                   NRTIGRLILDASFSPVRRVAYVVEAARVEQRTDLDKLIIDIETNGTIDAEEALRTAADI
FT                   LTDQLSVFGDFTHRDRGTVKPASSGVDPVLLRPIDDLELTVRSANCLKAESIYYIGDLI
FT                   QKTEVELLKTPNLGKKSLTEIKEVLGQRGLGLGVKLENWPPPGVSQYGMLG"
FT   gene            550089..550469
FT                   /locus_tag="XfasM23_0458"
FT   CDS_pept        550089..550469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0458"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: xcb:XC_3315 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91905"
FT                   /db_xref="GOA:B2I8J4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J4"
FT                   /protein_id="ACB91905.1"
FT                   /translation="MRHQKSGRKFNRTDAHRGAMFSNMIASLFKYQLIKTTLPKAKELR
FT                   RFAEPLITLAKVDSVANRRLAFARLRNKEAVGILFSNLGPRYITRPGGYIRLLKCGFRH
FT                   GDNAPMAYVEMLERPIIAEEVT"
FT   gene            551297..551557
FT                   /locus_tag="XfasM23_0459"
FT   CDS_pept        551297..551557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0459"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   xom:XOO_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91906"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8J5"
FT                   /protein_id="ACB91906.1"
FT                   /translation="MIDLNHLDTIANRLSDLLPPALYESRGELQTLFKDVLQAGLAKLD
FT                   LVTREEFEIQRVILLSTREKLETLLHTLVLLEDRLTDQGKN"
FT   gene            551568..553088
FT                   /locus_tag="XfasM23_0460"
FT   CDS_pept        551568..553088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0460"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: xcv:XCV4047 putative competence related
FT                   protein; TIGRFAM: Mg chelatase, subunit ChlI; PFAM:
FT                   magnesium chelatase ChlI subunit; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91907"
FT                   /db_xref="GOA:B2I8J6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8J6"
FT                   /protein_id="ACB91907.1"
FT                   /translation="MSLALVHSRARAGVFAPSVRVEVHLSGGLPATQIVGLPEAAVRES
FT                   RDRVRAALLCACFEYPARRITINLAPADLPKEGGRFDLPIALGILAASGQLPLDALAGK
FT                   EFLGELALTGELRSVDSVLPAALAASQAGHWLVIPESNGAEAAIAGCCEAYTARTLLEV
FT                   CAGLCGKTLLLAAQRFEVKSDVLHDIPDISDVRGQEEARRVLEIAAAGGHHLLLIGSPG
FT                   CGKTLLASRLPGLLPPASEQEALESASIASVSGHDLNLTHWRRRPYRAPHHSASAVALI
FT                   GGGVQARPGEISLAHNGVLFMDELPEWQRKTLEALREPMESGVVTIARATRSVDYPARF
FT                   QLVAAMNPCPCGWAGDSSGRCQCGLDAIRRYRRRISGPLLDRIDLQLEIPRLAPQLLRP
FT                   STPRGEHSVTVRRRVTDSRTLQYNRQAGLNAHLGQAATERHCCLDATDQRLLERAIEQL
FT                   QLSARSMQRILRVARTIADLDGSTLITSMHLHEAIGYRRFDRTAFGIA"
FT   gene            554321..554530
FT                   /locus_tag="XfasM23_0461"
FT   CDS_pept        554321..554530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_2702 CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91908"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8J7"
FT                   /protein_id="ACB91908.1"
FT                   /translation="MFLDSIEDAKDAKDAKDAKDAKDAKDAKDAKDAKDAKDAKDAKDA
FT                   KDAIGQAMEEVSTPQVLSFWRWWR"
FT   gene            555536..556669
FT                   /locus_tag="XfasM23_0462"
FT   CDS_pept        555536..556669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0462"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bch:Bcen2424_3915 triacylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91909"
FT                   /db_xref="GOA:B2I8J8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8J8"
FT                   /protein_id="ACB91909.1"
FT                   /translation="MRIISLAFSDLNFSGWVELINFIYYELMKKMLACVMSTVFFVNTI
FT                   ALVMLTGMGVASAASKDSYAATKYPIIFEPGFGGVDKLFVFIDYFYRIPEDLRAHGANV
FT                   YLSTSSAFQRPDGPNGRGEQLLAYVKAVLAITGAEKVNLIGYSQGGLTVRYVAAVAPDL
FT                   VASLTTIGTPHHGSELADYFEELLNKNPIRPLSTALGGLSNAFASITTANLNQDMFAAL
FT                   KSLTTSQVVIFNENYPSAGLDKLASCKGGAEFETFGSHRQYLYSWGGAAIKEKESLFGT
FT                   NVIDTSVIPFIDLANFVDPTTKALYRFGRVMINRGSGSNDGMVSTCSSMFGKVISNNFN
FT                   WNHFDEINQVLGIRGAYAEDPLAVIRTHVNRLKMQGL"
FT   gene            556670..557731
FT                   /locus_tag="XfasM23_0463"
FT   CDS_pept        556670..557731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0463"
FT                   /product="lipase chaperone"
FT                   /note="PFAM: lipase chaperone; KEGG: bps:BPSS1740 lipase
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91910"
FT                   /db_xref="GOA:B2I8J9"
FT                   /db_xref="InterPro:IPR004961"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8J9"
FT                   /protein_id="ACB91910.1"
FT                   /translation="MIKKYSFVNHRIVLYLILGCVVVCGVWYSFDVRQAIDVGAVDLSL
FT                   PQMSNNLLKEVAVGEGKTTNRLSRLPVDSTVPTVLPQSLAGSIAPPLPLDAYGHLARVS
FT                   AVRDFFDYFLTAQNDLTPAALDEIVTHEIVKQLHGKSAQAEAQDVWTRYCAYFSQLVKL
FT                   PDMGMVLGDKLDFVAVQRALDQRASLAVRTLGDWSEPFFGAEQQRQRYDLERLKIADDQ
FT                   ALTDEQKKKRLVALEQKLPSKVQEERIKIQQQQDAVVKIIQLQKDEVTPDGIRLQVVGL
FT                   LGPEVAYRVAEIRRQDEIWQEKYKHYAAQRAQRAQIEAQQLEPKEHDVQVENLRQRIFT
FT                   KPGEALRAASLDQ"
FT   gene            complement(558099..558185)
FT                   /locus_tag="XfasM23_R0025"
FT                   /note="tRNA-Leu3"
FT   tRNA            complement(558099..558185)
FT                   /locus_tag="XfasM23_R0025"
FT                   /product="tRNA-Leu"
FT   gene            558321..559613
FT                   /locus_tag="XfasM23_0464"
FT   CDS_pept        558321..559613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0464"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: xac:XAC2105
FT                   polysaccharide biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91911"
FT                   /db_xref="GOA:B2I8K0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K0"
FT                   /protein_id="ACB91911.1"
FT                   /translation="MVADKQGGPTLARIAVVGLGYVGLPLAVAFGRQRPTLGFDIDICR
FT                   VQQLCAGHDITCEIELEELQAARHLRYSSDPRELSDCQIFIITVPTPIDVVEQPDLGPL
FT                   RSASMLVASVLKPGDLVIYESTVYPGTTEEVCVPLLEAGSGLRFNVDFHCGYSPERINP
FT                   GDRKRRLQDICKIISGSTPDITAVVDALYSQIIVAGTWCAPSIRVAEAAKVVENIQRDV
FT                   NIALVNELALIFDRLGIDTLDVLEAAETKWNFLPFRPGLVGGHCIGVDPYYLLHKSESV
FT                   GYYPDLIHTARRVNNRVSRHVVDRVVALLGELSVPMTRAVVLVLGVTFKEDCPDLRNSR
FT                   ALDLVRMFRTLGAQVDVCDPCADPQQALEHEAVTLCTEPKAGAYDAIVLAVAHAQYRMY
FT                   DVATIAALGKSQAVVYDVKSVWPRAAVTDRL"
FT   gene            complement(560756..561217)
FT                   /locus_tag="XfasM23_0465"
FT   CDS_pept        complement(560756..561217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91912"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K1"
FT                   /protein_id="ACB91912.1"
FT                   /translation="MKRIQALVVLSLLFIANAQAQQGTLFCPQLPTTSKLHWDQNVGIG
FT                   FLFCKASNEEGRMVLGVILTTRDPNIPMTRNHRAEKSQIGSEKFYWYKLDLGIKNTPSQ
FT                   ENRRITVVTLGRKRYAQMWIDAQDEQELVMMQFVISKLDLESASLALLP"
FT   sig_peptide     complement(561155..561217)
FT                   /locus_tag="XfasM23_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            complement(562622..562705)
FT                   /locus_tag="XfasM23_R0026"
FT                   /note="tRNA-Leu2"
FT   tRNA            complement(562622..562705)
FT                   /locus_tag="XfasM23_R0026"
FT                   /product="tRNA-Leu"
FT   gene            563126..564421
FT                   /locus_tag="XfasM23_0466"
FT   CDS_pept        563126..564421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0466"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: trigger factor domain
FT                   protein; trigger factor domain; KEGG: xcv:XCV1080 trigger
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91913"
FT                   /db_xref="GOA:B2I8K2"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8K2"
FT                   /protein_id="ACB91913.1"
FT                   /translation="MPVLIESIGNLERRLTFSVPEDRLESHVDERLREIARAARINGFR
FT                   AGKVPAKVIEQRFGEKVRAEVLDSLLRETLDSAIRAHSLRLAGAARIDHANEGGLNFVA
FT                   TFEVVPDFGEIDVSKLGVVRRTAKVTDVDIDQMIENLRLQRRTWRVAEHGAQVGYLVAL
FT                   ETWSQAGDERLPIEGVEAGSTILGSGVMFEQIERGLEGLSKGDENVLDVTFPDDWRVMQ
FT                   LAGKAVQVHVKVIEVSEPVLLEVNEEFIKSFGVKSGKLEDFRADIRANLERELKGALVS
FT                   HLRREIGEQLIAAYAHVEMPPRLVEKEARLMLAKQIEQIRLSGRDPTVIPDDAHIGFMD
FT                   AACKRVLVGLLVGEIAGRNRLRLDPMRVTETLHLIASTYEEPEEVFQMYRNDPKLMEGV
FT                   QSLVMEEQVIEWIADRAQKTEQVLSFQEAIQQ"
FT   gene            564559..565185
FT                   /locus_tag="XfasM23_0467"
FT   CDS_pept        564559..565185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0467"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: xom:XOO_0932 ATP-dependent Clp protease
FT                   proteolytic subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; PFAM: peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91914"
FT                   /db_xref="GOA:B2I8K3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8K3"
FT                   /protein_id="ACB91914.1"
FT                   /translation="MDDVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDD
FT                   YMANLIVAQLLFLEAENPEKDINIYINSPGGVVTAGMAIYDTMQYIKPAVSTICVGQAA
FT                   SMGALLLASGASGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILALRARLNEILAK
FT                   HTGQSLETIAHDTERDNFKSAVDAQAYGLVDQVFGQRQEELIQSS"
FT   gene            565313..566593
FT                   /locus_tag="XfasM23_0468"
FT   CDS_pept        565313..566593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0468"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="KEGG: xom:XOO_0933 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; PFAM: AAA ATPase central domain
FT                   protein; zinc finger C4 domain protein; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91915"
FT                   /db_xref="GOA:B2I8K4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8K4"
FT                   /protein_id="ACB91915.1"
FT                   /translation="MSEDRQSRSGDGNKILYCSFCGKSQREVRKLIAGPSVFICDECVE
FT                   LCNDIIREELEEKSQSARSSLPKPKEILEVLDQYVIGQQRAKRTLAVAVYNHYKRIESR
FT                   HKNDDIELAKSNILLVGPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENI
FT                   IQKLLHKCDYDVEKAQHGIVYIDEIDKISRKSENPSITRDVSGEGVQQALLKLIEGTVA
FT                   SVPPQGGRKHPQQEFLQVDTKNILFICGGAFAGLDKVIQQRCNEVGGIGFGVKVKSSES
FT                   KRDVGKVLAGVEPEDLIKFGLIPEFVGRLPVVATLDELDESALVKILTEPKNAITKQFK
FT                   KLFEMENVELEFRQDALSAVARKALKRKTGARGLRTIVELVLLDTMYELPSQEGISKVV
FT                   VDESVIENKSEPYLIYQTMPAKVASGE"
FT   gene            566745..569216
FT                   /locus_tag="XfasM23_0469"
FT   CDS_pept        566745..569216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0469"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: xcb:XC_3263 ATP-dependent serine proteinase
FT                   La; TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16
FT                   lon domain protein; AAA ATPase central domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91916"
FT                   /db_xref="GOA:B2I8K5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K5"
FT                   /protein_id="ACB91916.1"
FT                   /translation="MTQSSQKALDLQVLPLRDVVVFPYMVIPLFVGREKSMRALEKAMD
FT                   ADKRILLVAQKTADIDDPGVVDLHAIGTYAQVLQLLKLPDGTIKVLVEGLTRVSVDQVV
FT                   EHDGALRGCGIEIASTQGREEREIEAIVRSLLSLFEQYVKTNRKLPPELLQTLSGIDDP
FT                   GRLADTIAAHLSVRLAHKQRLLETIEIGDRLEILIGLVDGEIDVQQMEKRIRGRVKSQM
FT                   EKSQREYYLNEQMKAIQKELGDFDDLPSELEELARKIAEIGMPKSVQSKAKSELNKLKQ
FT                   MSPMSAEAAVVRNYLDWLLGVPWRKCTKVRKDLKVAQSTLDDDHYGLDKVKERILEYLA
FT                   VQSRVKQMRGPILCLVGPPGVGKTSLGQSIAKATNRKFVRMSLGGVRDEAEVRGHRRTY
FT                   VGSMPGRVVQNLNKVGSKNPLFVLDEIDKMAMDFRGDPSAALLEVLDPEQNNAFNDHYL
FT                   DVDLDLSEVMFVATSNSLNIPGPLLDRMEVIRIPGYTEDEKLNIATRYLVPKQIRANGL
FT                   VVGELAIGEDAIRDIVRYYTRESGVRNLEREISKICRKIVKEIALVGVKPFAKKSTKSK
FT                   VLFAVTSKNLEKYLGVRRFDFGRAEEANEIGLVTGLAWTEVGGDLLQIESTLVPGKGNL
FT                   ILTGQLGSVMKESASAALTVVRSRADRFCIDVDFLHNQDVHLHVPDGATPKDGPSAGIA
FT                   MVTSLVSMLTKVPVRADVAMTGEITLRGRVSVIGGLKEKLLAALRGGIRTVLIPEGNRR
FT                   DLADIPANVTRALTIVPVKWIDEVLDLALESPLEPKVAAQLGKSKPRKAHSRVSTVRGK
FT                   SKGSSNARVRH"
FT   gene            569437..569721
FT                   /locus_tag="XfasM23_0470"
FT   CDS_pept        569437..569721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0470"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: xom:XOO_0935 histone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91917"
FT                   /db_xref="GOA:B2I8K6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K6"
FT                   /protein_id="ACB91917.1"
FT                   /translation="MNKTELIDGVAAAANLSKVEAGRAIDAVVNEITEALKEGDSVTLV
FT                   GFGTFQVRQRAERPGRNPKTGEPIMIAASNNPSFKPGKALKDAVKSSAG"
FT   gene            569723..569797
FT                   /locus_tag="XfasM23_R0027"
FT                   /note="tRNA-Val1"
FT   tRNA            569723..569797
FT                   /locus_tag="XfasM23_R0027"
FT                   /product="tRNA-Val"
FT   gene            569828..569904
FT                   /locus_tag="XfasM23_R0028"
FT                   /note="tRNA-Asp1"
FT   tRNA            569828..569904
FT                   /locus_tag="XfasM23_R0028"
FT                   /product="tRNA-Asp"
FT   gene            570292..572259
FT                   /locus_tag="XfasM23_0471"
FT   CDS_pept        570292..572259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0471"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: xcv:XCV1085 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91918"
FT                   /db_xref="GOA:B2I8K7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K7"
FT                   /protein_id="ACB91918.1"
FT                   /translation="MLQKLREKTSGWIATAIIGLLVIPFLFVIDVRYIGVGGKDDVAQL
FT                   QASPTWWKSAPAFWPISLLWQRQGISKQEFQSRFDQARLQQRAQQGEGFDAREFETLSN
FT                   KRKLLDQLIEEHVMRLVAEGAGVVISDEAVRTIIANDQRFQVKGKFNQDRYRLLLAQEP
FT                   TMRTPQMYESYVRSMMQLSMIPSAIFDSGFVPNTELERILALLGQTRNAELVTLPALKL
FT                   DTAEISDMQIKEWYAVHRDDFRQPETLSFEYVDLDAAHLPRPTPSEAMLRKRYDAQQRG
FT                   EAQNEQRKAAHILITAGADAASQKVAEAKAAKLVEEARKPGADFAALARINSQDPGSKD
FT                   AGGDLGWVQRGMMVKPFEDALFAMKVGEVVGPIKTEFGNHVIKLEEIKAAKQLPFEAVR
FT                   DQLAAEQTKEDIDKAFNDVTGKLMDLLVKNPTDLSSASEQLGLPLRKLGPLSRRDAVGI
FT                   AANPAVQRVLFNHDFIQEGKVSDPIQINPNHSVVLRVIAHTTEQQLPLDKVREQVVAAV
FT                   RADRAEKDEASAADALVARLQKGETLEEVAKAEKLQITPLTGLQRTAQVPAFAATRAIF
FT                   SALSPVAGKPTVGKVRLDDGRYAVFTVTRVIPGDLTKLPEEQKAMLRQQLDQIEGTLAV
FT                   HAYVDMMRKRFKVTIHKSQL"
FT   gene            573510..574547
FT                   /locus_tag="XfasM23_0472"
FT   CDS_pept        573510..574547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0472"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475; KEGG:
FT                   xcb:XC_4077 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91919"
FT                   /db_xref="GOA:B2I8K8"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K8"
FT                   /protein_id="ACB91919.1"
FT                   /translation="MLRDFRISFIFTAFCLSLAAWWGYSTALGVWQALWLCLVLSVLEV
FT                   SLSFDNAVINAGILKHMSEFWRKLFLTIGIFIAVFGMRLVFPIVIVAVATGMGLIPVMK
FT                   LALEHPEQYSLVLTDHYPSIAAFGGMFLLLVFLNFLFDNERQLHWLGPIERMLAKLGKA
FT                   DAMAVIVAVACLMGTKFFLPYEVFQDVLFAGLGGILLYLLVDSVDALFKMDGQEDGVMG
FT                   PGKRSGVAAFLYLEVLDASFSFDGVIGAFAITRDVVIIMLGLAIGAMFVRSITLYLVRK
FT                   GTLDEFVFLEHGAHYAIGVLAVIMLVGTVYHVPEVITGLMGVALIAASLWSSFQYRKRL
FT                   ITVGR"
FT   sig_peptide     573510..573593
FT                   /locus_tag="XfasM23_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.467 at
FT                   residue 28"
FT   gene            574850..575074
FT                   /locus_tag="XfasM23_0473"
FT   CDS_pept        574850..575074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91920"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8K9"
FT                   /protein_id="ACB91920.1"
FT                   /translation="MLGVRVVVVVSYRLRNGLCYPCFTILLYPKSLKCQPMLGHGSIMC
FT                   VSSKMMRYSESAFLMLLTVIRTCTLSDSV"
FT   gene            575749..578241
FT                   /locus_tag="XfasM23_0474"
FT   CDS_pept        575749..578241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0474"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: xom:XOO_0439 ribonucleotide-diphosphate
FT                   reductase subunit alpha; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; Ribonucleotide
FT                   reductase large subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91921"
FT                   /db_xref="GOA:B2I8L0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L0"
FT                   /protein_id="ACB91921.1"
FT                   /translation="MIPKEQFVAAIADSLPNPGHVAGSVPPVALSVFHPDEPEDEVPIP
FT                   RQTAMMHTRAVEEANVSTWITKEAGNRRMPFDCARLECAIDTIHQEFPQLDVAEYKRAV
FT                   FGFVERKDSVNADDLVDLLIREAESRVDLTAPEWEYFAARLYLRRLYKRASRNRFYDAS
FT                   QKYGSFVGLQESLADRNIYSNDILRSYSKEELIEAGQMIDPERDKLFTYNGLYLLATRY
FT                   LATDTSRGVFELPQERWLTIALYLMQDEYGPGKGGRERRMQLVGEAYWALSNLYMTVAT
FT                   PTLGNAGKINGQLSSCFIDTVDDSLQGIYDSNTDIARVSKHGGGVGAYLGYVRSSGSMI
FT                   RGVANSSGGVVPWIKQLNNTAVSVDQLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQR
FT                   LRAHDVFTSVCIPDLFMEAVERRGDWYLFDPYEVKRVKGWYLQDFYDEKRGDPNGSFRR
FT                   KYEDVVADERISRKTVKAIDIFKRIMVSQLETGNPFMFYRDEVNRKNPNKHVGMVYSSN
FT                   LCTEILQNMTPTRLIQEMISGNQIVTTKHAGDFVVCNLSSINLGRAITVQADLLGADVL
FT                   ERLIPIQVRMLDNVIDLNLLPVPQATITNQKYRAIGLGTFGWHHLLAQKAIHWNSQEAE
FT                   QYSDALYERINYLTIRASMELAKEKGTYAVFPGSDWQTGEYFRARDYNSPQWLELAAQV
FT                   AVNGVRNAYMVAVAPNMSTAQIAGSTASIDPIYSAFYYEEKKDYRRPVVAPGLSLDTWP
FT                   YYEKGAYKLDQFASIRQNARRQRHVDQSLSFNFYVPSTIRASTLLDLHMTAWREGLKTT
FT                   YYVRSNDIDISECEWCSS"
FT   gene            578310..579359
FT                   /locus_tag="XfasM23_0475"
FT   CDS_pept        578310..579359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0475"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: xcv:XCV4160
FT                   ribonucleotide-diphosphate reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91922"
FT                   /db_xref="GOA:B2I8L1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L1"
FT                   /protein_id="ACB91922.1"
FT                   /translation="MTNMAISLDRIKILEPRNPNRSTGIINGKTSGILNWNDIPYPSFY
FT                   RAYKELSTNFWIPDEVDMKIDKRQYGELSAREKNAYDAIIGLLATLDSPQTRFIYNVAE
FT                   YITDPAAHANAAIIGQQEVIHNESYSYVLASITDLANQNRVFEIARTHPTILKRNAPIM
FT                   QAYDDFMREKTAETLLYSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRD
FT                   ELAHTKFISEVIRAIVGENPELQTDALTDYVHQAFAHAIELETQWTGEVLDGIDGIDVE
FT                   EMIRYVKYRANKMAGMLGIQTLYTETTDNVMPWIRAYADNFTETKTDFFEMRNASYKKT
FT                   NVDNCFDDL"
FT   gene            579371..579853
FT                   /locus_tag="XfasM23_0476"
FT   CDS_pept        579371..579853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0476"
FT                   /product="ribonucleotide reductase-associated flavodoxin"
FT                   /note="TIGRFAM: ribonucleotide reductase-associated
FT                   flavodoxin; PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   xac:XAC4073 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91923"
FT                   /db_xref="GOA:B2I8L2"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010088"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L2"
FT                   /protein_id="ACB91923.1"
FT                   /translation="MRILLALASLSGNTREVARVIRARCEERGHRVDWIETDLQTLAGQ
FT                   ALDPHTYTLFLLGTWTDNAGRTPFEMKRFIVELLELIGKPPSVAVFGTGETQWGQEYYC
FT                   GAVHRISDFFASRFPRLLIEQMPHGERDALAIVEWTDQVLDQCNKDSDADHYRYVA"
FT   gene            579825..580151
FT                   /locus_tag="XfasM23_0477"
FT   CDS_pept        579825..580151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0477"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: xom:XOO_0443
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91924"
FT                   /db_xref="GOA:B2I8L3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L3"
FT                   /protein_id="ACB91924.1"
FT                   /translation="MQIITATSPDEFNAALKAHSRLLVDFYKEHCPGCRMLDMALNKFA
FT                   ATDAAAGVVVLKIRLETIGEDFFRDLGLRQTPTLGVFKNGLEVSRLLGFQSLAQIEAAV
FT                   QTYL"
FT   gene            580557..581267
FT                   /locus_tag="XfasM23_0478"
FT   CDS_pept        580557..581267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0478"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: xac:XAC3678
FT                   ribosomal small subunit pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91925"
FT                   /db_xref="GOA:B2I8L4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L4"
FT                   /protein_id="ACB91925.1"
FT                   /translation="MKLLKYIANLGYGSRKEVARIFREGRITNDEGEVLYADDHVQHTA
FT                   VRFDGEPLDPPPGLMVMLHKPSGYICSTKDAGRLVYDLLPARFRLRSPLLSTVGRLDGD
FT                   TSGLLLLTDDGALLHRMISPKTHLPKVYEATLVQALRGDEATLFASGTLLLDGDTKPLQ
FT                   PAVLEVLGPCQVRLTLYEGRYHQVRRMFGATGNRVNTLHRSAIGGLVLDGLPEGQWRVL
FT                   EAQDLAMLFSQGSR"
FT   gene            581267..581944
FT                   /locus_tag="XfasM23_0479"
FT   CDS_pept        581267..581944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0479"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xom:XOO_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91926"
FT                   /db_xref="GOA:B2I8L5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L5"
FT                   /protein_id="ACB91926.1"
FT                   /translation="MVSAPLSFMPEAVIFDMDGLMLDSERVSIECRCRAAFDLEHQIEP
FT                   DYWLQMVGVSDIACHVQLSARIGAVSATALLARSDALYEAVVMKGVPHRPGIVTLLEWL
FT                   FARGIPCAVGTSTRRPLALRKLNTAGLLSRFDVVCTASEVAQAKPAPDIYLLAAHTLGI
FT                   VPRRCLVVEDSPIGVRAALAAGMTPIQVPDLLMPDAQVSALGHRIVASLTEVQSLLEAC
FT                   FDV"
FT   gene            complement(582740..583297)
FT                   /locus_tag="XfasM23_0480"
FT   CDS_pept        complement(582740..583297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0480"
FT                   /product="protein of unknown function DUF1415"
FT                   /note="PFAM: protein of unknown function DUF1415; KEGG:
FT                   xom:XOO_0644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91927"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L6"
FT                   /protein_id="ACB91927.1"
FT                   /translation="MTATIADPLALTRQWIERAVIGLNLCPFAKAVYIKQQLRLVLSDA
FT                   TKPETLLEHLAKELLLLRDTPAEHIDTTLIVHPHVLTDFLDYNDFLDNVDAIIKTLDLQ
FT                   SILQVASFHPKYQFHGTAPDDMSNYTNRSPYPSLHLLREKSVDHAIAAFPDPNVIVQRN
FT                   IQTLKRLGNTGWQQVLAGTQIE"
FT   gene            583890..584126
FT                   /locus_tag="XfasM23_0481"
FT   CDS_pept        583890..584126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0481"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: xom:XOO_4295 50S
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91928"
FT                   /db_xref="GOA:B2I8L7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8L7"
FT                   /protein_id="ACB91928.1"
FT                   /translation="MSRVCQVTGKRVQTGNNVSHANNKTRRRFLPNLHKRRFWVASENR
FT                   WVKLRVSTCAVRTIDKNGIDAVLAELRASGEKV"
FT   gene            584140..584304
FT                   /locus_tag="XfasM23_0482"
FT   CDS_pept        584140..584304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0482"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: xom:XOO_4296 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91929"
FT                   /db_xref="GOA:B2I8L8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8L8"
FT                   /protein_id="ACB91929.1"
FT                   /translation="MAGKRDKIRLISSADTGHFYTTDKNKKNTPGKLEFKKYDPRVRRH
FT                   VIYKEGKIK"
FT   gene            584490..585893
FT                   /locus_tag="XfasM23_0483"
FT   CDS_pept        584490..585893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0483"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   xcb:XC_4117 cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91930"
FT                   /db_xref="GOA:B2I8L9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8L9"
FT                   /protein_id="ACB91930.1"
FT                   /translation="MEGTWLFALDWVIRLVALLWIPARTTPSAARSWLLLIGFVPVFGL
FT                   PLYLVFGHPWLSRKRVLRQALASHVIREWQRGLGALRWQPQENGVAAELVPLVEHQGDF
FT                   MPTRGNALDLLDDYQASLHLLINDIDSACERVHLLYYLMFDDAVGDAVVAALQCAAARG
FT                   VSCRLLLDAVGAKRGLRAYQQCLRAHGVEVHAMLPGGLRWRRSGRMDLRNHRKIAVIDN
FT                   RVAYIGSQNLACPDFVPHFPNRELVARVCGPAVSHLEAVFLSDWFVETGQRLGMRPDVP
FT                   ICEQNVAAQLVASGPAYPYENARDAVNTMIHLARRRIVLTTPYFVPDEATFSALRIAGT
FT                   SGVDVQLILSESNNQFLMAWAQEAYFEELLRAGIKIALYRPHFLHAKHLSVDDDIALFG
FT                   SINLDIRSFALNAEIGMICYDSRIVTRLREVESDYLANARQLNLVEWQQRPAWRRSREG
FT                   IARLADALM"
FT   gene            586275..586892
FT                   /locus_tag="XfasM23_0484"
FT   CDS_pept        586275..586892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0484"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   xom:XOO_0885 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91931"
FT                   /db_xref="GOA:B2I8M0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M0"
FT                   /protein_id="ACB91931.1"
FT                   /translation="MKLYIKPGACSLADHILLRWSGSSFDLQFLDHQSMKAPEYLALNP
FT                   SGAVPALQVGDWVLTQNAAILNYITDIAPAECGLSGDGSLKARAEINRWIAFSSSDVHP
FT                   MYWALFGGTTYLQDPQMIARSQDNARQKLRVLYQRADAHLKHHNWLANGQRSGADAYLY
FT                   VTLRWAKKVGVDLSSLDALSAFFERMEADPGVQAALQAEGLI"
FT   gene            complement(587063..588049)
FT                   /locus_tag="XfasM23_0485"
FT   CDS_pept        complement(587063..588049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0485"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: xcb:XC_3307 malate dehydrogenase; TIGRFAM:
FT                   malate dehydrogenase; PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91932"
FT                   /db_xref="GOA:B2I8M1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I8M1"
FT                   /protein_id="ACB91932.1"
FT                   /translation="MKALVRVAVTGAAGQIGYSLLFRIAAGEMFGKDRPVILQMLELPD
FT                   EKAQAALKGVMMELEDCAFPLLAGMVVTDNPDIAFKDADAALLVGSRPRGPGMERKDLL
FT                   MENAKIFTAQGAALNKVARRDVKVLVVGNPANTNAYIAMKSAPDLNPKHFTAMLRLDHN
FT                   RALSQLSTKLGKPVANIEKLIVWGNHSPTMYPDYRFATADGTPIIEAINDQAWNANSFI
FT                   PTVSKRGAAIIEARGLSSAASAANAAIDHMRDWLLGSNGKWITMGVPSDGSYGIPEGMI
FT                   FGFPVTTTNGEYSIVKDLPIDTFSKTYIDKTLAELEEERASIAHLLR"
FT   gene            complement(588182..588676)
FT                   /locus_tag="XfasM23_0486"
FT   CDS_pept        complement(588182..588676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0486"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: xcv:XCV1033 peptidyl prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91933"
FT                   /db_xref="GOA:B2I8M2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M2"
FT                   /protein_id="ACB91933.1"
FT                   /translation="MHLIAHLDTVRGPIKINLFADKTPLTVANFVNLAKRGFYDGLNFH
FT                   RVIANFMIQGGCPEGSGHGGPGYHFEDETNNGMCHERGSLSMANAGPNTNGSQFFITHV
FT                   ATPWLDGKHTVFGKVLDGQDVVDAIAQGDIINKITIEGDTDGVLALKTDRIIEWNSILA
FT                   T"
FT   gene            588917..590746
FT                   /locus_tag="XfasM23_0487"
FT   CDS_pept        588917..590746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0487"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: xom:XOO_0888 GTP-binding elongation
FT                   factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91934"
FT                   /db_xref="GOA:B2I8M3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M3"
FT                   /protein_id="ACB91934.1"
FT                   /translation="MSIENLRNIAIVAHVDHGKTTLVDQLLKQSGTFSERAQVGERVMD
FT                   SNDQEKERGITILAKNTAIKWNGNRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAMD
FT                   GPMPQTRFVTQKAFAMGFKPIVVVNKIDRPGARPDWVVEQVWDLFDRLGATPEQMDFPI
FT                   VYASALNGYASLESSARAGDMNPLYEAIMQHVQPPQVDLHGPFQMRISQLDYNSYVGLI
FT                   GIGRIQRGKVSTNMPVTVIDRMGNKHNGKVLQVLGFLGLERHEVEEAQAGDIVAISGIE
FT                   SLSISDTLTDPTAPDALPALSVDEPTISMTFQVNNSPFAGQKEYSGGKFLTSRQIRERL
FT                   ARETLHNVALRVEDTEDPDRFKVSGRGELHLSVLIETMRREGYELGVSRPEVIIKEIDG
FT                   ILQEPYEQLVVDVEEEHQGGVIERLGTRKAQLSNMELDGKGRVRLDYIIPARGLIGFQT
FT                   EFKTITSGSGLLFHIFDHYGPKADGPIAKRINGVMISNGHGKAPGYALMGLQERGRLLI
FT                   DAGEDIYEGMLVGIHSKDNDLTVNALREKQLTNIRASGKDDAISLTPPIKMSLEQALEF
FT                   IEDDELVEVTPKAIRLRKKYLSENDRKRASRTG"
FT   gene            590766..591248
FT                   /locus_tag="XfasM23_0488"
FT   CDS_pept        590766..591248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91935"
FT                   /db_xref="GOA:B2I8M4"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M4"
FT                   /protein_id="ACB91935.1"
FT                   /translation="MTDKPCNPDSHSHSGLHAIALFEAFKGVLTLVGATGLELLGPLPL
FT                   QNIVSNLIRLLHLDPEHGFLPSLLKMIDPNAVHLAAVLMLAYGVLHLIEFWGLWRVKAW
FT                   ASLLGCVSAAIYLPFDIYAIIHHPGWPSWSVLAINLLVVAVLTRDLIRRRYASALH"
FT   gene            591492..592754
FT                   /locus_tag="XfasM23_0489"
FT   CDS_pept        591492..592754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0489"
FT                   /product="colicin V secretion protein"
FT                   /note="KEGG: xom:XOO_1677 colicin V secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91936"
FT                   /db_xref="GOA:B2I8M5"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M5"
FT                   /protein_id="ACB91936.1"
FT                   /translation="MKDLFRKEVLEAKRTSWLGGISLIQPIKAWLLVFASSVMALLVVV
FT                   FLCVGTYTRRSSVTGQLVPSKGLVTVVAPATGMVSQIKVSEGANALSGQILALVTVPRT
FT                   TLASGDAIRALEQQLQERKQGLSMGQQAQAQVLSAQTSGIEAQLSAAQRELAQIEIEIA
FT                   TRQKQIQIANETLQRLKQLEDARYVGTLQIKQQESTVLDYTSQMQAMQRQAIMTRRSIA
FT                   QLQQSLRELPGQYQNSQATYRRELAQLEQEKVETEARGALSVVSPIDGIVATQIVKSQQ
FT                   TVQAGQPMLSLLPVNGELEAELLLPSSAIGFIEQGDEVRLRYQAYPYQKFGHQRGQVSR
FT                   ISRSALTSSELAALIGNTQQTEPYYRVIVKLPQQSITVYGRHEPLKPGMLIDADILSEK
FT                   RRLIEWIFEPLYSLRGKVSDN"
FT   gene            592979..593233
FT                   /locus_tag="XfasM23_0490"
FT   CDS_pept        592979..593233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91937"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M6"
FT                   /protein_id="ACB91937.1"
FT                   /translation="MGIDKVRELTVREIESVDGGVYFLNLNYRSLGGLIRTPMLTFFGI
FT                   GNTAIAVNFGRGSSFYIKPTLNIDTVNATSITQEINQGT"
FT   gene            593381..593686
FT                   /locus_tag="XfasM23_0491"
FT   CDS_pept        593381..593686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91938"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M7"
FT                   /protein_id="ACB91938.1"
FT                   /translation="MEMNQMRELAFQEIENVDGAFFFVIYPKSFSNGTVSSISFTTGSN
FT                   VTGNSGSLTLPDPAVSGPVLSGIGFFGTGTGFLRTSSRHVSIGTVNLYNVIQKIDL"
FT   gene            593912..594145
FT                   /locus_tag="XfasM23_0492"
FT   CDS_pept        593912..594145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91939"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M8"
FT                   /protein_id="ACB91939.1"
FT                   /translation="MRELVMQEIRRVDGGIFFFVSPNVSSSSSFDSFPASALTPPFKHS
FT                   GSNVSLFGFNFGRIVSQDFYVRSVKIYNIIQE"
FT   gene            594319..594495
FT                   /locus_tag="XfasM23_0493"
FT   CDS_pept        594319..594495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91940"
FT                   /db_xref="GOA:B2I8M9"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8M9"
FT                   /protein_id="ACB91940.1"
FT                   /translation="MENVHGGCCCEIIIGASILIGAVAIGLLSLAAIGITVLTVAAIAV
FT                   AMHNDACSISSSQ"
FT   gene            594818..596941
FT                   /locus_tag="XfasM23_0494"
FT   CDS_pept        594818..596941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0494"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: xom:XOO_1681 colicin V secretion
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91941"
FT                   /db_xref="GOA:B2I8N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033838"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N0"
FT                   /protein_id="ACB91941.1"
FT                   /translation="MRSVLQSEVSECGLASLAMVANAHGKHLTLSQLRQRFPSSLKGAK
FT                   LTHLVHIAQQLGFSTRPLRLDMEDLGKLKLPCILHWDLNHFVVLAKVGTTKVTIYDPAI
FT                   GKRKLSLNEVSKYFTGIALELTTTTEFKQQKPPPSISARQLTGPIRGLWRALAQILLLS
FT                   LALQVFVVLSPFYMQWVVDQVLVSADRDLLVVLGLGFGLVLLLQIAIGLFRSWSVIYLS
FT                   SRLGLQWMGNVFAHLLKLPLEYFEKRHLGDLTSRMSSVQSIQKTLTTSFVEAIIDGLMT
FT                   LVTLGLMLVYSWKLALVTLVAVVLYMVIRAVSYWPVRDCTEQQLVVGAKQQTHLLESLR
FT                   GIQSLKVACEESLRRSTYENLLNDTVNQEVRLARMSLGFSTASQLVFGLERIAVIWYGA
FT                   TLALSNVFSVGMLIAYLSYKDQFASRISSLIDKWVEFRMLRLHGERLADIVLTPPEEDY
FT                   ELPEMQLQKKEPDIEVEGLSFRYGEDEPWVLKDCSFKVAAGESVAIIGASGCGKTTLMK
FT                   LLLGLLKPTAGTIRISGRDLHKFGTRNVRSIVGAVMQDDQLFAGSVADNISFFDPDFDL
FT                   ERIEAAAKLAAIHEDIAAMPMGYHALIGDMGSALSGGQKQRVILARALYRQPKLLFLDE
FT                   ATSHLDVMRERLVNDAVHQLKLTKVIVAHRPETIASTDRVVILDHGRIVQTVAMPEDRD
FT                   DSIEIVHNTIQST"
FT   gene            complement(597477..598256)
FT                   /locus_tag="XfasM23_0495"
FT   CDS_pept        complement(597477..598256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0495"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: xcv:XCV4153 ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91942"
FT                   /db_xref="GOA:B2I8N1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N1"
FT                   /protein_id="ACB91942.1"
FT                   /translation="MTNTPSNTQRNLTALSTIVRREVRRILRIWSQTLVPPAITMGLYF
FT                   LIFGKLIGTRVGQMDGFDYMHFIVPGLVMMSVIQNSYGNISSSFFGAKFGRHVEELLVS
FT                   PMPNWVILWGYVAGAVLRGVMVGAIVMVIAMYFTPVRLPYPLVTLSTAVLGAIIFSLAG
FT                   FINATYAKNFDDIAIIPTFVLTPLSYLGGVFYSVKLLPGWAEAATYANPIFYMVNAFRY
FT                   GLLGHSDVPLWKAYALMLTFIAGLSALSLWLLRREID"
FT   gene            complement(598336..599268)
FT                   /locus_tag="XfasM23_0496"
FT   CDS_pept        complement(598336..599268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0496"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xac:XAC4065 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91943"
FT                   /db_xref="GOA:B2I8N2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N2"
FT                   /protein_id="ACB91943.1"
FT                   /translation="MNSTIPNTPALHVYNLHKTYSNGTQALKGISLDITPGDFFALLGP
FT                   NGAGKSTLISIVSSLVNLSSGSVEVFGIDLVHERSAAIRLIGLVPQEINFNLFEKPLDI
FT                   LINYAGFYGIPYAKAEALAEIELKRAHLWGKAHVMSRTLSGGMKRRLMIARAMMTQPRL
FT                   LILDEPTAGVDVEIRRDMWRVLQEINANGTTIMLTTHYLEEAESLCRNLAIINGGQIIE
FT                   KGPMRTLLAKLDVEGFLLDIDGTLPAQLPSIEDTTLNALDDHTLDLSMPRAMNLNQVFA
FT                   ALSAANIQVRSMRTKSNRLEELFIRLTST"
FT   gene            600114..603791
FT                   /locus_tag="XfasM23_0497"
FT   CDS_pept        600114..603791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0497"
FT                   /product="pilus tip-associated protein"
FT                   /note="KEGG: mpt:Mpe_A3408 pilus tip-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91944"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N3"
FT                   /protein_id="ACB91944.1"
FT                   /translation="MKEQDLMVGMSRIILNNLFFFRCVVAVFSAHSLVISGAVHAGVQI
FT                   SQSPLHGGGDVPGNLAIVASIEFPTVISVANLADTYTPGVRYVGYFDSNKCYKYHYSSR
FT                   ELDRYFYPVASPRPQANYGCNTTGGVWAGNFLNWAATQTIDPFRSALTGGYRVRDTANE
FT                   TILEKAVMDRAYPGNFPRRTIEGLALTTSVPAQWLRFRMRIDGLGNRMRFTQFPGLSTD
FT                   PLNTEGQPYDPSRHPLNSNDRGVYEVSVRVKVCDASVGLESNCVAYPSGFYKPEGLVQE
FT                   YSKRVRYSVFSYKNDDYYLDDGGVLRARQKFVGPKTYYPEQGEKTNPHAEWHPRTGVLY
FT                   DNPNPEDAKATTHRVGRTIGNSGVINYLNKFSQMETGKNTKGFDPVSELYYTAYRYFKR
FT                   LGNVPEYSVLTGSVNEKYQQADAFPVITDWDDPIRYACQSNVVLGIGDTHTNFDKNLPG
FT                   NTNTTGEPVKPQAVRNDRSIDVVKRMAQIFQMEGMRQQDAMTSALAPSFNFLVPGAGNN
FT                   SAYIAALAYDAHTKDMRPDLEGDQLLTTHWVDVVEGGDYKIPISTNQYWLAAKYGGFQV
FT                   PAGYDPDKTVNPLSEATWWTNGEYVNGDTKAKRADNFYIAADAEKMVASLKHAFSRIVA
FT                   EIKGAGTGLSSNSARLETGAVTYQAQFFSGTWRGDLIAYHVDKVTGALTPFWNANFPAW
FT                   EQRVIKFANATTLQDFTKKNLGQTALASASAQQINYLRGDRSQEGNVPGKLRIRSGIMG
FT                   DIVNSQPLYVGAPNGRLYTTANFTGASAYAAFAAQQANRVPVVYVGANDGMLHAFDANT
FT                   GKEIFAFVPRAAMPKLLEYTDQNYGHQYYVDGELTAADIYDTKLGWRSVLVGTLGRGGK
FT                   GLFALDVTDPSNIRLLWDKTSADIGGLGNTLSKPMIAQTSDGTWSVLLGNGPNSTADNA
FT                   QLIVMNLLTGHAAQVPVSKTSNNGLSGVFPWSSQSNGITDRVYAGDLLGTLWRFTFSDN
FT                   AWKVAPLFTATYQGKAQPISATPLGAIERSTGRMWIFFGTGRALSSHDMDNKEVQSWYG
FT                   LIDQGTTIPGRTRLSQVQIVDEGVVNGYAVRTVSDPKNIGTDGWYMDLISPKSGKQGER
FT                   MIVSNMFRGAALIGTTRIPDNSDICKLSGSGFVMAINPFTGGRLGQWFFDLNTGGGSGG
FT                   ALNGNPVSGVGVSSAPNSPVFTGNIMQIGADDGTVTSLKTPSSGGLNINRVSWREILRP
FT                   "
FT   sig_peptide     600114..600239
FT                   /locus_tag="XfasM23_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.726) with cleavage site probability 0.724 at
FT                   residue 42"
FT   gene            complement(604200..604688)
FT                   /locus_tag="XfasM23_0498"
FT   CDS_pept        complement(604200..604688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91945"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N4"
FT                   /protein_id="ACB91945.1"
FT                   /translation="MLRFATAGFFYVLLTPMVKASTPHYSVNTPFNQSTPTTVVTPINT
FT                   MFYNPQTPLGIPGKALSQRYNREYLMDPMLLHLRVNSRQSIAKTKTTSTESTANSNNKT
FT                   ETDYKKQTIYDNTPWRFNMNQQGKRMTADEFDAWMKARGVHVIPSQTNNNVQSVSEAK"
FT   sig_peptide     complement(604626..604688)
FT                   /locus_tag="XfasM23_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.929 at
FT                   residue 21"
FT   gene            604953..605162
FT                   /locus_tag="XfasM23_0499"
FT   CDS_pept        604953..605162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91946"
FT                   /db_xref="GOA:B2I8N5"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N5"
FT                   /protein_id="ACB91946.1"
FT                   /translation="MCVAGGIEDDFYFLVLMCCVICQSVHPWLIFPASAYLGLKVILFV
FT                   SVFCDSALYDFVMLDLLVDSQLPS"
FT   gene            complement(605609..605998)
FT                   /locus_tag="XfasM23_0500"
FT   CDS_pept        complement(605609..605998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91947"
FT                   /db_xref="GOA:B2I8N6"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N6"
FT                   /protein_id="ACB91947.1"
FT                   /translation="MNKFTAMTDRALKHTMDLAQQANDRIRRTAPQASQWLKSGAALEV
FT                   VKSSRKVTGKLIKRNPSIAVAVAAVSVGLAGYMIYRKYKMNHKKKIVINGKGEHMLNEH
FT                   ADHVEVRRSIHRHRSAAAPTDNNSG"
FT   gene            complement(606264..608765)
FT                   /locus_tag="XfasM23_0501"
FT   CDS_pept        complement(606264..608765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0501"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="KEGG: xcb:XC_0285 ATP-dependent RNA helicase;
FT                   TIGRFAM: ATP-dependent helicase HrpB; PFAM: helicase domain
FT                   protein; helicase-associated domain protein; Helicase
FT                   ATP-dependent domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91948"
FT                   /db_xref="GOA:B2I8N7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N7"
FT                   /protein_id="ACB91948.1"
FT                   /translation="MNHHALPIDALLPAITTSLSNHPRLILEAPPGAGKTTQVPLALLD
FT                   APWLNGRSIILLEPRRVAARNAALFMARQCGEEVGGLVGYHIRFESKVSARTRIHVVTE
FT                   GILTRIIQDDPLLDGIGALLFDEFHERHLASDLGLALALDVQTQLREDLRIVVMSATLQ
FT                   GQRLAQFLDAPRLTSEGRAYPITITHFPARRDESLETQASRAIQHALDTHQGDVLTFLP
FT                   GQREIARLQAILEKTLSPELHVMPLHGELPLQEQTRVLEPDQHGRRRIVLATNVAESSI
FT                   TLPGISVVIDSGLAREPAYDPNTGFTRLDVVSITQASADQRAGRAGRLAPGWAYRLWPQ
FT                   SQRLEAQRRPEIIQTELSGLALELTAWGSSTLRFIDPPPSGALSAARELLQRLGAISNT
FT                   STLTPLGKRMLALGIHPRLAAMLLAPHDPQEQALACDLAALLDARDPLRGSGDALISRW
FT                   RALAELRSGCLPHDTKRSTLKAIDATTHQWRRRIRCDATPPDAIEAHTLGNLLTYAFPE
FT                   RIAARHSSDPLYYVLANGRRMRLLDNSALHGEPWIIASELHHGIKDIQLLCGAPLDERK
FT                   LHADFPERFIQHDVIRWETDKRALVAQRESCFDRIVLDVRPAGRIDPVQAANVLTGAVR
FT                   TLGLDTLSWTEHLRQWQARAVALRHWIPELELPDLSNTTLLATLDTWLRPAFAGKTRLD
FT                   ALDEAAFEQAVKSLLSWTQHALIDRHVPAHIIVPSGMGRHIDYGLADDGTPQPPVLSVK
FT                   LQELFGLPDTPRIAKNRIPLTLHLLSPGGRPLQVTQDLKSFWTNTYPEVKKEMKGRYPK
FT                   HPWPDDPWTATATHRTKSPGK"
FT   gene            complement(608762..609013)
FT                   /locus_tag="XfasM23_0502"
FT   CDS_pept        complement(608762..609013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91949"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N8"
FT                   /protein_id="ACB91949.1"
FT                   /translation="MLEAMRSKIECTTLFLLNPTASPLKIGGGVKHPFAMRCYDPRVLG
FT                   SHGRLLECLLLSIKVGNQAVQKDEFNGGHLNPHLLCAA"
FT   gene            complement(609275..609757)
FT                   /locus_tag="XfasM23_0503"
FT   CDS_pept        complement(609275..609757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0503"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xom:XOO_0696
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91950"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8N9"
FT                   /protein_id="ACB91950.1"
FT                   /translation="MLAPFILTGNKPEQYAQLEAQAKALIHGETDRIANAANLAALIFH
FT                   SLPGLNWVGFYFYDGRELVVGPFQGLPACIRIPLDKGVCGAAARTQRTQRIDDVDTFPD
FT                   HIACDSASRSELVVPLLKDNTLIGVLDLDSPTCARFDSDDQTGIESLARVFVSNLR"
FT   gene            610019..611908
FT                   /locus_tag="XfasM23_0504"
FT   CDS_pept        610019..611908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0504"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: xac:XAC4204
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91951"
FT                   /db_xref="GOA:B2I8P0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P0"
FT                   /protein_id="ACB91951.1"
FT                   /translation="MMRTAWMLHLQDLEVLRCFWNVRFITLSILPRYTAQMLRRFIPPM
FT                   LSLWLLFASLAQANATVDKIQIKGLDKGDDVEMMKNITVSLSLYSVVGKEQGESRLEYL
FT                   LSQAEFQTRQALEPFGYYAPAIRIDAPRQNDHITVVIYVDKGEPVRIRQAHVAMTGAAA
FT                   QDHYLQRDLEDFKPKLGEIFNHPTYEASKVRITRRLAERGYFDADFTRRQVEVTRATYA
FT                   ADIDLIWESGRRYDMGPVRFHYDYFHEGLFNPLVYWEEGSYFHEGKLDRLRESLTKLDY
FT                   FSSIDIQPKPEEADSEGNVPVDVKLERAKSKIYTAGISYGSESGAGLRAGVERRYMNAR
FT                   GHKMNARLDYAQNRKSLTTAYQIPAFKWLDGWYIFSARAYDEQTQYIDLRNVKLSAARS
FT                   GQINRHLTATASLNALRERWRYAADDGTNTVAYQHSTLVYPQLEASYVDVDDATFPRNG
FT                   SAATVLLRGGASAFGSKSNFTQLHGQLRWFHGLGSSSRLILRGEVGTTWASDLVAMPPS
FT                   LRFFAGGVNSIRGYAFREVGPRTAKPDAFALGAKHVFSAGAEYEYYYKGGPFGGAVFVD
FT                   SGSAFNRYPDWHTGIGIGLRYRSPVGPVRVDIARGLNKPDSKIQLYIDIGANL"
FT   gene            611905..615726
FT                   /locus_tag="XfasM23_0505"
FT   CDS_pept        611905..615726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0505"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   xcb:XC_4175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91952"
FT                   /db_xref="GOA:B2I8P1"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P1"
FT                   /protein_id="ACB91952.1"
FT                   /translation="MNAPQPIGALRRHRLWFGIGLIATGLFLTLLALLYWLLQTTSGRD
FT                   ALLAQVVTRLPAATALTWDRAEGAVAGPLTLHNIEFRYQDIHFRAARLRMDPDIWRLLL
FT                   LRLRLDVLEMSNASLSLGQSEEPFKLPSWPDVLPSINVPLALQIDTITIDNFRISKLKQ
FT                   PLIHLRRIRGAVNVADGELEIQRLAVDSDRGNIRADGYYRPRHDYSTDLTATAVLPSVR
FT                   GRPPASFGLVIRGDLDRLQLALAGRAPAPLQADVVLNGRSDPRWTFSAASEHFEPGLLL
FT                   PGELTGTPPATALAFNVHAQGQGGKADLKGQFKQGEQTIVLQPSRLQLANQMLMVEPLV
FT                   IDAFGGRTNLRGKVDLRDPANTRFHFSVNARGLSFKPSPEPGNTQIRAVPVVLEEAGLG
FT                   VSGTLRAWAAVGRARLTRDAQQARLIFDVRGDAEHATFKQVQAATPGGLLDFTGGVTWA
FT                   PALRWDLKAELAQFDPGYFIPGWNGHVSGQLTSQGRQRTVSSGIEAIVAVPGLNGQLRQ
FT                   RPMQASGRFTLKDHQGEGAFQLGIGDSHISAKGKVGPHLDLAVQLQSLHLNDLLPSKEG
FT                   TLKGSLLLRGPAHTPDVIVDLNGTSLRWNDYRAKQFALHGHLPWRGNNGKLTLQAQELE
FT                   IGTLLDSVRIHASGAVENLNLQADVRHAMVLLTLHGGVHRDGARWRGNLSQLRIEPARG
FT                   PAWALRAPAQFVMNAPAFTLSATCLDAQGGGALCLHADWPHEGLVLKGQALPLTLVHPW
FT                   LPKKNGRSINLRGVLTLDGHLRPHGDAWEGSFRASSLEGGIRLGEPRYADVLGVQDRGE
FT                   LVRYDQFSVQVDLTSQHIVGKLGIGFQGNGFVDAKFNTGWDPYAPLTGDLYMNMSRLYW
FT                   LEMFVPDIGNPRGLIEGHVSLRGTRSGPLLGGEATLRDFTAEYPSIGLNLSQGQGRFTA
FT                   QPDGSARILASVKSGDGTLNIDGGLSWFGENNPLQLNIRGRNVLAYNTSELRIVSDPDL
FT                   RFGLINNTMQLQGEVAVSEADIDLERLDRGVSVSEDVVVLDPIDPERTTVSPLEMNLRI
FT                   VLGDKVNMSGFGLKGGLSGQMQIRARPGREMTANGGLDVRGRYKAYGQDLTITRGQLVW
FT                   NNNIVSDPRVNIRAQRRIADITAGIDVSGRAQSPRAQVWSDPVMSQSEALSYLVLGRKL
FT                   ATASSDENQQVASAAAALSAGGGLIASQLGAKLGLDDAGISQSSTMGGSVLGFGKYLSP
FT                   KLYVGYGVSMVGSGSVLTLKYLLSRGFDLEVESSTVETKGSVNWRKEK"
FT   gene            616486..617382
FT                   /locus_tag="XfasM23_0506"
FT   CDS_pept        616486..617382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0506"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; KEGG: xcb:XC_3215
FT                   2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91953"
FT                   /db_xref="GOA:B2I8P2"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P2"
FT                   /protein_id="ACB91953.1"
FT                   /translation="MSTSLPIQTPGQCFRTALMNERPLQVIGAMNAYHALLAQRAGYRA
FT                   LYLSGGGVAAGSLGLPDLGINTLEDVLIDVRRITDVCDLPLLVDIDTGFGPSALNIERT
FT                   IKTLIKAGAAACHIEDQVAAKRCGHRPGKEIVSLSDMADRVKAAADARTDATFFLIART
FT                   DAIQAEGVEAAIERAQAYVEAGADSIFAEAVSDLETYRHFVERIRVPVLANMTEFGKTP
FT                   LLTREQLEAVGVAMQLFPLSAFRAANKAAETVYMAIRRDGHQQAVLPHMQTRAELYERL
FT                   DYHAFEQRLDALSSRST"
FT   gene            complement(617700..617790)
FT                   /locus_tag="XfasM23_R0029"
FT                   /note="tRNA-Lys4"
FT   tRNA            complement(617700..617790)
FT                   /locus_tag="XfasM23_R0029"
FT                   /product="tRNA-Lys"
FT   gene            complement(617792..618595)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0507"
FT   gene            618856..619104
FT                   /locus_tag="XfasM23_0508"
FT   CDS_pept        618856..619104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ngo:NGO0732 conserved hypothetical protein,
FT                   putative phage associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91954"
FT                   /db_xref="GOA:B2I8P3"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P3"
FT                   /protein_id="ACB91954.1"
FT                   /translation="MTMTQKEHNAEIINEREAQIAKILTETSKLNAETAKIQAEIHEVN
FT                   AQTKKLIGESKWYPVVVGSSLIAAGATAATLFIKLFH"
FT   gene            complement(619129..619545)
FT                   /locus_tag="XfasM23_0509"
FT   CDS_pept        complement(619129..619545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_2137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91955"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P4"
FT                   /protein_id="ACB91955.1"
FT                   /translation="MNFRIVSFLFIFFSLFVSCRVFADQLVHKCLYKRRVSYQSEPCSS
FT                   GVEVRTWQAVPDSPPSSDELLRRYQVDQELQQRYANDRLQRSVSHTLGSSIPVQKSSCD
FT                   AARRQRAVILDQMGVNRSYEATAAVDNAVNAACR"
FT   sig_peptide     complement(619474..619545)
FT                   /locus_tag="XfasM23_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(619827..621129)
FT                   /pseudo
FT                   /locus_tag="XfasM23_0510"
FT   gene            complement(621129..621458)
FT                   /locus_tag="XfasM23_0512"
FT   CDS_pept        complement(621129..621458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0512"
FT                   /product="minor coat protein"
FT                   /note="KEGG: xcb:XC_2113 minor coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91956"
FT                   /db_xref="GOA:B2I4X6"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4X6"
FT                   /protein_id="ACB91956.1"
FT                   /translation="MFILRVAWLTDLTQWIWDLITKMFLALADFVSDVFVLFCDFCFSL
FT                   ILFVVGVLPWPDFLKQQSLGDMLGKAGSTVVWFADVFQLSNSMRVISAAIVFSIFRRLL
FT                   TLGIW"
FT   gene            complement(621471..622775)
FT                   /locus_tag="XfasM23_0513"
FT   CDS_pept        complement(621471..622775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV2466 filamentous phage phiLf adsorption
FT                   protein III"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91957"
FT                   /db_xref="GOA:B2I4X7"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4X7"
FT                   /protein_id="ACB91957.1"
FT                   /translation="MSIFRILVFFVILFISRFSFACEIGEPHWDPGQCLDRGEAYAIAS
FT                   ASYQMWRSNQLKDSNIPGLQVVDCPMTDDGHIIGFGGYTTAPGYPSSDSCSNSLVYFQR
FT                   VYPEGKTCLTRSPKSLLGLTLPSGVRVPSTACYDGCSYDLDRSHGIIGVGQDDGKVRYV
FT                   LPGMTPNGNLCVLSPPGSSSESSQDTPPVQDVVKDECTHMGTLTQCVRPDGKYCATSST
FT                   GHQYCWKPGEVGTQIASDGNHAATLNKVDVPVIAPVDAPKDKGDWRVDGKGTSTQIINN
FT                   TYNNYNTTTFASTGSSGGGSSGGSSSSGGQSSGGGSDKSGGGDKSGGDKDTPGSGSPSG
FT                   TGVLYKRNGKTLDTVVSGYQAKVNDLPFISGISSFLTISASGECPIFTLSASAYWPEMT
FT                   FDYHCSGVFLSFLRSAGYIIFAIASYFAVRIATLR"
FT   sig_peptide     complement(622710..622775)
FT                   /locus_tag="XfasM23_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(622906..623034)
FT                   /locus_tag="XfasM23_0514"
FT   CDS_pept        complement(622906..623034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0514"
FT                   /product="filamentous phage phiLf major coat protein VIII"
FT                   /note="KEGG: xcv:XCV2467 filamentous phage phiLf major coat
FT                   protein VIII"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91958"
FT                   /db_xref="GOA:B2I4X8"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4X8"
FT                   /protein_id="ACB91958.1"
FT                   /translation="MADILSGLDVKSAAAALIGAAALIALVGFTKWGAKKVAGFFG"
FT   gene            complement(623054..623305)
FT                   /locus_tag="XfasM23_0515"
FT   CDS_pept        complement(623054..623305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91959"
FT                   /db_xref="GOA:B2I4X9"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4X9"
FT                   /protein_id="ACB91959.1"
FT                   /translation="MALCVSLKADGTLVATGQGVSDCTGYVLVSGSEYGVYQLVQRVFE
FT                   VPDIKTVIQTSTTVAFTVIGWYVVARIIGTVATFFDSR"
FT   gene            complement(623431..623727)
FT                   /locus_tag="XfasM23_0516"
FT   CDS_pept        complement(623431..623727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0516"
FT                   /product="Helix-destabilizing protein"
FT                   /note="PFAM: Helix-destabilizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91960"
FT                   /db_xref="GOA:B2I4Y0"
FT                   /db_xref="InterPro:IPR003512"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4Y0"
FT                   /protein_id="ACB91960.1"
FT                   /translation="MKDNVLIERSVNTKTGPQIFREQRAAVVMGGAYETVFSLKLGSAP
FT                   LYPPGEYLIHPDSYGIDDYGNLVLRRLKLISLSSALKEFASKEPLSVVSSKVS"
FT   gene            complement(623783..624958)
FT                   /locus_tag="XfasM23_0517"
FT   CDS_pept        complement(623783..624958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0517"
FT                   /product="replication initiation factor"
FT                   /note="PFAM: replication initiation factor; KEGG:
FT                   xom:XOO_2132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91961"
FT                   /db_xref="GOA:B2I4Y1"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4Y1"
FT                   /protein_id="ACB91961.1"
FT                   /translation="MSRRSSSSDSAVYVNFLERERRADVEKAARLYETRRDRVEPSYVF
FT                   PAPSGEKRVGPNSNTGQKGVVGSYPVSIDYLTVVFSYARLAEAGYFDEPRFLLYLLFGL
FT                   SVDDVIVGSHTSVRWHFYNSSASIIDSNGDLVGKIGWDGNADSYCISLTGSACRYIHDW
FT                   SKVKRSLASLDARITRCDVAYDDYDGILGTVRHHEALAREHLAPAGGCLLFSSGGTPPR
FT                   TRFLDDHGGGSGCTLYVGQRGHKQLCIYEKGKQLGVAESPWVRYEVRLYAKHAVIPFDL
FT                   LEEPMRYLRGSYDYLCQLFSSVVVSPVSRIRTVVKHVEATGEALVRWLRRQVGPALGVL
FT                   RQALGCGFSDFIVDRVEREGLPSRFRRICRGGDLLAYLRETLIDCSVGVCV"
FT   gene            complement(624992..625321)
FT                   /locus_tag="XfasM23_0518"
FT   CDS_pept        complement(624992..625321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91962"
FT                   /db_xref="GOA:B2I8P8"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8P8"
FT                   /protein_id="ACB91962.1"
FT                   /translation="MRFIQAVYSRYHSIRSFFYFPIVRRFFNLLLSFFLSILLFICLSL
FT                   LILVQPTSGFQDYFAHSVSHSLSSFVPFLCSCVFVFSVVYFILRLVFFLDFLLLLFLNR
FT                   IDRCG"
FT   sig_peptide     complement(625157..625321)
FT                   /locus_tag="XfasM23_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.546 at
FT                   residue 55"
FT   gene            complement(625345..625566)
FT                   /locus_tag="XfasM23_0519"
FT   CDS_pept        complement(625345..625566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91963"
FT                   /db_xref="GOA:B2I8Y6"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Y6"
FT                   /protein_id="ACB91963.1"
FT                   /translation="MIDLWNCEKLSFECLFLVRVAIVAVLSILCGALACFFIYLIVWCL
FT                   SSTFGWVLIPISFAFFVYYVIQNIHNQV"
FT   gene            complement(625575..625745)
FT                   /locus_tag="XfasM23_0520"
FT   CDS_pept        complement(625575..625745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV2460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91964"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4V0"
FT                   /protein_id="ACB91964.1"
FT                   /translation="MRITDTERGARMALNIAEMYVRQLDFWEDTLPQQFDFWMSVRAAA
FT                   LDQLDECYLLR"
FT   gene            complement(625732..625995)
FT                   /locus_tag="XfasM23_0521"
FT   CDS_pept        complement(625732..625995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91965"
FT                   /db_xref="UniProtKB/TrEMBL:B2I4W3"
FT                   /protein_id="ACB91965.1"
FT                   /translation="MSKLAPLDSDPLSAQQYISLMSTSFSTIESNVEIIQGVLVRMYRI
FT                   TSKVSDEFIFDKIHLMYINTMDIVSELEELKHRLSSLPYADY"
FT   gene            complement(625988..626272)
FT                   /locus_tag="XfasM23_0522"
FT   CDS_pept        complement(625988..626272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91966"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Y9"
FT                   /protein_id="ACB91966.1"
FT                   /translation="MLEVVTRNPHDGMSFKSLGEPSAVSKRLLLASIGKLVQDLDSVKN
FT                   KFEHLDYERCGVGMYKERRYVAGRINEAAEWVARFLGDVDAALEDDLNV"
FT   gene            complement(626295..626603)
FT                   /locus_tag="XfasM23_0523"
FT   CDS_pept        complement(626295..626603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91967"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z0"
FT                   /protein_id="ACB91967.1"
FT                   /translation="MGGVMLENERPVLGASVFSPLCSSFSRQYLKSLSLFISDLDRNYH
FT                   FINESFLKMDRSAFEVTDEVTLHSLHRMSCYLNDLYRELSILKRFFYRLSLSFSNPK"
FT   gene            complement(626578..626850)
FT                   /locus_tag="XfasM23_0524"
FT   CDS_pept        complement(626578..626850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91968"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z1"
FT                   /protein_id="ACB91968.1"
FT                   /translation="MLNDQSEVSAVPESLFDEQSSKQFDPFFYYEIIKCSLARLHVVEG
FT                   MLRAACCEQSLVLDSILDVEARLEFVIKLTEERLSVFDGGRYVGK"
FT   gene            complement(626994..627272)
FT                   /locus_tag="XfasM23_0525"
FT   CDS_pept        complement(626994..627272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91969"
FT                   /db_xref="GOA:B2I8Z2"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z2"
FT                   /protein_id="ACB91969.1"
FT                   /translation="MPLLQLAALALISKQHVLSAIVLFPRGFLPSMLHRPFLLFCIFGL
FT                   CVRLALVLCHCAIRLVLHLRHLFVLQVHAGYFLMSAGLLGQLVVFAA"
FT   gene            complement(627360..627435)
FT                   /locus_tag="XfasM23_R0030"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(627360..627435)
FT                   /locus_tag="XfasM23_R0030"
FT                   /product="tRNA-Lys"
FT   gene            627952..628107
FT                   /locus_tag="XfasM23_0526"
FT   CDS_pept        627952..628107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3510 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91970"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z3"
FT                   /protein_id="ACB91970.1"
FT                   /translation="MPPLAGSGTTGVAALRAKHRFIGMALSLVYSHVAKQRLSDRVCGL
FT                   IRDVYL"
FT   gene            628094..628234
FT                   /locus_tag="XfasM23_0527"
FT   CDS_pept        628094..628234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91971"
FT                   /db_xref="GOA:B2I8Z4"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z4"
FT                   /protein_id="ACB91971.1"
FT                   /translation="MCICEGLELSQSFTVAAVIASGLIDTLYTLALIRNFIVLKLGIGG
FT                   K"
FT   gene            628231..628539
FT                   /locus_tag="XfasM23_0528"
FT   CDS_pept        628231..628539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91972"
FT                   /db_xref="GOA:B2I8Z5"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z5"
FT                   /protein_id="ACB91972.1"
FT                   /translation="MIMIRKALRRIPAYLPNMRLLVEYVMITSLVSLAAHAVLSWVNHA
FT                   KLTQRATYIQEQVASMERALNEKATMNAEQHAAIAQLLLLRNSDSRAVAVPRCAREL"
FT   sig_peptide     628231..628344
FT                   /locus_tag="XfasM23_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.579 at
FT                   residue 38"
FT   gene            628529..628867
FT                   /locus_tag="XfasM23_0529"
FT   CDS_pept        628529..628867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91973"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z6"
FT                   /protein_id="ACB91973.1"
FT                   /translation="MSFKHEVEIDPYAEAHEPYPLILAEKVQIDCYIRLRVPRTIDVCL
FT                   SSLQLTGTDTTHVAVELKKPQGNRPLTFGFVLTGKCRGNTTITAKMELTNGVVSKRTFH
FT                   VVVRSCCG"
FT   gene            628855..628992
FT                   /locus_tag="XfasM23_0530"
FT   CDS_pept        628855..628992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91974"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z7"
FT                   /protein_id="ACB91974.1"
FT                   /translation="MLWLKSTSWNLGCRLAGSKNRNTATIKNAFLEALDYLGGVPALAE
FT                   "
FT   gene            628997..629182
FT                   /locus_tag="XfasM23_0531"
FT   CDS_pept        628997..629182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91975"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z8"
FT                   /protein_id="ACB91975.1"
FT                   /translation="MQIARNFYTLAARLIPKQTHIASKFALNSADVAELDAAIAVLTTQ
FT                   SCLGIIAGRKNAPPLY"
FT   gene            629459..630334
FT                   /locus_tag="XfasM23_0532"
FT   CDS_pept        629459..630334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0532"
FT                   /product="Bacteriophage terminase large (ATPase) subunit
FT                   and inactivated derivatives-like protein"
FT                   /note="KEGG: sme:SMc04187 probable DNA PACKAGING protein
FT                   GP2"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91976"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="UniProtKB/TrEMBL:B2I8Z9"
FT                   /protein_id="ACB91976.1"
FT                   /translation="MRHRRVPGACIDGMTWAPGVPELVDTVYVRHCSGVRSSVSLKSFE
FT                   QGGEKWQADPVDWIWFDEQPPEDVYFEGIIRTNRTFGLVCMTFAPLKSILTVVWRFLLE
FT                   NVPDRADVQMIIEDAEHYLLEDCARITASYPPYERQARTQGVPALGSGRLFPIAGEKIG
FT                   VAPEKNLKKVSNALRIALSAKPSTHQMPHSVTCLYGHALTPIRNTFVRLKTASVPDTHA
FT                   EAEAEACADVLEMNLQKVTESASRNDKGLVRLGANIVKGFAEVEQRLGNVEQRYHTDRK
FT                   TLRTARSTFH"
FT   gene            630835..632709
FT                   /locus_tag="XfasM23_0533"
FT   CDS_pept        630835..632709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0533"
FT                   /product="aconitate hydratase domain protein"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   xcb:XC_3213 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91977"
FT                   /db_xref="GOA:B2I900"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B2I900"
FT                   /protein_id="ACB91977.1"
FT                   /translation="MHNRYCKPLPGTPFHYYDARAAIDALCPGAYAALPYVARVYAENV
FT                   LRRAVSDQWPAYLGQLIGRRCDTDIPWFPARIVCHDILGLTALVDLAGLRDAIAAQGGD
FT                   AFQVNPTVPVQLIVDHSLAVEYGGSDPEAVAKNRAIEARRNADRFHFIEWTRHAFENVT
FT                   VIPPGYGIMHQINLEALSPVVAVQDGVAFPDTCIGTDSHTPHVNALGVVAIGVGGLEAE
FT                   SVMLGRAVWLRCPESVGVELHGRPRPGITATDIVLALTAFLRQARVVGAYLEFRGEGVP
FT                   ALTVGDRATIANMAPEYGATAALFFIDAQTVEYLRLTGRDKAQVALVDTYAKQAGLWAD
FT                   TLDGAQYARLLHFDLSSVARTMAGPSSPHHQLPTSALTERGIAGGLAQARAEEAAGHLP
FT                   DGAVIIAAITSCTNTSNPRNLIAAGLLARNAHARGLRCKPWVKTSLAPGSQAVPLYLEA
FT                   AGLLSALQQLGFGVVGFACTTCNGMSGALDPLIQHAIMARHVHTVAVLSGNRNFDGRIH
FT                   PDATQAFLASPPLVIAYAIAGTIRFDIERDVLGHDADGTPVMLKDIWPSDADIDALVRR
FT                   SVHPEQFRHVYMPLLQASRQRRECVPPLYAWGTPGVRTSVGPLIGKGS"
FT   gene            632652..633461
FT                   /locus_tag="XfasM23_0534"
FT   CDS_pept        632652..633461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0534"
FT                   /product="Aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   bpt:Bpet1814 probable aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91978"
FT                   /db_xref="GOA:B2I901"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniProtKB/TrEMBL:B2I901"
FT                   /protein_id="ACB91978.1"
FT                   /translation="MGHPGSTYIRRPPYWEGVLAGARTLRGLRPLAVLGDNITTDHLSP
FT                   SNAILPNSAAGEYLARMGVPQEDFNSYATRRGDHLTAQRATFANPMLLNELVRDADGKV
FT                   RQGSLTRLEPDGTVMRMWEAIEIYMQRSQPLIIIAGADYGQGSSRDWAAKGVRLAGVEA
FT                   IVAEGFERIHRTNVIGMGVLPLTFHPGTTRITLRIDGTELFDVCGVPSVGAVLILRIQR
FT                   RDGSVAEVPVTCRLDTAEELSIYAAGGVLQRVAQEMLATTSGTSQRV"
FT   gene            633809..635005
FT                   /locus_tag="XfasM23_0535"
FT   CDS_pept        633809..635005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0535"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: xcb:XC_3210 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91979"
FT                   /db_xref="GOA:B2I902"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:B2I902"
FT                   /protein_id="ACB91979.1"
FT                   /translation="MLPLPQCRIPATYLRGGTSKGVFFRLEDLPPACRVPGPARDALLL
FT                   RVIGSPDPYGKQIDGMGGGTSSTSKVVIIAPSAYPNHDVDYLFGQVAIEGACVDWTGNC
FT                   GNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVAHVPILDGQVQESGDFM
FT                   MEGAAFPGAEVRLEFLNPADVGGDRVMFPTGHLIDTLDVPGLGPIEATLINAGIPMLCV
FT                   DAHALGYTGTELQEAINGDPHALVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVA
FT                   APADYVASGGRHVHATEIDVLVRAMSMGRLHHAMMGTAAVALGTAAAIPGTLVNRAAGG
FT                   GLRRVVRFGHPSGTLQVGAEVHQVNGQWSVANVRMSRSARVLMEGCVRVPAESVQNVD"
FT   gene            complement(635364..635603)
FT                   /locus_tag="XfasM23_0536"
FT   CDS_pept        complement(635364..635603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91980"
FT                   /db_xref="GOA:B2I903"
FT                   /db_xref="UniProtKB/TrEMBL:B2I903"
FT                   /protein_id="ACB91980.1"
FT                   /translation="MFSVFAFLIYYFVVYAFFSPGSQTFFRLTIFGLFLACIVSSCMFH
FT                   SGSRERSTVDAMPGEMHPEETNTPHDTPAPSKAD"
FT   gene            complement(635768..636052)
FT                   /locus_tag="XfasM23_0537"
FT   CDS_pept        complement(635768..636052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91981"
FT                   /db_xref="GOA:B2I904"
FT                   /db_xref="UniProtKB/TrEMBL:B2I904"
FT                   /protein_id="ACB91981.1"
FT                   /translation="MKLSELIEAIIDLFISLILIIYTTVYKAIKAHIELRLRAAKFSII
FT                   FLIVVIIFLHISLNTNILIYLSQYFPAPSATHSESKNTPQPSPAPQQTP"
FT   gene            complement(636131..636376)
FT                   /locus_tag="XfasM23_0538"
FT   CDS_pept        complement(636131..636376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91982"
FT                   /db_xref="UniProtKB/TrEMBL:B2I905"
FT                   /protein_id="ACB91982.1"
FT                   /translation="MESTVYDHFLDYCDYHLRRYVSLWTPGPVHSAPTSKCNSRGDKQY
FT                   SPTPPLSQVKHLETTAHHMLIQQALLLMRFISAMPI"
FT   gene            complement(637384..638031)
FT                   /locus_tag="XfasM23_0539"
FT   CDS_pept        complement(637384..638031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91983"
FT                   /db_xref="UniProtKB/TrEMBL:B2I906"
FT                   /protein_id="ACB91983.1"
FT                   /translation="MVANPAHLKDGGIFLDGWKTGQPDKQAAAFVYYPGETGRVYAAYY
FT                   NGRQIFHFGVNASQIHPAIQVWTKRFLPPSAVISHAKERSAADPRSLMKRRTMSNEPSP
FT                   EEQDKLRQLAATIWQPWIVNYWDMNATVGNILATVTGEILKCSIAYSFVPQQILNPFLK
FT                   PLWKDRWKLVVQYFAQIIWENYKISQNQRYQSCIYVAAANWRSPIEMASAGI"
FT   gene            638722..639618
FT                   /locus_tag="XfasM23_0540"
FT   CDS_pept        638722..639618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0540"
FT                   /product="arginase/agmatinase/formiminoglutamase family
FT                   protein"
FT                   /note="KEGG: ddi:DDB_0232116
FT                   arginase/agmatinase/formiminoglutamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91984"
FT                   /db_xref="GOA:B2I907"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2I907"
FT                   /protein_id="ACB91984.1"
FT                   /translation="MMKDAMSIVKKKTIRMLFPQWQGGNQELYGLGARLLAWLAPETEA
FT                   PMFEVNVPEFKKETPEPERGVIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAP
FT                   FAWLNEKHHGQLGVLWIDAHPDIKTPQDSINGHTMVLGSLLGEGDNEFAAKVKVPLKPS
FT                   RVMFAGLIETGLTEQETEVIHRLGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLD
FT                   VLHPDVFRSLLFAEPEPEFDWRATYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPW
FT                   DVWHLKESLSKVPLLNR"
FT   gene            640116..645041
FT                   /locus_tag="XfasM23_0541"
FT   CDS_pept        640116..645041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0541"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin domain protein 2; KEGG: xcv:XCV1164
FT                   putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91985"
FT                   /db_xref="GOA:B2I908"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:B2I908"
FT                   /protein_id="ACB91985.1"
FT                   /translation="MRDRVAMMLRPLVRGWIPRAVLLLTVAFSFGCNRNHNGQLPQSSG
FT                   EPVAVAKEPVKGFVLVRAYPDQHDGELALALEFSQPLAATQEFDTLVRLEQGSGNHDGG
FT                   WSLSDDAKTLRYPYVEADKHYTVLISGDLLAATGSRLGKSRKEPVYTGELDPVVGFASR
FT                   GSILPARGSRGVPVVSVNVPEVDVEFMRVREKALPAFLARYHKAGQRSSWELSNQGNSR
FT                   KRLSELADPVYVTRFVLDGKKNERALTYLPIQNIRELREPGLYFAVMKPTGSFSDAFET
FT                   AFFSVSNIGLHARAYKDKLFVHTASLRSGNPYKQVDLLVLDAKGETVLQGATDDNGNAL
FT                   LNYTLNAGHVLVSRNGRDISILPFNQPALDLSEFAVAGRENPWFDVFAWSGRDLYRPGE
FT                   MLRISALLRDRDGKPVKPQPVFLRLKQPDGKTFRETRLQPAEQGYLEFTQKIPSDAPTG
FT                   RWRVEFRTDPASKEAVQGLAVRVEEFLPERMKLELSSAQPVLRAKAPFTLTADAAYLYG
FT                   APAAGNRFTANLAVAVEQHPLDNMPGWFFGDATLQLPRGAKETIDITLGADGHLVHDIV
FT                   LPEEAKPVSPMAVVVSGSVYESGGRPVTRSLKRVLWPADALVGVRPLFDVASGADANGM
FT                   ARFELTRVGVDGKPQSAKGLKATLVRELRDYHWRYSDGRWDYDFTRRFENKETRTVDIS
FT                   SSHTTTLSLPVEWGDYWLEVFDPVTGLTMRYPFRAGWSWGDDNRGLDARPDKVKLALDK
FT                   TSYRAGDTLKVTITPPHPGKGLLLVESDKPLYVQAIDANPSTTLEIPVTADWERHDVYV
FT                   TALVFRGGSASNNTTPARAVGEAYVPMQRKERRVAVGLVVPKQVRPAQSLPVTVSVPEL
FT                   AGKQAHVTISAVDAGILNITGFPVPDAAAHFFAQRRLSVDAYDIYGRVIESFEGGTGRL
FT                   KFGGDMALPPLPQAKRPTARSQTVDLFSGAVKLDAKGNAHIQLPVPDFNGALRVSALVY
FT                   SDTRYGQRDAETVVRAPILAEASMPRVMAPGDRSTVTVDVQNFTGKQGKFAVKVEGVGP
FT                   LVVAEAGRSVTLGIDGKTTLNFPLRALEGNSVAQVRVRVEGNGSKAERHYDLPVRAVWP
FT                   QGLRTQAHVLNVLAPIAFDPALAKGLMPDSVNARLSVSTLAPIPFASVLQGVFEYPYGC
FT                   AEQTASKGYAALWLDDATIRSLGIQGVTPAQRLERLEGALGRLASLQTTNGHFSMWGGN
FT                   SDVNPVLTPYIAGFLLDAKDAGFAVSDAVLQKALNRLSEDLLSGAHLFYGNDQSEALMF
FT                   AHQAWSGYVLARVNRAPLGTLRTLYDNERGKAVSGLSLVHLGVALSLQGDRKRGEAAIE
FT                   AGFAKSEGGRPEVFGDYGSVIRDNALMIALVRAHGLAKPAYEARVMALGRDLQARRRSG
FT                   WLWLSTQEQVALAQLGRALLVDQKKQVSGTLYVGKQREDIAASRLIGRSFDAAALARGV
FT                   RFVPQGDVPLYASFEVAGIPRQAPVSDDSQLLVVRRWYTVDGKPWTPGPLKEGQALIVR
FT                   VSVTSKQNMPDALLTDLLPAGLEIENFNLGETRQWADVTVDGIALSERADAADIKHEEF
FT                   RDDRYVAMLQLTGGRTANLFYLVRAVTPGSYNVPPSLVEDMYRPALRGTGRVAPAMVTV
FT                   VQP"
FT   gene            complement(645147..646160)
FT                   /locus_tag="XfasM23_0542"
FT   CDS_pept        complement(645147..646160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0542"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rso:RS02616 probable lipase signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91986"
FT                   /db_xref="GOA:B2I909"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2I909"
FT                   /protein_id="ACB91986.1"
FT                   /translation="MKFTRKLATAAILALASTSSQAAGSPGVEHRTQAFLEDLAKGGGA
FT                   PIETLSPANARQVLVNAQKGAKLPPADVSEKTITIDGKQIVLNIVRPAGVKGILPGFMF
FT                   VHGGGWVLGDFQTHERLVRDLVSDSGAVAIFVNYTPSPEARYPVAINEIYAATQWVAEH
FT                   GAQINVDGQRLAIVGNSVGGNMATVVAQMAKEKGTPALRAQVLFWPVTNANFENTSYNE
FT                   FANGHFLTKNMMKWFWDAYTTDSKQRQDIYASPLLATAEQLKGLPPTLIQTAEKDVLRD
FT                   EGEAYARKLDAAGVNVVITRYNGMIHDFGLLNVLADLPATRAALHQASEELKIHLR"
FT   sig_peptide     complement(646092..646160)
FT                   /locus_tag="XfasM23_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            646378..647235
FT                   /locus_tag="XfasM23_0543"
FT   CDS_pept        646378..647235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0543"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: cvi:CV_2492 probable transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91987"
FT                   /db_xref="GOA:B2I910"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B2I910"
FT                   /protein_id="ACB91987.1"
FT                   /translation="MSIEVTGACTDRLEALLNHFPVRARMFHSGTLCGITDFSVPAEGG
FT                   QVHLLRSGAMDVIHPGRELLQVSVPSLLFYPRPMSRRFVADAQCGADLVCAQLDFEGGS
FT                   ANQVAGALPDVVCLPLENIDGAAQVLELLFDEAFGDHCGRRVLIDRLFEVVLIQMLRYL
FT                   METGGVAGGMLAGLSHPKLRKVLVAMHEQPERGWSLEALAYLAGMSRSVFAGTFRRVVG
FT                   CTPGVYLQGWRVKLAQQALRQGRQLLKTIAVEVGYGSEAALSRAFKAQCGMTPREWRQR
FT                   QDED"
FT   gene            complement(647411..647629)
FT                   /locus_tag="XfasM23_0544"
FT   CDS_pept        complement(647411..647629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91988"
FT                   /db_xref="UniProtKB/TrEMBL:B2I911"
FT                   /protein_id="ACB91988.1"
FT                   /translation="MQTKAMTKGLAREFPSAPIRELAETELHFIVGGSSQEQSDQQTQP
FT                   KNPNYLDEQRQTQIVGPSSFDMDNVKF"
FT   gene            648017..648148
FT                   /locus_tag="XfasM23_0545"
FT   CDS_pept        648017..648148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91989"
FT                   /db_xref="UniProtKB/TrEMBL:B2I912"
FT                   /protein_id="ACB91989.1"
FT                   /translation="MRDFYAIWVVVRPGKYLNWFGVNDDDLIVLQLPIRCLHQVYGE"
FT   gene            648212..648793
FT                   /locus_tag="XfasM23_0546"
FT   CDS_pept        648212..648793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0546"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: xcv:XCV2200 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91990"
FT                   /db_xref="GOA:B2I913"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2I913"
FT                   /protein_id="ACB91990.1"
FT                   /translation="MVAELPVVESDRRLIWIDLEMTGLDTHRDSIIEIATVVTDAQLNV
FT                   LAEGPEFAISHPLNVLEAMDEWNRNQHRHSGLWQRVLNSEIQHAQAEASTIAFLQQWVK
FT                   IGASPMCGNSICQDRRFLHRQMPCLERYFHYRNLDVSTLKELAGCWSPSILDGVVKTSS
FT                   HTALSDIYDSIAELRHYRKSMGTFAGLSVV"
FT   gene            complement(649017..649934)
FT                   /locus_tag="XfasM23_0547"
FT   CDS_pept        complement(649017..649934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0547"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   xom:XOO_2078 small conductance mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91991"
FT                   /db_xref="GOA:B2I914"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B2I914"
FT                   /protein_id="ACB91991.1"
FT                   /translation="MDWTKLLSNIVSPATVTTFHGRFNWTRIDWIHILMNLTAAAAIAI
FT                   LGVWLSKRLSNGLHRILIRAHVEITLANFLRNIAYALLLIVVSVSVLQRLGVPATSLAA
FT                   VVGATGLAVGLALKDSLSNIAAGVMLIVLGPVRSGDHVVIAGQEGIIDEIRIFQTRLRT
FT                   FDQRIITLPNSTITTVPIINYSTLPTRRVEITVGVSYQDNLKQAQELLVKIARENPKIL
FT                   DDPAPLVYVNNLGESSVDLLLLAYTQNDNFNPAKSEILEQIHNQLPENGLNIPYPQRDL
FT                   HLYHHDTNNGKIASLLLPSVTDKS"
FT   gene            complement(649935..652334)
FT                   /locus_tag="XfasM23_0548"
FT   CDS_pept        complement(649935..652334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0548"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: xcb:XC_1952 phosphoenolpyruvate synthase;
FT                   TIGRFAM: phosphoenolpyruvate synthase; PFAM: PEP-utilizing
FT                   protein; pyruvate phosphate dikinase PEP/pyruvate-binding;
FT                   PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91992"
FT                   /db_xref="GOA:B2I915"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2I915"
FT                   /protein_id="ACB91992.1"
FT                   /translation="MALNGASYLNENILWLHELRLTDLARVGGKNSSLGEMIGNLTALG
FT                   VSVPGGYATTAAAFKAFIAYNNLSKRIYDKLATLDVEDVKALTAAGKEIRDWVIDAPLQ
FT                   PELEKDIRDAYDTLSKDNSGNDVAVAVRSSATAEDLPDASFAGQQETFLNVIGADQVVH
FT                   KIKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGIQLMVRSDISASGVLFTLDTESGFRE
FT                   VVFVTASFGLGEMVVQGAVNPDEFYVYKKTLKAGKPAILRRTLGTKLVRMVYSDAPGER
FT                   VKIEDTPTELRHCFAISDADVQELARQALIIEQHYGRPMDIEWAKDGISGKLFIVQARP
FT                   ETVKSRSHTTQIERFALQQPGQILTEGRAIGQKIGSGTARVVNSLEDMHHMQPGDVLVA
FT                   DMTDPDWEPVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGTGNALSIIQDGQPITVS
FT                   CAEGDTGYIYAGKLPFERTTTDLGHMPPAPLKIMMNVANPERAFDFGQLPNAGIGLARL
FT                   EMIIAAHIGVHPKALLEYHKQDADTKQKIDAKIAGYPDPVSFYVNRLAEGIATLTASVA
FT                   PHTVIVRLSDFKSNEYAHLIGGQHYEPQEENPMLGFRGASRYVDPSFSDAFALECKAVL
FT                   KVRNEMGLDNLWVMIPFVRTLEEGRKVIDVLRQNGLKQGENGLKVIMMCEVPSNALLAD
FT                   EFLDIFDGFSIGSNDLTQLSLGLDRDSSIVAPLFDERNPAVKKLLSMAIKAARSKGKYI
FT                   GICGQGPSDHPDLAEWLMQEGIESLSLNPDTVVDTWLRLAKLKTVH"
FT   gene            652459..653280
FT                   /locus_tag="XfasM23_0549"
FT   CDS_pept        652459..653280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0549"
FT                   /product="protein of unknown function DUF299"
FT                   /note="PFAM: protein of unknown function DUF299; KEGG:
FT                   xac:XAC2042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91993"
FT                   /db_xref="GOA:B2I916"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I916"
FT                   /protein_id="ACB91993.1"
FT                   /translation="MSTIRPVFYVSDGTGITAETIGHSLLTQFSGFTFVAERMVFIDDA
FT                   EKARDASQRILAASERYRVRPIVVNSCVNPYLSVILAESGALMLDVFAPFIGLLEHELN
FT                   TSRHSCVGRAHGMVDFETYHRRINAMNFALAHDDGVAASYDEAEVILVAVSRAGKTPTC
FT                   IYLALHYGIRAANYPLIDEDLNSDQLPLRLRPYRKKLFGLTINPERLQQIRQERRPNSR
FT                   YAALDTCKREVAAAEQMFSAERITTLSTTHTSIEEISSKVLVTLGLQREMF"
FT   gene            653366..653863
FT                   /locus_tag="XfasM23_0550"
FT   CDS_pept        653366..653863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0550"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   xcb:XC_1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91994"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:B2I919"
FT                   /protein_id="ACB91994.1"
FT                   /translation="MLNDMMLHQRIPRLSRLSWLMALYAENYRHLKRLFAPGDLEKGSY
FT                   VSVIGDGLDLCLDVIERHRYTVDLRLTYELCDPMTGEPDPSAYVRLYCDALQVETTHCY
FT                   VGRRWQDVIGLSPFPGELMHYRMRMNIFLGKWLDYLAERGHGMATLSAIGRSHRVCRLM
FT                   RG"
FT   gene            653931..654419
FT                   /locus_tag="XfasM23_0551"
FT   CDS_pept        653931..654419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0551"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: xoo:XOO2214
FT                   7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91995"
FT                   /db_xref="GOA:B2I920"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2I920"
FT                   /protein_id="ACB91995.1"
FT                   /translation="MAYTPIIATLGYVLSPDQCRVLMIHRNARSGDAHLGKYNGLGGKV
FT                   EPGEDVLAGMRRELYEEAGIDCLSIRLRGTISWPGFGKQGDDWFGFVFVIDAFQGEPKT
FT                   HNAEGVLEWVERQRLFELPMWEGDAKFLPLVFDDDPRPFHGVMPYCEGRMQSWSFSRL"
FT   gene            complement(654901..657102)
FT                   /locus_tag="XfasM23_0552"
FT   CDS_pept        complement(654901..657102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0552"
FT                   /product="Autotransporter beta-domain protein"
FT                   /note="PFAM: Autotransporter beta- domain protein; KEGG:
FT                   pfl:PFL_2727 autotransporter beta-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91996"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B2I921"
FT                   /protein_id="ACB91996.1"
FT                   /translation="MERKNHKKTTLATLISVLLMGSAGATYANSPSISEKLDLATQHLD
FT                   GAASTGEAISSDGKTIATSINNRTRAFLLSGDNWATKTELGSLKSDSSGTSIVRALSAD
FT                   GKIAAGISSVDSSSTQLHATIWSGDNWATKTTLGTLATNNGGDSVVYALSADGKVAAGQ
FT                   TAASIGTLHAVIWSGDNWATKTDLGTIRSDGTGDSMVKALSADGKIAVGSAASDIKTPV
FT                   NGMYAGGVLTGPNSVRAIAWSGDNWATKTDLGTLRSDNLGAAVANAISADGKVIGGASH
FT                   HYVTTEYYRANADQLATIWSGGNWATKTNLGSLRSDNSGASLVAALSADGSIAGGAALN
FT                   DANATRAIIWSGSHWATKTDLGTLKSDNSGNSEVVALSPDGSVAVGTAATDSGSSHATV
FT                   WKITYPTESTSTSDSTTNTQTPSQPSQPSVVTVDADNTKKTLSQLGAETFSVMDLQRQG
FT                   LTRLQQHCQIDAAGQSCWGIQTAISSIDGNRDKVAGIRLGHGFTETFSAGVSLDRSLSR
FT                   SLPDSYLKNNGNLGAGLYAQWNTAFKGSQWYVRPAVAFNRYNVTVQRPVLENTEAGIGT
FT                   SRMKGRGASLEAGQTFKSDHGVLLGWHLGGRYNNVSRAEYSEQNAAFPTTYGKASFKRT
FT                   SAYLGADATIPLTTNLKWMAAVEIDRALKNRDAVYSAQADYIGSFNHRAGIKGTIATLS
FT                   SGLQYTISEKILLGLTLDVNQTAFGDIARGGTFTVGGHF"
FT   sig_peptide     complement(657016..657102)
FT                   /locus_tag="XfasM23_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 29"
FT   gene            complement(657818..659737)
FT                   /locus_tag="XfasM23_0553"
FT   CDS_pept        complement(657818..659737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0553"
FT                   /product="Cellulose 1,4-beta-cellobiosidase"
FT                   /EC_number="3.2.1.91"
FT                   /note="PFAM: glycoside hydrolase family 6;
FT                   cellulose-binding family II; KEGG: rso:RS03897 probable
FT                   exoglucanase A (1,4-beta-cellobiosidase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91997"
FT                   /db_xref="GOA:B2I922"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:B2I922"
FT                   /protein_id="ACB91997.1"
FT                   /translation="MSVSLLAGGLFSTSYVYAEAHVDNPFVDATSYLNPDYSKDIDTSI
FT                   TKVSDVSLKEKMETIKHYPTGVWLDTIDAVKGGAKNPGRLNLTGHLDAALAQKKGNTPI
FT                   TATFVIYDIPGRDCHALASNGELPLNSASLERYKREYIDTIASIFSNPKYKDIRIVNII
FT                   EPDSLPNLITNLSTPSCAKAKNTGIYEEGIKYALNKFSEIPNVYNYMDIGHAGWLGWDT
FT                   NRIPAVSLYTKVIQSTTAGFASVNGFATNTANTTPLIEPNLPNADLNIGGQPIRSSKFY
FT                   DWNRYFDEMDYSETLYNDFIAAGWPSSIGFIIDTGRNGWGGSQRPTSAFGNDINSYVNS
FT                   GRIDRRNHRGNWCNQQDAGIGLPPTVTPGGHVDAFQWIKPPGYSDGSSSLIPNDQGKGF
FT                   DRYCDPTFTTPDGVLTGALPDAPLSGDWFHAQFVKLINNAYPDISRTPLPSSGSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSSGSSSSSGSSSSSGSTSSSGSTS
FT                   SSGSTSSSGSTSSSGSSSGTGFNPGAGFNPGAGSDPTKNPITSSITVDSDWYTGYCERV
FT                   KVTNTGSSRSNWTVTIPLKGTIQTLWSATWSLSGSDKLIASGLNWNKTLEPNGTTEFGF
FT                   CANY"
FT   sig_peptide     complement(659681..659737)
FT                   /locus_tag="XfasM23_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.633 at
FT                   residue 19"
FT   gene            complement(660944..662065)
FT                   /locus_tag="XfasM23_0554"
FT   CDS_pept        complement(660944..662065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0554"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: xac:XAC0668 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91998"
FT                   /db_xref="GOA:B2I923"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I923"
FT                   /protein_id="ACB91998.1"
FT                   /translation="MTQPIIRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFAD
FT                   VPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILG
FT                   EVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFV
FT                   DCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRP
FT                   GADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYL
FT                   QPTPHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNAT
FT                   VSLGSPAVSSTEHRERNTIASKSASKTESIHHR"
FT   gene            complement(662102..662782)
FT                   /locus_tag="XfasM23_0555"
FT   CDS_pept        complement(662102..662782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0555"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: xac:XAC0667
FT                   lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB91999"
FT                   /db_xref="GOA:B2I924"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B2I924"
FT                   /protein_id="ACB91999.1"
FT                   /translation="MNACGAVAPWHVGRAALLRMLGAQPYVPVWHAMQRFTDVRDATAV
FT                   DELWVVEHEPVFTLGQAGKLEHVLAPGEIPVVHVDRGGQVTYHGPGQLVVYPLLDLSRL
FT                   GLGVRDYVYGIEQAVINTLAQWNILGERREHAPGVYVGDAKIAALGIRVRRGCSFHGVA
FT                   FNVAMDLEPFHRIHPCGYRGLQVTSVLDLGGPSEMDTVAAALLAELARQFGFVLHPTSG
FT                   WLSS"
FT   gene            complement(662779..663057)
FT                   /locus_tag="XfasM23_0556"
FT   CDS_pept        complement(662779..663057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0556"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   xcb:XC_0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92000"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I925"
FT                   /protein_id="ACB92000.1"
FT                   /translation="MEIKSDHSEHGFQFPGTFELSVVGTAGKALETELPRLLALCGVEL
FT                   VQERISWKHSSTGKYVSVRIGFRALDREQYDAAHQVLRDHPEVKWTL"
FT   gene            complement(663222..664025)
FT                   /locus_tag="XfasM23_0557"
FT   CDS_pept        complement(663222..664025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0557"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG: xcv:XCV1686
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92001"
FT                   /db_xref="GOA:B2I926"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B2I926"
FT                   /protein_id="ACB92001.1"
FT                   /translation="MVSILKIHFSQQQQPDHTLSPGVHRIVRHASGVVAFADEVQGRGV
FT                   VLAQFSLDNRGLWLQVAKGIRGIHVNGRPVRRMAWLRVGDAVYADGVEMLVIGIQAEPP
FT                   DDATATLDRNCLVLRGVGGRHYGRSFTLETPRIVGQEAGVDIWIDDPVFAARHAVFERH
FT                   GDRVLLRDLGSEEGSVVNGCKVRDAWLQAGDQIVLDGQHRFVLESPLFLLLPLSCSMSE
FT                   DVAAPIPPAAVSVRTPRRTARWPWLLLSALLLATALGALLWFDVR"
FT   gene            complement(664033..664170)
FT                   /locus_tag="XfasM23_0558"
FT   CDS_pept        complement(664033..664170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92002"
FT                   /db_xref="UniProtKB/TrEMBL:B2I927"
FT                   /protein_id="ACB92002.1"
FT                   /translation="MGYSDLGHGGIAFVQVNVSCLASRLDAASAMYFKRLVLQQVGPNC
FT                   "
FT   gene            664551..665057
FT                   /locus_tag="XfasM23_0559"
FT   CDS_pept        664551..665057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0559"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: xcv:XCV1684 putative poly(hydroxyalcanoate) granule
FT                   associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92003"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B2I928"
FT                   /protein_id="ACB92003.1"
FT                   /translation="MIPTNHHNEHASRKDPNEQTNDHDNEEFTQRLGKSAERVWLAGIG
FT                   ALGRVQSEGARFFEALVNEGEEIKQRRRESSLHSAESIREHVEVKLEETWENTQRNWRR
FT                   MNQLFDERIQDILHTLKIPTREEIEALRHEIEILRNELHELRNEKKTRNPSPSTPKSNK
FT                   SHTED"
FT   gene            complement(665073..665363)
FT                   /locus_tag="XfasM23_0560"
FT   CDS_pept        complement(665073..665363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92004"
FT                   /db_xref="UniProtKB/TrEMBL:B2I929"
FT                   /protein_id="ACB92004.1"
FT                   /translation="MGDGHDFSRFCGVVQRLQAAGRCLGRCEALAGTLGMVRSLEWLCV
FT                   AGGNGIRIMRRGDGLACGELRRLQCRKITKKLGGCLLINASALKTKTAVLR"
FT   gene            665843..667198
FT                   /locus_tag="XfasM23_0561"
FT   CDS_pept        665843..667198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0561"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   xcb:XC_1757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92005"
FT                   /db_xref="GOA:B2I930"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B2I930"
FT                   /protein_id="ACB92005.1"
FT                   /translation="MRIHPLLTYTSPMSGSQSSSPTTDPRLRQLRFMKVMALLLLLIML
FT                   GGFILAHTQGNRGIWAWLGAFCEAAMVGALADWFAVVALFKHPMGLPIPHTAILPRNKD
FT                   RLADGLAHFVRDHFLAPYSLLEKLRLFNPAARLGEWLSTPKQTQALTQMTRDWAIQTLN
FT                   LLNETTVRNAIEHLVITHLREWNAAITTGDIMALLTTDKRHQRLFDKALLRLARWLDND
FT                   KIKAQASALIVRYARREWPTLMGTVNWITSVDEIGDRLAERIARAGLEELQLILTTPKH
FT                   PLRQQYELWLQDYIHRLRNDPAFIERVEEFKQQAIDNSTIQTYIRDLWTQINTALRTDL
FT                   ESADSTLAGHLEGVLQSLGKALSEDPNLRDKLNEHLLDTSERLSERLRDTVTHHIASTM
FT                   SGWDEHHLTRQLELNVGCDLQYIRFNGTLVGGLIGLLLHAVIYGCEIYSVMG"
FT   sig_peptide     665843..665998
FT                   /locus_tag="XfasM23_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.838 at
FT                   residue 52"
FT   gene            complement(667898..669217)
FT                   /locus_tag="XfasM23_0562"
FT   CDS_pept        complement(667898..669217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0562"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: xcb:XC_2542 hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92006"
FT                   /db_xref="GOA:B2I931"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2I931"
FT                   /protein_id="ACB92006.1"
FT                   /translation="MFELLIVIALIFLNGFFAMSEMSLMTSRKSRLKQMAHSSKHAAKA
FT                   LTLAQNPESFLSTVQIGITLIGILTGLFGGDAIGTAIGQWLTALTPQLGEYTSIIGKTL
FT                   SVALITFLTLIFGELVPKRLALTHSEKIASTIAVPMSVLARIAAPGVWVLAKSTQLVLR
FT                   VFGFGKIPSSAVTEEEIRLLVAESHEAGVIDDYERNMMNRVMRLGDRTADSLMTPRNRI
FT                   AWLDNSADLEHNLEIMREHQFSRYPVYRSSDQDIVGILEVKSVITRIDSQTQTTLSLFQ
FT                   ELCEPVFVSESTHALKLLEIFREEQQSMALVVDEYGEILGLVTISDLMGAVIGRLQNVE
FT                   NTDEDALMVTREDGSFLIDGTLPIEELREVLGAELPDGEENNYHTLAGMCISYFGRIPH
FT                   VGEYFDWAGWRIEIVDLDGARIDKLLLQRLNKEKNHVPHK"
FT   sig_peptide     complement(669155..669217)
FT                   /locus_tag="XfasM23_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.637 at
FT                   residue 21"
FT   gene            complement(669978..671504)
FT                   /locus_tag="XfasM23_0563"
FT   CDS_pept        complement(669978..671504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0563"
FT                   /product="peptidase S10 serine carboxypeptidase"
FT                   /note="PFAM: peptidase S10 serine carboxypeptidase; KEGG:
FT                   xom:XOO_2822 carboxypeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92007"
FT                   /db_xref="GOA:B2I932"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2I932"
FT                   /protein_id="ACB92007.1"
FT                   /translation="MAMTPRIALLSLLLSGSVPLAYATATPPKPDKETTTPATTLTALP
FT                   ANTQIRQSIRIGNRTLGNRTLSYKAIIGALPVQDDKGKTIGEVMFTAYIMKGNNRPVTF
FT                   ALNGGPGASSVYLNMGAIGPKVVHFGTQGTSPSDPAILHDNPGTWLDFTDLVFIDPIGT
FT                   GFSRARIEGEEAKKQFFNPKADVDYLSRTIYDWLVANGRLLSRKYLVGESYGGFRAPRI
FT                   AHTLQTQMGIALNGLVLVSPYLNPTLDDNSDVSPLAWIMTLPSIAAAHLERQHQLSEAK
FT                   MREVIEYTRGDYASTLMKGRSDPAATETMLQQVIHLTGLDPTYVRRAGGRLETQAYLRE
FT                   VFRDTGELGSRYDINVTALDPFPYDSEQRTNDPLLDSIIAPTTTAMVDFVTRTVGWKVH
FT                   ERYQALNYDVNRQWDWNEELRKGSVTQLRQSVAIDPKLRVLIAHGWNDLSCPFMASVLT
FT                   IDQIPKMGSDPTRIQVREYPGGHMFYNRPDSQSSFRQDVQAMYEHPQDTP"
FT   sig_peptide     complement(671433..671504)
FT                   /locus_tag="XfasM23_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.878 at
FT                   residue 24"
FT   gene            complement(672123..674012)
FT                   /locus_tag="XfasM23_0564"
FT   CDS_pept        complement(672123..674012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0564"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xac:XAC1714 DNA topoisomerase IV subunit B;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA gyrase
FT                   subunit B domain protein; ATP-binding region ATPase domain
FT                   protein; DNA topoisomerase type IIA subunit B region 2
FT                   domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92008"
FT                   /db_xref="GOA:B2I933"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I933"
FT                   /protein_id="ACB92008.1"
FT                   /translation="MNSRYNAADIEVLTGLDPVKRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EALAGYANRIEVTLYKDGSCEVADNGRGMPVDIHPEEKIPGVELILTRLHAGGKFSNRN
FT                   YTFSGGLHGVGVSVVNALSSKVDLFIKREGSEHHMEFREGFAVSKLKVLGTVSKKNTGT
FT                   RLRFWPDSKYFDTPKFNVRVLRHLLRAKAVLCPGLTVELLEEATGEINTWHFKDGLRDY
FT                   LKGEMTESELLPAELFIGCLKKDTEVVDWAVAWVPEGELTQESYVNLIPTPQHGTHVNG
FT                   LRSGLTDALREFCDFRNLLPRGIKLAPEDVWDRVTFVLSLKMSDPQFSGQTKERLSSRQ
FT                   AAGFIESTVHDAFSLWLNQNVDIGEHIAQIAIERASARLKTEKQVTRKKITHGPALPGK
FT                   LADCISLDLSRTELFLVEGDSAGGSAKQARDKDFQAILPLRGKILNTWEVASGSVLASD
FT                   EVHNLAIAIGCDPGKDNLSGLRYGKIVILADADSDGLHIATLLTALFLKHFPGLVAAGH
FT                   VFVAMPPLFRVDVGKQVFYALDDEEKTILLEKIQREKIKGQISVTRFKGLGEMNPQQLR
FT                   ESTIHPDTRRLVQLTMDDNTQTCSLMDMLLAKKRASDRKQWLETKGNLASLDI"
FT   gene            674046..674486
FT                   /locus_tag="XfasM23_0565"
FT   CDS_pept        674046..674486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92009"
FT                   /db_xref="GOA:B2I934"
FT                   /db_xref="UniProtKB/TrEMBL:B2I934"
FT                   /protein_id="ACB92009.1"
FT                   /translation="MCCLLHIFARHSGSFSEGLAIPGRLGGGIPIEVALFRVRTGTSGV
FT                   ATMKLKYLVMLMLVPAVVGVAVPSALAQAPKASSTATEMQQPASPSTDMPTNSEGQGMG
FT                   EHTGEHKVRKSKKHRSHSAKPMSTGSATAPTKEAEENTSATR"
FT   gene            674637..676301
FT                   /locus_tag="XfasM23_0566"
FT   CDS_pept        674637..676301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0566"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase; KEGG: xcb:XC_2534 CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92010"
FT                   /db_xref="GOA:B2I935"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I935"
FT                   /protein_id="ACB92010.1"
FT                   /translation="MTPLIFVTGGVVSSLGKGIAAASLASILEARGLKVTMVKLDPYIN
FT                   VDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFVRTRLSRKNSVTTGRIYQNVICKERR
FT                   GDYLGATVQVIPHITDEIRRCIDEATASFDVALVEIGGTVGDIESLPFLEAIRQVRIER
FT                   GAERTMFMHLTLVPYIAAAGELKTKPTQHSVKELRSIGIQPDVLLCRSEQVIPDSERRK
FT                   IALFTNVSERAVIGCPDIDVLYGMPLELRRQGLDEIVIDQFKLSGTASLADLSEWEDVV
FT                   DAIKHPLDEVTIAVVGKYVDYQDAYKSVGEALKHGGLRQRTKVNLKWVEAQDLEGSDMA
FT                   ALKDIDGILVPGGFGDRGFEGKVLASRYAREQRVPYFGICYGMQAAVVDYARHVAGLEG
FT                   ANSTENDRQSSHPVIALITEWRTTTGEVERRDEKSDLGGTMRLGLQEQRLKAGTLAREL
FT                   YGRDVVGERHRHRYEFNNRYRTQLEDAGLVIAAKSMDDTLVEMIELPREMHPWFLACQA
FT                   HPEFLSTPRDGHPLFIGFVKASRARKAGGKLLREVCV"
FT   gene            676462..677292
FT                   /locus_tag="XfasM23_0567"
FT   CDS_pept        676462..677292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0567"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: xom:XOO_2816
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92011"
FT                   /db_xref="GOA:B2I936"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I936"
FT                   /protein_id="ACB92011.1"
FT                   /translation="MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGL
FT                   NFIFKSSFDKANRTSGSSFRGPGLEEGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVV
FT                   DVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSPWDMKPVVEKAKSTGNSQILVCER
FT                   GASFGYNNLVSDMRSLAVMRETGCPVVFDATHSVQLPGAQGGRSGGQREFVPVLARAAV
FT                   AVGISGLFAETHPDPPNALSDGPNAWPLRTMAMLLETLVELDAVTKKRGFLEQD"
FT   gene            677743..679035
FT                   /locus_tag="XfasM23_0568"
FT   CDS_pept        677743..679035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0568"
FT                   /product="Phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: xcv:XCV1752 phosphopyruvate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92012"
FT                   /db_xref="GOA:B2I937"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I937"
FT                   /protein_id="ACB92012.1"
FT                   /translation="MTVIAKIYAREILDSRGNPTLEAEVTLENAVCGRAAVPSGASTGT
FT                   KEAVELRDGDKTRYLGKGVRAAVDNVNGVIAAALVGFDGADQTGLDHRLINLDGTENKG
FT                   RLGANALLGVSLATAHAVAAARKQPLWMYLSTLGESKLSLPVPMMNIINGGAHADNNVD
FT                   FQEFMVLPVGFASFSEALRAGTEIFHALKSVLKGQGLSTAVGDEGGFAPDFRSNVEALD
FT                   AILEAIGRAGYIAGEDVLLGLDVASSEFRNNGKYNLVGENKRLTSEQFVDFLDDLVAQY
FT                   PIISIEDGLAEDDWVGWKQLTERIGHKVQLVGDDLFVTNPKVFQEGITSGIANAILIKL
FT                   NQIGTLTETLESIAMAHRAQYAAIVSHRSGETEDTSIADIAVATTATQIKTGSLCRSDR
FT                   VAKYNQLLRIEQALGVGARYAGRDAFVSLKS"
FT   gene            679039..679395
FT                   /locus_tag="XfasM23_0569"
FT   CDS_pept        679039..679395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0569"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: xac:XAC1720
FT                   cell divison protein FtsB"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92013"
FT                   /db_xref="GOA:B2I938"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I938"
FT                   /protein_id="ACB92013.1"
FT                   /translation="MRNWRWLLLVLAALLAWLQHRFWFGPGNSGEVRMLQVQIVQQHQE
FT                   NERLRQRNASLAAEVKNLKDGDAAIEERARSELGMIKPGEIFYRVVEDIPVPLPNDTSA
FT                   DHGVDLSQPRREKR"
FT   sig_peptide     679039..679128
FT                   /locus_tag="XfasM23_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.539 at
FT                   residue 30"
FT   gene            679392..680087
FT                   /locus_tag="XfasM23_0570"
FT   CDS_pept        679392..680087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0570"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   xac:XAC1721 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92014"
FT                   /db_xref="GOA:B2I939"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I939"
FT                   /protein_id="ACB92014.1"
FT                   /translation="MSVGVWAVIPAAGRGVRFGSPVPKQYLPVVGRPLIVYTLEALAAH
FT                   PAVCGLMVVVAEGDLAWSGWTELAGKPLLTCSGGVTRAASVLSGLLALPQVVHADDFVL
FT                   VHDAARPNVALSDLERLLEAGCAHPVGAILAVPVRDTLKRAGSDGSIDGTEPRERLWRA
FT                   FTPQLFRRSQLVRGLQVAAADGIEMTDEAMVMERQGLRPLLVECAESNFKITTPDDLVR
FT                   FEFELARRV"
FT   gene            680111..680614
FT                   /locus_tag="XfasM23_0571"
FT   CDS_pept        680111..680614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0571"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: xcv:XCV1755 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92015"
FT                   /db_xref="GOA:B2I940"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B2I940"
FT                   /protein_id="ACB92015.1"
FT                   /translation="MTGLNVRIGQGYDVHAFGPSDHVMLGGVRVPHRCGVLAHSDGDVI
FT                   LHALCDAMLGALGLGDIGQHFPPSDVRWKGADSGVFVRHCNLLLRERDWCVGNVDATAI
FT                   CESPKIAPYVNAMREGIARLLEVQPECVSVKATTSEGLGFIGRGEGLAAQVVVLLYRLN
FT                   GVVV"
FT   gene            complement(680851..681393)
FT                   /locus_tag="XfasM23_0572"
FT   CDS_pept        complement(680851..681393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0572"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: xcb:XC_2526
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92016"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B2I941"
FT                   /protein_id="ACB92016.1"
FT                   /translation="MTQHNDNDDDAALFRAAIGPVRPLRPSETAITIKPRSRPRRCIIK
FT                   HHEDEAKSEFAQLLRESAPLEAGDTISYRSKALPSRLFQRLKRGQFSVQDELDLHGATV
FT                   VQAETLLRQFLLEAHTYEYGCVRIIHGKGLQSNGGTPVLKNLVNQLLRLRKDVLAFHSS
FT                   PPAQGGTGAVLVLLTHR"
FT   gene            complement(681875..682891)
FT                   /locus_tag="XfasM23_0573"
FT   CDS_pept        complement(681875..682891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0573"
FT                   /product="Gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pst:PSPTO_1345 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92017"
FT                   /db_xref="GOA:B2I942"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2I942"
FT                   /protein_id="ACB92017.1"
FT                   /translation="MKATRKNYFTHIIIAGFFLTLPFHGITTPHNTKIQTAKIQKEDPL
FT                   FETLIDKAPELITLYDQGIWLEGPQTLPDGSLIWSDVKANRVLRWQEGKGVSVFLEPSH
FT                   FQNGHALDNEGRLLAASHGKRAIERLEKDGKWTIVVDSYQGNKLNSPNDLIVDRSGDIW
FT                   FTDPAFGINNPKESYGGKAVQGGDYSYRYSPKTGTIVRLKTPLVKAPNGIALSPDEKTL
FT                   YIADSELAYNSNNSALNSRIVAYDIKKDKSLRNGRVLASISHGIPDGIVTDANGNIWSS
FT                   SEGAIQIFSPKGKLLGKVILPGTVGNMNFALDKENNPILYVTASHAIYRLKIKVKGK"
FT   gene            complement(683051..684697)
FT                   /locus_tag="XfasM23_0574"
FT   CDS_pept        complement(683051..684697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0574"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   xcb:XC_3604 flavoprotein-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92018"
FT                   /db_xref="GOA:B2I943"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B2I943"
FT                   /protein_id="ACB92018.1"
FT                   /translation="MLAAKQETETNTIERDVMEYDVVTVGSGPAGLAFAIRLKQLNPAL
FT                   SVCVIEKSSTIGGHILSGAVIEPAPLDSLLPGWRNAPPPICVPATEDEFWLLSKNGAYK
FT                   FPIMPPSLRNHGNVIVSLGALCAWLAPQAETLGVDIYPGFSATETLHDAAGQVIGVRIG
FT                   DMGIAKNGTHKPSFTPGIAIKAKVTVLAEGARGHLTKHLIKHFSLDQNSDPQTYSIGIK
FT                   ELWHVPEKRSSPGKILHTLGWPADTHTYGGGFLYHLNDNRIALGYVSGLDYHDPRYEPW
FT                   EAFQQWKNHPLIKPLLESGDLLSGGARAIVTGGWQSLPKVDMPGALLIGDTAGLLNVPK
FT                   IKGTHQAIRSGMLAAEHLVATQLIPYGFDAKLRASKAMTELKQVRNIKPGFKKGLWLGL
FT                   LNAAWETATRGASPWTLKNTPDWAALQRLDKNQQTKHDYVQRTLPPRDRLHSVYFAATV
FT                   HNEDQPIHLKVTDPERCVTRCVEEYGNPCTRFCPANVYQIIEDPNSATNKRLHINAANC
FT                   VHCKTCDIKDPYQIIDWITPEGGSGPNYQNL"
FT   gene            684805..685389
FT                   /locus_tag="XfasM23_0575"
FT   CDS_pept        684805..685389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0575"
FT                   /product="DNA repair system specific for alkylated DNA"
FT                   /note="KEGG: xcv:XCV3699 DNA repair system specific for
FT                   alkylated DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92019"
FT                   /db_xref="GOA:B2I944"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B2I944"
FT                   /protein_id="ACB92019.1"
FT                   /translation="MDLFPFLPGVRISLQSGWLPSGAADALLAGLLEGVPWEVHRIHIF
FT                   GREVNSPRLSCWVGDPQASYRYSGRCFQPRPWWPALAELRMCLEGETGAVFNSVLLNRY
FT                   RHGGDAIGWHSDDEAELGIDPLIASVSLGASRRFVFRHRRERHLRAECVLSHGDLLLMG
FT                   GTTQRDYQHALPRTLRVVGERVNLTFRRILM"
FT   gene            complement(685584..686225)
FT                   /locus_tag="XfasM23_0576"
FT   CDS_pept        complement(685584..686225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0576"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3698 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92020"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2I945"
FT                   /protein_id="ACB92020.1"
FT                   /translation="MKLIHPLVCLSVLTLASCSSTLLGEKKPTTIYSPQIHVTTDPSWP
FT                   RVTWHLTVLHPKAPRMIDTPRINVQPTPGEIQVYHNVSWAQPTTDMLEDALIRVFEDSG
FT                   KIAGVTRAGTGIRTDYSLSLDLRRFESDYAGTPMPTATIEVNAKLIGAHNKRLIASRTF
FT                   IVTQPATNTDTSTVANAFGQALTQLTNELVGWTLTMGQSDAISNNKPSQH"
FT   sig_peptide     complement(686151..686225)
FT                   /locus_tag="XfasM23_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.855 at
FT                   residue 25"
FT   gene            complement(686222..687148)
FT                   /locus_tag="XfasM23_0577"
FT   CDS_pept        complement(686222..687148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0577"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: xcv:XCV3697 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92021"
FT                   /db_xref="GOA:B2I946"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2I946"
FT                   /protein_id="ACB92021.1"
FT                   /translation="METKANYVLIGSFTILTGLALLIFGLWAAKYSSDRTWQNYRVVFR
FT                   EAVTGLSVGSPVQYNGIAIGSITQLTLAPNDPRQVVAHIRVNSTTPVKKDTRAKLAITS
FT                   LTGPSIIQLSGGTPESPSLTSIYKDDAPIIQTTPSALQNITDTANDIVERLYDVLSDKN
FT                   VAAISTILQNMQKISGQVSDSDTGLEALLTSARDATRQLNTTLTTANGTVQQLDNNLVK
FT                   QLPIILNKLEATLTKIDATASNANSILDNNQAAINSFANEGLSQFAPTMSELSNLIRDL
FT                   RQISNKLEGNPKRYLLGRDAPKEFDPK"
FT   sig_peptide     complement(687062..687148)
FT                   /locus_tag="XfasM23_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.930 at
FT                   residue 29"
FT   gene            complement(687152..687982)
FT                   /locus_tag="XfasM23_0578"
FT   CDS_pept        complement(687152..687982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0578"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xcv:XCV3696 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92022"
FT                   /db_xref="GOA:B2I947"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I947"
FT                   /protein_id="ACB92022.1"
FT                   /translation="MSKITTHPIAAEHKEANLAIRVRGLINHFGTQTVHDGLDIDVHRG
FT                   EILGVVGGSGTGKSVLMRTILGLHTPNAGSIEVLGVNPHSQSSEDRRIIARNTGVLFQD
FT                   GALFSSMTVGENVQVPMKEHHGEFPKRLYYELALLKIKLAGLPANALDKLPSQLSGGMR
FT                   KRAGLARALALDPPLLFLDEPTAGLDPIGAASFDQLIKTLQKALGLTVFLITHDLDTLY
FT                   TICNRVAVLAERKVIANAPLAEIENIDHPWIREYFHGPRGRAARTAQHTSTGSS"
FT   gene            complement(687988..689178)
FT                   /locus_tag="XfasM23_0579"
FT   CDS_pept        complement(687988..689178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0579"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   xom:XOO_0734 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92023"
FT                   /db_xref="GOA:B2I948"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2I948"
FT                   /protein_id="ACB92023.1"
FT                   /translation="MYVASDVKIDLRTSRGTGYAYTLIMPKKTVTAPHIEQDAQDRGQI
FT                   HLSGSWVLANLLTASELLQSYSNSIQHINARNIDQLDSAGALQLLRFTTRTGLKNEAIE
FT                   FREEHRPLISTIEILDDEHPKPERDYGFLAALERLGIAVVKTRRNIIDVCSFLGENLVK
FT                   IAQLAREPRRFRITSTVHHMEQVGLDAVPLVVVLSYLVGAVIAFLGSTILRNFGAEIFV
FT                   VELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAIQTLGLDPIDLLVIP
FT                   RLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHETMQLRHFIIGMSKA
FT                   PLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALAALWFMRMGW"
FT   gene            689216..690478
FT                   /locus_tag="XfasM23_0580"
FT   CDS_pept        689216..690478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0580"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   xcv:XCV3694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92024"
FT                   /db_xref="GOA:B2I949"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B2I949"
FT                   /protein_id="ACB92024.1"
FT                   /translation="MSSAPLLSPALSTSYAQRVAFVAEIAGRLHTYGTTAQRLEASLVA
FT                   LSQQLGLDCEPWSNPTGIILSFSDPAKAIGSSDITRVIRLAPGENDLYKLSVADNVAQA
FT                   VASGRMSISQGHTTLRRLDRELDRRSKMMRVFGFGLAAGGVAGLWKLPWLDVATAATVG
FT                   LLIGLLTQYTDHRAATREASEALAALLAGFVATLVATLIGPINLNTVIIASVVVLLPGM
FT                   SLTNAVNELSSQHWVSGTARLAGALTVVFKLTVGALIALSLCKLIGLKPQIYVAQPQPQ
FT                   WVEWVALLTTAYGFAVLFKARFRDYPWVMAAAMAGYVIARYAGKLSGNAEEGVFLSAMV
FT                   LTAAGNLFGRLMPKPGALIRLPGIIMLVPGSTSMRGFMDVVEHQSIHVGQDELLGVTNV
FT                   VMALVAGLLFGNLLIPTRKNL"
FT   gene            690843..691061
FT                   /locus_tag="XfasM23_0581"
FT   CDS_pept        690843..691061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92025"
FT                   /db_xref="GOA:B2I950"
FT                   /db_xref="UniProtKB/TrEMBL:B2I950"
FT                   /protein_id="ACB92025.1"
FT                   /translation="MRTINDVEMEEVSGGFLGLATVASLLAPVGTAVMVIGTAVSQASA
FT                   LYSAVSNIYNIFSSVIRGFEQAYNKKS"
FT   gene            691132..691338
FT                   /locus_tag="XfasM23_0582"
FT   CDS_pept        691132..691338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92026"
FT                   /db_xref="UniProtKB/TrEMBL:B2I951"
FT                   /protein_id="ACB92026.1"
FT                   /translation="MRELSKVEMEQISGGCLTDIVTGVNTAFRLISDTLNTLFSGSVTT
FT                   LFSNAFSTLLNTATNIITSSRKS"
FT   gene            691404..691613
FT                   /locus_tag="XfasM23_0583"
FT   CDS_pept        691404..691613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92027"
FT                   /db_xref="UniProtKB/TrEMBL:B2I952"
FT                   /protein_id="ACB92027.1"
FT                   /translation="MKMRELSKVEMEQISGGCLTDIVTGVNTVVNWFTTGLQSLFTTGL
FT                   QSLFSSISSIFGATTTTNSSTTKG"
FT   gene            692009..692368
FT                   /locus_tag="XfasM23_0584"
FT   CDS_pept        692009..692368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92028"
FT                   /db_xref="UniProtKB/TrEMBL:B2I953"
FT                   /protein_id="ACB92028.1"
FT                   /translation="MYFMDLDCEITGDVLGSKEQGIRLIIKTMRALSVSEVSEVFGGNA
FT                   LTDWTSIVMDAGAFVGIMNGFTSPMFLGAFADTGGLIGVAWGGAWMAGTFIHKNFISMY
FT                   PTIFKSLRSNNDEYG"
FT   gene            692355..692630
FT                   /locus_tag="XfasM23_0585"
FT   CDS_pept        692355..692630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92029"
FT                   /db_xref="UniProtKB/TrEMBL:B2I954"
FT                   /protein_id="ACB92029.1"
FT                   /translation="MNMDKLLPSEIMQIDGAGWRSNMAEFVDTGSVIGTVIGYAPTGTL
FT                   IGADQGGLIGAVGGFSAGLGWGIGTLIRERIIYPYARIYYFFSVNE"
FT   gene            693730..694005
FT                   /locus_tag="XfasM23_0586"
FT   CDS_pept        693730..694005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92030"
FT                   /db_xref="GOA:B2I955"
FT                   /db_xref="UniProtKB/TrEMBL:B2I955"
FT                   /protein_id="ACB92030.1"
FT                   /translation="MPAVIAECSDDLSLICDDHAVVWHIWFRGDTLAASDECAMSVCHW
FT                   ERYVKDACLSAKNVTASVWISDAVVVIVLVFLLTIDCRKKEGDSLG"
FT   gene            694221..695264
FT                   /locus_tag="XfasM23_0587"
FT   CDS_pept        694221..695264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0587"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: xac:XAC0656 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92031"
FT                   /db_xref="GOA:B2I956"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2I956"
FT                   /protein_id="ACB92031.1"
FT                   /translation="MSKKLRGMFSNDLSIDLGTANTLIYVRGQGIVLNEPSVVAVRQDR
FT                   AIGGTRSVAAVGVEAKQMLGRTPGNITTIRPMKDGVIADFTYTEAMLKHFIKKVHKARF
FT                   LRPSPRVLVCVPAGSTQVERRAIKESAEEAGARDVYLIEEPMAAAIGAGMPVTEARGSM
FT                   VIDIGGGTTEVAVISLNGIVYSQSVRIGGDRFDESITNYVRRNHGMLIGEATAERIKLE
FT                   VGCAYPQVEVHELEISGRNLAEGVPKVIKINSNEVLEALHEPLSGIVSAVKSALEQTPP
FT                   ELCADVAERGIVLTGGGALLRDLDRLISDETGLYVQVADDPLTCVARGGGRALELVDMH
FT                   GNEFFAP"
FT   gene            695462..696412
FT                   /locus_tag="XfasM23_0588"
FT   CDS_pept        695462..696412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0588"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: xac:XAC0657 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92032"
FT                   /db_xref="GOA:B2I957"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B2I957"
FT                   /protein_id="ACB92032.1"
FT                   /translation="MPSYPGFSLASRSPAVVSTIRLLTYLTLAIVLVVLDSRGAWLSQL
FT                   RQRANWLAQPVWALAGLPGWFGGQLSERAISNARLVNENRQLRNQLLIANARLTRLQTA
FT                   ARDNAQLRELLNFAEHHGLDVQLAPILDVDLDPTRQRLVLDAGSRDGVSVGQTVIDAGG
FT                   LMGQVIEVTPLHSIVLLLTDPDHAVPVTVARNGVRLIVYGRGDRLELRNIPLSSGVKIG
FT                   DVLITSGLGGRFPAGFPVGNISALHPDDSHAFLVGEITPTAKLDRGRNVLLLRLGGSMS
FT                   PGGGGSLTSRSIIDSNSESHSTNLGASRVIKEPQQ"
FT   gene            696409..696894
FT                   /locus_tag="XfasM23_0589"
FT   CDS_pept        696409..696894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0589"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: xom:XOO_3746 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92033"
FT                   /db_xref="GOA:B2I958"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B2I958"
FT                   /protein_id="ACB92033.1"
FT                   /translation="MTRLRNTWLLPVSVILALLLGLLPLPVSVRPIRPYWLALVLMYWV
FT                   IETPGRVGIGFAFVMGVLADFIYGGLLGEQALRLVVMSFIVQRFRARLRFFPMPQQALV
FT                   IGGLLFNDCVVATALHLTLGQPLLPWSYWSAPLLGMLLWAPLFVLLDALRLGHGSRK"
FT   sig_peptide     696409..696498
FT                   /locus_tag="XfasM23_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.977 at
FT                   residue 30"
FT   gene            696899..698962
FT                   /locus_tag="XfasM23_0590"
FT   CDS_pept        696899..698962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0590"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: xcv:XCV0720 penicillin-binding protein 2;
FT                   TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92034"
FT                   /db_xref="GOA:B2I959"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2I959"
FT                   /protein_id="ACB92034.1"
FT                   /translation="MSVHHPQAKHTYAEVEQFRRRALLSLFVVVVCLFGLVGWYFKLQV
FT                   LDHEIYATRSDANRIKLHPVVPGRGMIYDRDGRLLADNVPAFRLDVMPDKVADMEAMLV
FT                   ELGKVIPLSEDELERFHRERKVRRRFMPVTLKLRMSEEEMARFAVDRWRFPGVELEPYF
FT                   TRRYLYSDLFAHVIGYVGRIDEKDLETLNGGDAALTYIGKSGLERYYEQVLRGKIGYQQ
FT                   IETNVQGRAIRSLGRVTAQAGADLRLSIDADLQRAMVAAFGQYEGAAVAMDPRSGEILG
FT                   MVSLPSYDPNLFVNGISHAQFNALNANPSRPQFNRLVSGGVAPGSTLKPLIALAGLDAG
FT                   VRRPEDRILSTGMFYLPGVNRGWGDSHRGGHGWTDLRKSIAQSVNTYYYKLALDLGIER
FT                   FTDYMRRYGLGQLTGVDLTGEISGILPSLEYKRKVRKQAWYQGDTVNVSIGQGDWKVTL
FT                   LQLVRSVAGLASGHMNRPHLVVAERAAFSQPWQVLPQPPSQPISSNPGHVQVVREGMID
FT                   TMRPGGTGYQAAIGAPYSIAGKTGTAQVASRKGEAAVDPRNLPMHLRHRALFVGFAPAD
FT                   NPTIAVAVAVEGGGYGASTAAPIARKIFDAWLLGKLPEGLEPLDSARGRTAIGLTQFDM
FT                   TVAGVCEAGNRAALQLGEIQVSVAGGMLNSTAMMPVAPRAPVTLDSLPEEDP"
FT   gene            698959..700080
FT                   /locus_tag="XfasM23_0591"
FT   CDS_pept        698959..700080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0591"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: xcb:XC_0695 rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92035"
FT                   /db_xref="GOA:B2I960"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B2I960"
FT                   /protein_id="ACB92035.1"
FT                   /translation="MRDLLRLLVDLVLRFTRTLDLPLCLTLGALMVIGLMVMHSAGAAV
FT                   TGTSHLMLSQSVRFAFGLLIMWCLSRVPVPRLRAWSPLVYVFSMVPLMVVFILGTGKYG
FT                   RQWLDLKLFYLQPAELLKISLPMMMAWYLHRMPLPPRLFTVMVSFMIIGIPTSLIMLQP
FT                   DFGTSVLVAASGIFVLLLAGLPWWWIGIGVVSIAMIAPFSWFWLLRPYQKDRIMMFLNP
FT                   ENDTLGAGWNIIQSKIAIGSGGLAGKGWGLGTQSHLNFIPEQTTDFAFSVLSEEFGWVG
FT                   VTTVLMLYLFVIMRCLWIAGQARDTYSRLLVGALALSFFVYVLVNGGMISGLLPVVGVP
FT                   MPLMSYGGTSAVSLLVGFGLVMGVRSHRRMHHR"
FT   sig_peptide     698959..699090
FT                   /locus_tag="XfasM23_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.949 at
FT                   residue 44"
FT   gene            700176..701219
FT                   /locus_tag="XfasM23_0592"
FT   CDS_pept        700176..701219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0592"
FT                   /product="S-adenosylmethionine--tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine--tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: xac:XAC2514
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92036"
FT                   /db_xref="GOA:B2I961"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I961"
FT                   /protein_id="ACB92036.1"
FT                   /translation="MLKKSDFHYDLPEELIAQGPLPERSASRLMLVPSAPEQFQDCYVR
FT                   DLPELLQPGDLLVFNDTRVIPARLFGRKVSGGRVELLIERFLGTHQAVVQLRTSRSLKV
FT                   GNRILLDAGGHAEVLGRDGEFYLLSFDVESPLEQWLSDVGQLPLPPYIHREPDEYDRER
FT                   YQTVFARSVGAVAAPTAGLHFDESLLARLRARGVEFGYITLHVGAGTFQPVRVALLQEH
FT                   VMHSEWFKVGAELVEQVRSARARGGRVIAVGTTVVRSLESAMRHGELQPFVGETQIFIF
FT                   PGYCIRSVDAMVTNFHLPESTLLMLVAAFAGRTRILDAYYHAVQQRYRFFSYGDAMLLF
FT                   PRNAGEQ"
FT   gene            701947..704103
FT                   /locus_tag="XfasM23_0593"
FT   CDS_pept        701947..704103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0593"
FT                   /product="RelA/SpoT family protein"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: xcc:XCC2936 ATP:GTP 3'-pyrophosphotranferase;
FT                   TIGRFAM: RelA/SpoT family protein; PFAM: TGS domain
FT                   protein; RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92037"
FT                   /db_xref="GOA:B2I962"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B2I962"
FT                   /protein_id="ACB92037.1"
FT                   /translation="MNVSLFPQELDVLLRRSGVSTLNPELSQGLVQACQALPSEAGQQV
FT                   AWPVLLDMLDALVVLSADETLLIAALLFDLPMLRPMLPVLPWRSSTHQQMVGSLLDGQD
FT                   AAEQVWTLHAGCAAGRNGEGLRRLLLALVHDLRVVPILLARQLAKMRAAGVLLESQRRA
FT                   LAQLTRDIHAPLANRLGIWQLKWELEDLAFCYLESEIYRSIASALDESRVARERYISVI
FT                   AMELSRVLAEHGVCAEVSGRPKHIYSIWRKMQKKRLHFEQVYDLQAVRVMVEDMAACYA
FT                   ALGVVHALWAPVPGEFDDYIARPKANDYRSLHTAVLGPEERTVEVQIRTHEMHAHAELG
FT                   VAAHWKYKEDGKGAERDFDRKIVWMRQLLEQAQEGEFGEVVEALDTELLEDRVYALTPK
FT                   GEVIDVPQGATPLDFAYHVHTMVGHCCRGAKVNGRIVPLTYRLRSGDRVEILTAKEANP
FT                   HRDWLLRANGFLASRRSRDKVRAWFNKIERARNVQVGKESLDRELKRVGQQYVDLSPIA
FT                   RRFHADSVDDLYVQIALGNIGPNQVSRALLETERVVAFAPLARPSKKRHGLSKSMFIVQ
FT                   GVSNILVQLARCCQPVCGEPIAGYLTLSRGVTVHRADCAVLMRLNAMHPQRVLSVEWGS
FT                   QLSGSYEVEILVRAVNRRWLLKDIADVIAQEDAHMLEMSSDAFRDNGYLQFRVRLRLSH
FT                   HRQLAALLGKLDGLSGVNEVRRMG"
FT   gene            704230..705741
FT                   /locus_tag="XfasM23_0594"
FT   CDS_pept        704230..705741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xoo:XOO1737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92038"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2I963"
FT                   /protein_id="ACB92038.1"
FT                   /translation="MFFPFFSRLRLRMCILLRRCSVWHVLSIGTLLLGVAVLVLSKFLA
FT                   DWAWPDSRITQLLQRGEVALVQGNLSAPDGSGARELFETAKALDSDRHEAQDGLLRTGQ
FT                   AALAQARITFDRGQFDAAERYLRLARVLQMPQDQVDVLERLVRQRQAEHADLDQLLVRA
FT                   DEAYVAGRLEGDPNSALPLYQRVLELVPGFSRALQGREDALSELLRQACVDLERGQLDA
FT                   AAAKLNVAQRYDPGHVDLPQTQDLFNRAIDVHLHRAVRLLRRGLLAPAARDFRAVLAVR
FT                   PEQSAARRGLEDVVERYVAHAGRQAAEFHFEQAELSLARARALLPDQGSIYLAEQALQR
FT                   ARQTRLSLQPKLSKVERERYLGELMGRFDVAERLKEWLTPPGISAYDQVRAAQAIAPAD
FT                   ARVQRAAQRLLVAMRACFEEELGRNRLQSAQACLDVWQAINGQDVGLLGARKRLAQRWI
FT                   AVGSERFGEGDITFARRALEQARRWGARTPELDELARRVNLASQR"
FT   gene            complement(706251..706754)
FT                   /locus_tag="XfasM23_0595"
FT   CDS_pept        complement(706251..706754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92039"
FT                   /db_xref="UniProtKB/TrEMBL:B2I964"
FT                   /protein_id="ACB92039.1"
FT                   /translation="MPSTLTTSQTTPNALENVVRIGHIVPEDALELLARYGLHLHLIED
FT                   GAPIPGSYWGEPEAGIIGCNVYVRNDTPVHSMLHEACHLIVLPPEQRATVHTNATNSSE
FT                   EEDATCYLQIVLADALQGIDRDRLMQDMDAWGYSYRLGSTRAWFEQDAENARDWLNARG
FT                   LLTP"
FT   gene            complement(706817..707074)
FT                   /locus_tag="XfasM23_0596"
FT   CDS_pept        complement(706817..707074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0596"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: xom:XOO_3338 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92040"
FT                   /db_xref="GOA:B2I965"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I965"
FT                   /protein_id="ACB92040.1"
FT                   /translation="MGLIDFLRNKTKTAETAKNRLQIIIAQERTQRGGPDYLPLLQREL
FT                   LEVIKKYVKIDADAVKVDLIKDGANDVLDISVALPDDSER"
FT   gene            complement(707077..707886)
FT                   /locus_tag="XfasM23_0597"
FT   CDS_pept        complement(707077..707886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0597"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: xoo:XOO3531
FT                   septum site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92041"
FT                   /db_xref="GOA:B2I966"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2I966"
FT                   /protein_id="ACB92041.1"
FT                   /translation="MAEIIVITSGKGGVGKTTTSASLACGLARRGKKVAVIDFDVGLRN
FT                   LDLIMGCERRVVYDFVNVIHGEATLKQALIKDKRFDNLYLLAAAQTRDKDALTKEGVEK
FT                   VLNELQAEGFDYICCDSPAGIEKGASLAMYFADRAVVVVNPEVSSVRDSDRIIGLLDSK
FT                   TKKAETGGSIITTLLLTRYSPTRVESGEMLSITDVEEVLGLKAIGIIPESGDVLNASNK
FT                   GEPVILDNNSLAGLAYEDAVGRILGEDHPMRFTTVEKKGFFSKLFGS"
FT   gene            complement(707923..708639)
FT                   /locus_tag="XfasM23_0598"
FT   CDS_pept        complement(707923..708639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0598"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; Septum formation inhibitor
FT                   MinC domain protein; KEGG: xcc:XCC1125 septum formation
FT                   inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92042"
FT                   /db_xref="GOA:B2I967"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2I967"
FT                   /protein_id="ACB92042.1"
FT                   /translation="MSNVNMDFEQAGELKIGQVGIATLRIRTLNVPRLIQEMSDRVTRA
FT                   PKLFRRTAVILDFGELPHPPDLATAKALVEGLRAANVLPVAIAYGTNEIDLLSQQLGLP
FT                   LLSKFRAHYERQEVAAPPPQSTPPISTGRIQHTTVRSGQQLYAEHCDLTILNTVGAGAE
FT                   VIADGNIHIYGTLRGRAMAGARGNAEMRIFCRDFQAELIAIAGRYKVLDDIPTELRGKA
FT                   VQVWLEQNQIKIAALD"
FT   gene            complement(708655..709233)
FT                   /locus_tag="XfasM23_0599"
FT   CDS_pept        complement(708655..709233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92043"
FT                   /db_xref="GOA:B2I968"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I968"
FT                   /protein_id="ACB92043.1"
FT                   /translation="MPIIIRDVRESELDAVLTLNNEAGLAILPLDLSALYRFYKEADYF
FT                   RVAERDGNLAGFLVGFGSASRHGSSNFAWFRERYENFFYIDRIVVASRRRGGGVGRAFY
FT                   ADVHSYAELRYPYLTCEVFLDHGAEAALLFHGSFGFHEVGQNTMTGIDVRASMLMKKMC
FT                   SYPWIQETYGDKLPNLPWVGLQRHICTPN"
FT   gene            709636..710823
FT                   /locus_tag="XfasM23_0600"
FT   CDS_pept        709636..710823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92044"
FT                   /db_xref="GOA:B2I969"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:B2I969"
FT                   /protein_id="ACB92044.1"
FT                   /translation="MIRSRITEFLIALGMVAVLFLVIGFVLPGQRHMSESIGTNRKATI
FT                   VYDTVNSFRRFKDWNPLLLRDPKLQINLVGPESGKGARVEYSSNQKDIGSGSWEIINSV
FT                   KNERVEIAIQDATRGYDKVTTFTLKPSGKNNRNIEITQDYNVKYGFNLFGRYAGLYVSR
FT                   NVGEHLKVGLLRLSNILASVPNVDYRAEIDGKLTVTNLRIVDVPGENLLAVNAGNIDRQ
FT                   NDTIKKSIKDNQEWIKRVMDANGLEPSAPIRIVTTDFAQQKYAFDVVQPVRKKVESKPG
FT                   ETKSKTDSKEKKPQKNVVDKDKVVHAATVSADGALKVAISAGAPVKYVHTKPRRAASAS
FT                   YTGHMAGLDAARNALRAWAVTSGYEVIDRPYESWKGGVDKAFTQEGSYDLYWAVK"
FT   gene            711182..711862
FT                   /locus_tag="XfasM23_0601"
FT   CDS_pept        711182..711862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0601"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: xom:XOO_3330
FT                   DNA-3-methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92045"
FT                   /db_xref="GOA:B2I917"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B2I917"
FT                   /protein_id="ACB92045.1"
FT                   /translation="MAWYPRGFDVMAAYDYLYHCDPGLSGWMQRLGPLPALRRWRQPFN
FT                   VVDALARAILFQQLSGKAASTIVARIEAVIGSTCLYAETLACIDDACLRACGVSSNKIL
FT                   ALRDLTRREVAGELPSVWQMGSMHHNTIVEKLIPIRGIGRWTVEMMLIFRLGRPDVLPV
FT                   DDLGVRKGIQRVDSLAFVPTPKALCTRGECWAPYRTYAGLYLWRIADFHEGERAVISDR
FT                   SQDE"
FT   gene            complement(712204..712773)
FT                   /locus_tag="XfasM23_0602"
FT   CDS_pept        complement(712204..712773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0602"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xcb:XC_1257
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92046"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B2I918"
FT                   /protein_id="ACB92046.1"
FT                   /translation="MFKGSFLTVLTAATLVIGCYVVPPACATDYVQTSGSILVFSNKYD
FT                   GKVFTGTFPGFYTQMSFDPNDLSKAHLDVTIPLTHAQTGDKDRDSTLQSADFFNVSKFA
FT                   TAHYQASKFRALGHDKYAADGTLELHGMTKPVTLTFTWTPSTHPVLNGKATVNRLDFGI
FT                   GSGDWADIKIIPNETAISTKVVFKAK"
FT   sig_peptide     complement(712690..712773)
FT                   /locus_tag="XfasM23_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.989 at
FT                   residue 28"
FT   gene            complement(712791..713357)
FT                   /locus_tag="XfasM23_0603"
FT   CDS_pept        complement(712791..713357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0603"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: xac:XAC3033 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92047"
FT                   /db_xref="GOA:B2I9F3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F3"
FT                   /protein_id="ACB92047.1"
FT                   /translation="MTLKGTAERWGWMSQALHWLIAVLILGLGIGGLIMGKLPKTPNYF
FT                   WVYTAHKSIGISVLALAVLRLFWRLYAGAPKPIAGTPVWQERVANATHIMLYVLIFTIP
FT                   LAGWLYDSARGLRTFYWFGLFEMPALVSPNETIRGVALEIHKLSFWALIGLVVLHAGAA
FT                   FHHHLIQRDATLARMLPRNWFSSKS"
FT   gene            complement(713370..714074)
FT                   /locus_tag="XfasM23_0604"
FT   CDS_pept        complement(713370..714074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0604"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xom:XOO_1724
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92048"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F4"
FT                   /protein_id="ACB92048.1"
FT                   /translation="MFRINLMLLALLLTVPLVGTAATTRYVLDPVHTRIMFVIDHAGIS
FT                   KALGTVSGSTGILDFDPDNWSNAQLDVHIPLQRVDLGDAKWNKATLAQGLLDTAHYPEA
FT                   HFVSTQVTATSPSNGKAIGKLTLHGITREVVLDVTLYGIKRHPLPPFRRTVGFSANTTL
FT                   SRSAFGINAWKSMIGDEVQLRIEVEAVRQGSIKKETTEQTVHQDTTTSSNTKESDATLH
FT                   KTDTSKKTNELL"
FT   sig_peptide     complement(714009..714074)
FT                   /locus_tag="XfasM23_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            714184..717756
FT                   /locus_tag="XfasM23_0605"
FT   CDS_pept        714184..717756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0605"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Two component regulator propeller; Two component
FT                   regulator three Y domain protein; KEGG: xcb:XC_1260
FT                   histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92049"
FT                   /db_xref="GOA:B2I9F5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F5"
FT                   /protein_id="ACB92049.1"
FT                   /translation="MRCLKRVRGGLLTALLVFVSLLTATAAVPEMPRFRVLDATSGLPS
FT                   NVVRAMLQDAAGYLWLATSDGLARYDGTAFKVWRHDPNDPGSLPGDSVLALYIDVQDRI
FT                   WVLSENAGLAVLDAQRRRFIQIPVGSVAKTDALHTLTGHGDAIWLSDLHASVIRIDSAG
FT                   ALTRYALADVSPTLKDTPVVALTFDANGRLWVGTPDGLLYFEAGRLHLAPPPLDKTSIH
FT                   SIAAVGSRLWVGSTDGVYLQDAEGRWRAPNWGPMFAFGNLLLSVADAGDGEFWLGSERG
FT                   LWRTRQERPPVQIPLSDMHHGVSTVSSLWRDTSGGLWVPVYGRGLGYLRQDWKRMAVVR
FT                   PSDGGESAYCNVAPAAYSGGLWQLNRIGELMHLNTSTGELVHTGWQRHELRGVNITATL
FT                   EDSRGRLWLANMQNGLSRLDLKNGQWREWAAHGDDAVPLYGPISWIVEMPDSSLWLEAL
FT                   GVLQQRDLESGRVLNQIVPGSHGLDGSRVEQIGLGPDGRLWLAAGSGVYAWESQRRMFV
FT                   PIPDLTGTRAYSFVPVGGNEVWVHRLRGLEQWRHSSHGWKRVALVGPQHGLPAMESLGM
FT                   QHDAQGRIWLSTRRGLWRIDNTDELQVRNFGLRDGLGTQEFAEACLWMAPDGVLVGGTT
FT                   DGYLMLFDTAMPDPAPFVPQLRMETVSVIRAGHRIDLPVDQPFELLPNDRQLIVGARLL
FT                   SFGDPLSNRYSYWLKGFDTGWIDQGSSGTREFSSLPPADYTLLIQGTDPMGNLSRIHLV
FT                   TFRVLPPWWRSAWGMSVLTGSGLLLLWGVAWNYHRRLRRRARLQLEQHQREVAERASLA
FT                   KTQFLATLGHEVRTPMTGVLGMSELLLETPLDTRQHGYATSIQAAGKHLLRLVNDALDL
FT                   AKIEAGKLSLERRDFDFHALLEQVVAMIRPMVERKGLRFVYRLDPEVPQYVHGDADRLQ
FT                   QILLNLLINATKFTEHGEVVLQVAPGQEQACLGVRIDVADTGPGLSEEQCQRLFRRFEQ
FT                   VNGASTAARYGGSGLGLAICRELATVMEGEIHVDSELGKGTCFRVLLPLPWVLAVQPAV
FT                   AVMDMEPSPCSNPLHLLLIEDDPTVAEVIVELLRARGHRVTHALHGLEALVEVTLTRFD
FT                   ACLCDLDLPGLDGAGLIVQLRAQGQSFPIVVVTARTDADAQRQAFHVGCDAFLRKPVTG
FT                   EMLEQVLTQVLSAPRQDADVDTPT"
FT   sig_peptide     714184..714264
FT                   /locus_tag="XfasM23_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 27"
FT   gene            complement(717916..718983)
FT                   /locus_tag="XfasM23_0606"
FT   CDS_pept        complement(717916..718983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0606"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: ajs:Ajs_2196
FT                   DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92050"
FT                   /db_xref="GOA:B2I9F6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F6"
FT                   /protein_id="ACB92050.1"
FT                   /translation="MSRHPRRPKNIPNIVGVDLFCGVGGLTHGLARGGISVAAGIDIDP
FT                   NCQFPFEANNAALFLECDVARLKAAAVRGFYQAADITLLAGCAPCQPFSAYSRSRRNNA
FT                   YASQWPLVLAFARLVKQLKPDLVTMENVPQLVNHTVFQQFLKSLSGYKTWWHIVECASI
FT                   GVPQTRKRLVLLASRLGSQGLELSQQHVPRMTVREAIGSLPPIHAGERDPQDALHTAAS
FT                   LSALNMSRIRASRPGGTWRDWPAALRAACHCKDTGATYPSVYGRMEWDQPAPTITTQCF
FT                   GYGNGRFGHPEQDRAISLREAAILQTFPKSYRFAPPGAPITVNTMGRLIGNAVPVRLGE
FT                   VIARSLVRHVQGYMG"
FT   gene            complement(718980..719717)
FT                   /locus_tag="XfasM23_0607"
FT   CDS_pept        complement(718980..719717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ter:Tery_4677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92051"
FT                   /db_xref="InterPro:IPR040788"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F7"
FT                   /protein_id="ACB92051.1"
FT                   /translation="MSSKLRIAFQERLEEVNAYLELLTVMDAQAQQGQPRIKGAADPIT
FT                   PQQQKILYSSVYLQLYNLVEATISHCIKAVAEAVKGNAQCTPKQLNDAMRREWVRVVAR
FT                   THTTLEPNKRLDSALQLCNHLLAASPIDTFTIEKANAGNWDDREIENVIERVGLELKIN
FT                   KRVYQAIKQPFRNDLGPLAFVKQLRNDLAHGSISFAECAAEITVKELVALKEKTVDYLD
FT                   DVVDHFARYIDRFEYLAPEKRPA"
FT   gene            complement(719714..720814)
FT                   /locus_tag="XfasM23_0608"
FT   CDS_pept        complement(719714..720814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0608"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   ter:Tery_4676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92052"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:B2I9F8"
FT                   /protein_id="ACB92052.1"
FT                   /translation="MEKQKERTVIKSEEIKSEEEGLNADAQIVALSKRIEFYLTEYSVE
FT                   LLARKMNNGDFIIPAYQREYTWDDHRKSRFIESLILGLPIPFLFFWERPEDGTLEIVDG
FT                   SQRLRSIEEFLLGNLQLGKLQTLTALSGFRFSDLPESRQRKINNRSIRGVVLNEHADEK
FT                   ARFDMFERINTGSKIANMAEIRRGALPGPFMTLIIDLAELPEFIALTPVSQKNFKEREH
FT                   EELVSRFFAYSDGLDEYKDRPSTFIFNYIKTMNDKAAQDETLTERYRKQFEEVIDFVAR
FT                   VFPHGFSKIPKGKATPRTRFEAIAVGSRLALNKRPSLANATPPSVTTWLTSKEFTEILR
FT                   SDGANAITLLRKRTEFVRNQLLRESK"
FT   gene            complement(720944..722008)
FT                   /locus_tag="XfasM23_0609"
FT   CDS_pept        complement(720944..722008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XfasM23_0609"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: xcv:XCV3163 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:XfasM23_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACB92053"
FT                   /db_xref="GOA:B2I9F9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss