(data stored in ACNUC7421 zone)

EMBL: CP001013

ID   CP001013; SV 1; circular; genomic DNA; STD; PRO; 4909403 BP.
XX
AC   CP001013;
XX
PR   Project:PRJNA20039;
XX
DT   26-MAR-2008 (Rel. 95, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 6)
XX
DE   Leptothrix cholodnii SP-6 chromosome, complete genome.
XX
KW   .
XX
OS   Leptothrix cholodnii SP-6
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Leptothrix.
XX
RN   [1]
RP   1-4909403
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Lykidis A., Emerson D., Richardson P.;
RT   "Complete sequence of Leptothrix cholodnii SP-6";
RL   Unpublished.
XX
RN   [2]
RP   1-4909403
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Lykidis A., Emerson D., Richardson P.;
RT   ;
RL   Submitted (24-MAR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e1bd2583916d1314a9e81f73d3a6ff0f.
DR   BioSample; SAMN02598429.
DR   EnsemblGenomes-Gn; EBG00001213748.
DR   EnsemblGenomes-Gn; EBG00001213749.
DR   EnsemblGenomes-Gn; EBG00001213750.
DR   EnsemblGenomes-Gn; EBG00001213751.
DR   EnsemblGenomes-Gn; EBG00001213752.
DR   EnsemblGenomes-Gn; EBG00001213753.
DR   EnsemblGenomes-Gn; EBG00001213754.
DR   EnsemblGenomes-Gn; EBG00001213755.
DR   EnsemblGenomes-Gn; EBG00001213756.
DR   EnsemblGenomes-Gn; EBG00001213757.
DR   EnsemblGenomes-Gn; EBG00001213758.
DR   EnsemblGenomes-Gn; EBG00001213759.
DR   EnsemblGenomes-Gn; EBG00001213760.
DR   EnsemblGenomes-Gn; EBG00001213761.
DR   EnsemblGenomes-Gn; EBG00001213762.
DR   EnsemblGenomes-Gn; EBG00001213763.
DR   EnsemblGenomes-Gn; EBG00001213764.
DR   EnsemblGenomes-Gn; EBG00001213765.
DR   EnsemblGenomes-Gn; EBG00001213766.
DR   EnsemblGenomes-Gn; EBG00001213767.
DR   EnsemblGenomes-Gn; EBG00001213768.
DR   EnsemblGenomes-Gn; EBG00001213769.
DR   EnsemblGenomes-Gn; EBG00001213770.
DR   EnsemblGenomes-Gn; EBG00001213771.
DR   EnsemblGenomes-Gn; EBG00001213772.
DR   EnsemblGenomes-Gn; EBG00001213773.
DR   EnsemblGenomes-Gn; EBG00001213774.
DR   EnsemblGenomes-Gn; EBG00001213775.
DR   EnsemblGenomes-Gn; EBG00001213776.
DR   EnsemblGenomes-Gn; EBG00001213777.
DR   EnsemblGenomes-Gn; EBG00001213778.
DR   EnsemblGenomes-Gn; EBG00001213779.
DR   EnsemblGenomes-Gn; EBG00001213780.
DR   EnsemblGenomes-Gn; EBG00001213781.
DR   EnsemblGenomes-Gn; EBG00001213782.
DR   EnsemblGenomes-Gn; EBG00001213783.
DR   EnsemblGenomes-Gn; EBG00001213784.
DR   EnsemblGenomes-Gn; EBG00001213785.
DR   EnsemblGenomes-Gn; EBG00001213786.
DR   EnsemblGenomes-Gn; EBG00001213787.
DR   EnsemblGenomes-Gn; EBG00001213788.
DR   EnsemblGenomes-Gn; EBG00001213789.
DR   EnsemblGenomes-Gn; EBG00001213790.
DR   EnsemblGenomes-Gn; EBG00001213791.
DR   EnsemblGenomes-Gn; EBG00001213792.
DR   EnsemblGenomes-Gn; EBG00001213793.
DR   EnsemblGenomes-Gn; EBG00001213794.
DR   EnsemblGenomes-Gn; EBG00001213795.
DR   EnsemblGenomes-Gn; EBG00001213796.
DR   EnsemblGenomes-Gn; EBG00001213797.
DR   EnsemblGenomes-Gn; EBG00001213798.
DR   EnsemblGenomes-Gn; EBG00001213799.
DR   EnsemblGenomes-Gn; EBG00001213800.
DR   EnsemblGenomes-Gn; EBG00001213801.
DR   EnsemblGenomes-Gn; EBG00001213802.
DR   EnsemblGenomes-Gn; EBG00001213803.
DR   EnsemblGenomes-Gn; EBG00001213804.
DR   EnsemblGenomes-Gn; EBG00001213805.
DR   EnsemblGenomes-Gn; EBG00001213806.
DR   EnsemblGenomes-Gn; EBG00001213807.
DR   EnsemblGenomes-Gn; EBG00001213808.
DR   EnsemblGenomes-Gn; EBG00001213809.
DR   EnsemblGenomes-Gn; EBG00001213810.
DR   EnsemblGenomes-Gn; EBG00001213811.
DR   EnsemblGenomes-Gn; Lcho_R0001.
DR   EnsemblGenomes-Gn; Lcho_R0002.
DR   EnsemblGenomes-Gn; Lcho_R0003.
DR   EnsemblGenomes-Gn; Lcho_R0004.
DR   EnsemblGenomes-Gn; Lcho_R0005.
DR   EnsemblGenomes-Gn; Lcho_R0006.
DR   EnsemblGenomes-Gn; Lcho_R0007.
DR   EnsemblGenomes-Gn; Lcho_R0008.
DR   EnsemblGenomes-Gn; Lcho_R0009.
DR   EnsemblGenomes-Gn; Lcho_R0010.
DR   EnsemblGenomes-Gn; Lcho_R0011.
DR   EnsemblGenomes-Gn; Lcho_R0012.
DR   EnsemblGenomes-Gn; Lcho_R0013.
DR   EnsemblGenomes-Gn; Lcho_R0014.
DR   EnsemblGenomes-Gn; Lcho_R0015.
DR   EnsemblGenomes-Gn; Lcho_R0016.
DR   EnsemblGenomes-Gn; Lcho_R0017.
DR   EnsemblGenomes-Gn; Lcho_R0018.
DR   EnsemblGenomes-Gn; Lcho_R0019.
DR   EnsemblGenomes-Gn; Lcho_R0020.
DR   EnsemblGenomes-Gn; Lcho_R0021.
DR   EnsemblGenomes-Gn; Lcho_R0022.
DR   EnsemblGenomes-Gn; Lcho_R0023.
DR   EnsemblGenomes-Gn; Lcho_R0024.
DR   EnsemblGenomes-Gn; Lcho_R0025.
DR   EnsemblGenomes-Gn; Lcho_R0026.
DR   EnsemblGenomes-Gn; Lcho_R0027.
DR   EnsemblGenomes-Gn; Lcho_R0028.
DR   EnsemblGenomes-Gn; Lcho_R0029.
DR   EnsemblGenomes-Gn; Lcho_R0030.
DR   EnsemblGenomes-Gn; Lcho_R0031.
DR   EnsemblGenomes-Gn; Lcho_R0032.
DR   EnsemblGenomes-Gn; Lcho_R0033.
DR   EnsemblGenomes-Gn; Lcho_R0034.
DR   EnsemblGenomes-Gn; Lcho_R0035.
DR   EnsemblGenomes-Gn; Lcho_R0036.
DR   EnsemblGenomes-Gn; Lcho_R0037.
DR   EnsemblGenomes-Gn; Lcho_R0038.
DR   EnsemblGenomes-Gn; Lcho_R0039.
DR   EnsemblGenomes-Gn; Lcho_R0040.
DR   EnsemblGenomes-Gn; Lcho_R0041.
DR   EnsemblGenomes-Gn; Lcho_R0042.
DR   EnsemblGenomes-Gn; Lcho_R0043.
DR   EnsemblGenomes-Gn; Lcho_R0044.
DR   EnsemblGenomes-Gn; Lcho_R0045.
DR   EnsemblGenomes-Gn; Lcho_R0046.
DR   EnsemblGenomes-Gn; Lcho_R0047.
DR   EnsemblGenomes-Gn; Lcho_R0048.
DR   EnsemblGenomes-Gn; Lcho_R0049.
DR   EnsemblGenomes-Gn; Lcho_R0050.
DR   EnsemblGenomes-Gn; Lcho_R0051.
DR   EnsemblGenomes-Gn; Lcho_R0052.
DR   EnsemblGenomes-Gn; Lcho_R0053.
DR   EnsemblGenomes-Gn; Lcho_R0054.
DR   EnsemblGenomes-Gn; Lcho_R0055.
DR   EnsemblGenomes-Gn; Lcho_R0056.
DR   EnsemblGenomes-Gn; Lcho_R0057.
DR   EnsemblGenomes-Gn; Lcho_R0058.
DR   EnsemblGenomes-Gn; Lcho_R0059.
DR   EnsemblGenomes-Gn; Lcho_R0060.
DR   EnsemblGenomes-Tr; EBT00001782870.
DR   EnsemblGenomes-Tr; EBT00001782871.
DR   EnsemblGenomes-Tr; EBT00001782872.
DR   EnsemblGenomes-Tr; EBT00001782873.
DR   EnsemblGenomes-Tr; EBT00001782874.
DR   EnsemblGenomes-Tr; EBT00001782875.
DR   EnsemblGenomes-Tr; EBT00001782876.
DR   EnsemblGenomes-Tr; EBT00001782877.
DR   EnsemblGenomes-Tr; EBT00001782878.
DR   EnsemblGenomes-Tr; EBT00001782879.
DR   EnsemblGenomes-Tr; EBT00001782880.
DR   EnsemblGenomes-Tr; EBT00001782881.
DR   EnsemblGenomes-Tr; EBT00001782882.
DR   EnsemblGenomes-Tr; EBT00001782883.
DR   EnsemblGenomes-Tr; EBT00001782884.
DR   EnsemblGenomes-Tr; EBT00001782885.
DR   EnsemblGenomes-Tr; EBT00001782886.
DR   EnsemblGenomes-Tr; EBT00001782887.
DR   EnsemblGenomes-Tr; EBT00001782888.
DR   EnsemblGenomes-Tr; EBT00001782889.
DR   EnsemblGenomes-Tr; EBT00001782890.
DR   EnsemblGenomes-Tr; EBT00001782891.
DR   EnsemblGenomes-Tr; EBT00001782892.
DR   EnsemblGenomes-Tr; EBT00001782893.
DR   EnsemblGenomes-Tr; EBT00001782894.
DR   EnsemblGenomes-Tr; EBT00001782895.
DR   EnsemblGenomes-Tr; EBT00001782896.
DR   EnsemblGenomes-Tr; EBT00001782897.
DR   EnsemblGenomes-Tr; EBT00001782898.
DR   EnsemblGenomes-Tr; EBT00001782899.
DR   EnsemblGenomes-Tr; EBT00001782900.
DR   EnsemblGenomes-Tr; EBT00001782901.
DR   EnsemblGenomes-Tr; EBT00001782902.
DR   EnsemblGenomes-Tr; EBT00001782903.
DR   EnsemblGenomes-Tr; EBT00001782904.
DR   EnsemblGenomes-Tr; EBT00001782905.
DR   EnsemblGenomes-Tr; EBT00001782906.
DR   EnsemblGenomes-Tr; EBT00001782907.
DR   EnsemblGenomes-Tr; EBT00001782908.
DR   EnsemblGenomes-Tr; EBT00001782909.
DR   EnsemblGenomes-Tr; EBT00001782910.
DR   EnsemblGenomes-Tr; EBT00001782911.
DR   EnsemblGenomes-Tr; EBT00001782912.
DR   EnsemblGenomes-Tr; EBT00001782913.
DR   EnsemblGenomes-Tr; EBT00001782914.
DR   EnsemblGenomes-Tr; EBT00001782915.
DR   EnsemblGenomes-Tr; EBT00001782916.
DR   EnsemblGenomes-Tr; EBT00001782917.
DR   EnsemblGenomes-Tr; EBT00001782918.
DR   EnsemblGenomes-Tr; EBT00001782919.
DR   EnsemblGenomes-Tr; EBT00001782920.
DR   EnsemblGenomes-Tr; EBT00001782921.
DR   EnsemblGenomes-Tr; EBT00001782922.
DR   EnsemblGenomes-Tr; EBT00001782923.
DR   EnsemblGenomes-Tr; EBT00001782924.
DR   EnsemblGenomes-Tr; EBT00001782925.
DR   EnsemblGenomes-Tr; EBT00001782926.
DR   EnsemblGenomes-Tr; EBT00001782927.
DR   EnsemblGenomes-Tr; EBT00001782928.
DR   EnsemblGenomes-Tr; EBT00001782929.
DR   EnsemblGenomes-Tr; EBT00001782930.
DR   EnsemblGenomes-Tr; EBT00001782931.
DR   EnsemblGenomes-Tr; EBT00001782932.
DR   EnsemblGenomes-Tr; EBT00001782933.
DR   EnsemblGenomes-Tr; Lcho_R0001-1.
DR   EnsemblGenomes-Tr; Lcho_R0002-1.
DR   EnsemblGenomes-Tr; Lcho_R0003-1.
DR   EnsemblGenomes-Tr; Lcho_R0004-1.
DR   EnsemblGenomes-Tr; Lcho_R0005-1.
DR   EnsemblGenomes-Tr; Lcho_R0006-1.
DR   EnsemblGenomes-Tr; Lcho_R0007-1.
DR   EnsemblGenomes-Tr; Lcho_R0008-1.
DR   EnsemblGenomes-Tr; Lcho_R0009-1.
DR   EnsemblGenomes-Tr; Lcho_R0010-1.
DR   EnsemblGenomes-Tr; Lcho_R0011-1.
DR   EnsemblGenomes-Tr; Lcho_R0012-1.
DR   EnsemblGenomes-Tr; Lcho_R0013-1.
DR   EnsemblGenomes-Tr; Lcho_R0014-1.
DR   EnsemblGenomes-Tr; Lcho_R0015-1.
DR   EnsemblGenomes-Tr; Lcho_R0016-1.
DR   EnsemblGenomes-Tr; Lcho_R0017-1.
DR   EnsemblGenomes-Tr; Lcho_R0018-1.
DR   EnsemblGenomes-Tr; Lcho_R0019-1.
DR   EnsemblGenomes-Tr; Lcho_R0020-1.
DR   EnsemblGenomes-Tr; Lcho_R0021-1.
DR   EnsemblGenomes-Tr; Lcho_R0022-1.
DR   EnsemblGenomes-Tr; Lcho_R0023-1.
DR   EnsemblGenomes-Tr; Lcho_R0024-1.
DR   EnsemblGenomes-Tr; Lcho_R0025-1.
DR   EnsemblGenomes-Tr; Lcho_R0026-1.
DR   EnsemblGenomes-Tr; Lcho_R0027-1.
DR   EnsemblGenomes-Tr; Lcho_R0028-1.
DR   EnsemblGenomes-Tr; Lcho_R0029-1.
DR   EnsemblGenomes-Tr; Lcho_R0030-1.
DR   EnsemblGenomes-Tr; Lcho_R0031-1.
DR   EnsemblGenomes-Tr; Lcho_R0032-1.
DR   EnsemblGenomes-Tr; Lcho_R0033-1.
DR   EnsemblGenomes-Tr; Lcho_R0034-1.
DR   EnsemblGenomes-Tr; Lcho_R0035-1.
DR   EnsemblGenomes-Tr; Lcho_R0036-1.
DR   EnsemblGenomes-Tr; Lcho_R0037-1.
DR   EnsemblGenomes-Tr; Lcho_R0038-1.
DR   EnsemblGenomes-Tr; Lcho_R0039-1.
DR   EnsemblGenomes-Tr; Lcho_R0040-1.
DR   EnsemblGenomes-Tr; Lcho_R0041-1.
DR   EnsemblGenomes-Tr; Lcho_R0042-1.
DR   EnsemblGenomes-Tr; Lcho_R0043-1.
DR   EnsemblGenomes-Tr; Lcho_R0044-1.
DR   EnsemblGenomes-Tr; Lcho_R0045-1.
DR   EnsemblGenomes-Tr; Lcho_R0046-1.
DR   EnsemblGenomes-Tr; Lcho_R0047-1.
DR   EnsemblGenomes-Tr; Lcho_R0048-1.
DR   EnsemblGenomes-Tr; Lcho_R0049-1.
DR   EnsemblGenomes-Tr; Lcho_R0050-1.
DR   EnsemblGenomes-Tr; Lcho_R0051-1.
DR   EnsemblGenomes-Tr; Lcho_R0052-1.
DR   EnsemblGenomes-Tr; Lcho_R0053-1.
DR   EnsemblGenomes-Tr; Lcho_R0054-1.
DR   EnsemblGenomes-Tr; Lcho_R0055-1.
DR   EnsemblGenomes-Tr; Lcho_R0056-1.
DR   EnsemblGenomes-Tr; Lcho_R0057-1.
DR   EnsemblGenomes-Tr; Lcho_R0058-1.
DR   EnsemblGenomes-Tr; Lcho_R0059-1.
DR   EnsemblGenomes-Tr; Lcho_R0060-1.
DR   EuropePMC; PMC2620714; 19011059.
DR   EuropePMC; PMC3060100; 21437234.
DR   EuropePMC; PMC6595409; 31294068.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02243; Xoo8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001013.
DR   SILVA-SSU; CP001013.
DR   StrainInfo; 115267; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024183
CC   Source DNA and bacteria available from David Emerson
CC   (demerson@bigelow.org)
CC   Contacts: David Emerson (demerson@bigelow.org)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfmpageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4909403
FT                   /organism="Leptothrix cholodnii SP-6"
FT                   /strain="SP-6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:395495"
FT   gene            72..1604
FT                   /locus_tag="Lcho_0001"
FT   CDS_pept        72..1604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mpt:Mpe_A0001 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32277"
FT                   /db_xref="GOA:B1Y547"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y547"
FT                   /protein_id="ACB32277.1"
FT                   /translation="MHTDLWERGCERLAAELPEQQFNTWIRPLPPADVTLAGDGVLVGL
FT                   RVPNRFKLDWIRAQYGSRIEATLSELAGKPVRLELSLLPRDAVARAQGMAAAPAAQAGA
FT                   APQPTQSPMAIGAALHAAATARHDPQSVVPTPGGSANGRAAPRVGEPGGPVGTSTLPVA
FT                   PTLSPAVSRGRLNPALTFDTLVPGRANQMARTAALHVVGAPGHMYNPLFIYGGVGLGKT
FT                   HLIHAVGNALIRDNPDARVLYLHAEQFISDVVRNYQRKTFDELKAKYHSLDLLLIDDVQ
FT                   FFAGKDRTQEEFFNAFEALLAKRAHIIMTSDTYPKGLVDIDERLTSRFDAGLTVAIEPP
FT                   ELEMRVAILMKKSDAEGSRMPEDVAFFVAKNVRANVRELEGALRKVLAYSRFSHKEISI
FT                   NLAREALKDLLSIQNRQVSVENIQKTVADFYKIKIADMYSKKRPASIARPRQIAMYLAK
FT                   EMTQKSLPEIGELFGGRDHTTVLHAVRKIGGERQKNTELNQQLHVLEQTLKG"
FT   gene            1718..2863
FT                   /locus_tag="Lcho_0002"
FT   CDS_pept        1718..2863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mpt:Mpe_A0002 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32278"
FT                   /db_xref="GOA:B1Y548"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y548"
FT                   /protein_id="ACB32278.1"
FT                   /translation="MIVLKAAQEQVLGALQAVSGIVERRHTLPILANVLIRKSGGRTEL
FT                   TTSDLEIQVRTAAELGGDESAFSTTVGARKLIDILRMLPSDQIVTLTAAQNKLTLQGGK
FT                   SRFTLQTLPADDFPLVQEAADFGPAFSVPQKTLKSLIDQVHFAMAVHDIRYYLNGILFV
FT                   AEGKTLTLVATDGHRLALAQATLEAEIPKQEVILPRKTVLELQRLLKDDKASKEAAKQE
FT                   GAEEPRIEMRFADNQAKFSFGGMEFVTKLVEGKFPDYNRVIPRNHKNHVTLGRAPLLAS
FT                   LQRAAILTSEKFKGVRVNFEPGTLRIASSNAEQEEAKEELEIDYGGDAIEIGFNVTYLM
FT                   DVLANVNEDMVTLSLQDASSSALITVPERSGFKYVVMPMRI"
FT   gene            2965..5559
FT                   /locus_tag="Lcho_0003"
FT   CDS_pept        2965..5559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: mpt:Mpe_A0003 DNA topoisomerase
FT                   (ATP-hydrolyzing); TIGRFAM: DNA gyrase, B subunit; PFAM:
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32279"
FT                   /db_xref="GOA:B1Y549"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y549"
FT                   /protein_id="ACB32279.1"
FT                   /translation="MTDPKSLPQEPNGSADADGVTRRDLPDVEGVPVSTGAEASAAYGS
FT                   DSIQILEGLEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIIVTIHTD
FT                   NSISVIDNGRGIPTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVS
FT                   CVNGLSTWLRLTVRRDGRAHFMEFRQGIPQDRVLERRDGFEVSPMKVIGETDKRGTEVH
FT                   FLPDHTIFSNIDFHYEILSKRLRELSFLNNGVKIRLVDERNNKEDNFAYAGGVKGFVEF
FT                   VNKGKKVLHGNIFHARGDKMSDNQTNVGVEVAMQWNESYNENVLCFTNNIPQRDGGTHL
FT                   TGLRAAMTRVINKYIDDNDIAKKAKVEITGDDMREGLACVVSVKVPEPKFSSQTKDKLV
FT                   SSEVRAPVEDIVSRLLTDWLLENPTDAKTICSKIVDAARARDAARKAREMTRRKGVLDG
FT                   MGLPGKLADCQEKDPSLCEIYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYE
FT                   KLLTSNEILTLITALGTGIGKGMGGDDFNPDKLRYHRIIIMTDADVDGAHIRTLLLTFF
FT                   FRQMPDLVERGNIYIAQPPLYKVKHGKHEQYLKDGSELDAYLLKVAIDGATVEPGAGKP
FT                   AITGAALEELARQYVQASNVIARLSNWMDIEALRAISDGLTLDLDDAQKAEASAVALAG
FT                   ALLAVGSSAEVAAEYDARTDKHHLRISRRHHGNIKSSVITQDFVHGADYEALSRAGITF
FT                   KGLLADDATVKRGEGDKQKTAKAGDFRVAMAWLMQQAESSVGRQRYKGLGEMNPGQLWE
FT                   TTMDPTVRRLLRVQIEDAIEADKVFTMLMGDEVEPRRDFIESNALRAANIDV"
FT   gene            5756..6268
FT                   /locus_tag="Lcho_0004"
FT   CDS_pept        5756..6268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32280"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y550"
FT                   /protein_id="ACB32280.1"
FT                   /translation="MGLFDMFKSDSGDKMTPHLALATSLLYMMSADGEMDHEEIGHLLS
FT                   VLGGQSSADGTVGVGAQNQALLDNALKYRRKNPVEFFLKEATPLLSDAQKMCILVNMID
FT                   SSLSDGQPEPEEQAVFAKFMQAFGVSETRFQPFFEVIVLKNDRSVFTKQDHPKNSSGYQ
FT                   VKLSVPA"
FT   gene            complement(6287..7186)
FT                   /locus_tag="Lcho_0005"
FT   CDS_pept        complement(6287..7186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0005"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: pna:Pnap_3443
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32281"
FT                   /db_xref="GOA:B1Y551"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y551"
FT                   /protein_id="ACB32281.1"
FT                   /translation="MLNFKHLHYFWVAAKAGGIVRAGEQLHITPQTLSAQIKQLEERLG
FT                   CALFRKQGRGLELTDEGRVALGYADQLFAIADELETVIGSTRSGQQVLSFRVGIADSVP
FT                   KAIAYRLIEPALDAAAHVRLICHEGKFQDLLAQLAVHRLDLVIADEPMGRQLSIRAFNH
FT                   TLGSTATSFFATPELARQLQGPFPQCLDGAPMLLQGPASAMRRRLDTWLAEQHLRPRAI
FT                   AEFDDAALMKAFGSEGRGVFMSPTVLEAETQAQYGVDTIGRTEELVEEFYAISAERRIT
FT                   HPCVVAVTSAARGKLLRG"
FT   gene            complement(7230..7544)
FT                   /locus_tag="Lcho_0006"
FT   CDS_pept        complement(7230..7544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32282"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y552"
FT                   /protein_id="ACB32282.1"
FT                   /translation="MTFADTLKQLPPVAHLAGLQLLDAAGQVVATLENRPGQAGSVAVY
FT                   AALAQRHGAITPAAAVEGLQLYAEHTADAHAHPGRHPNIDRLIGCIAQAATYTVRLLPA
FT                   "
FT   gene            complement(7594..8796)
FT                   /locus_tag="Lcho_0007"
FT   CDS_pept        complement(7594..8796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0007"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: pna:Pnap_0166 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold-3 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32283"
FT                   /db_xref="GOA:B1Y553"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y553"
FT                   /protein_id="ACB32283.1"
FT                   /translation="MLHEGSESPERRGALRLALGIGAAYAAFGIAWILLSDAAVSAVST
FT                   EPGWLEVAQRYKGLFYVLITAVGLAVLVRSGHLRLMRADRQARSSELRVQDLFMRHPQP
FT                   MWLLDSRGLAFLKVNDAAILHYGYSADEFGRMTLADIRAPEDLAHRHEPAGSSLQGSPD
FT                   VGVVRHRKKSGEVIYAQVSVHPVPFDGGTAVMAMAIDITRDMLLKQAMENQEQQFRQLH
FT                   QSLGEVLWLASADGGNVLYVSPAIERIYGVSSDEFLRRPGLWLACVHPDDRALATASGA
FT                   RLKTEGRSSAEYRIVRPDGSVRWISDRKNVIVDEQGHTRMIGGIAEDITAIKDTEETLR
FT                   HQAEELARRNAELERFNQATVGREIDMIELKREINRLLQQAGQPPRHTLAFLDPPGPPQ
FT                   P"
FT   gene            8901..10451
FT                   /locus_tag="Lcho_0008"
FT   CDS_pept        8901..10451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0008"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   eba:ebA2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32284"
FT                   /db_xref="GOA:B1Y554"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y554"
FT                   /protein_id="ACB32284.1"
FT                   /translation="MNILPTGRRLVFVLCIAVAGLGGAGTADAVMASAWFDGGRPGAQA
FT                   QQAVALLADAASDGLEPQDYDAAALQRAVALAAQGPGLDAAAQSGLGDALSAAMQRFLA
FT                   DLHDGRIAPRQVHARFDVPRGAAFDPAAVLGAALAGQRLPQAVREAAPRLPLYEQLRQA
FT                   LAQYRALGEHPAWAQKLPPLRGRKLEPLQAWDGLPLLAGRLQVLGDLPADVPVPVRHEG
FT                   ALVAAVQAFQRRHGLGDDGVVGRATLAALAVTPAQRARQIALTLERLRWTPLQLGPRMI
FT                   VVNVPEFVLRAYETRDDRIDVRLEMKVIVGKALDTPTPLFTEEMRFIEFSPYWNVPRSI
FT                   AGAELVPRLQSEPAYFTRQGFEFVGRDGRVSAGFGDEQLDAVLRGELRIRQRPGPNNAL
FT                   GDIKFVFPNNDAIYLHHTPSPGLFERDRRDFSHGCIRVQEPVALAKFVLQDQPGWDEAR
FT                   IVEAMARGQSRTLRLDRPVPVLIAYGTVLVRQGRPHFLADVYGNDQLLDEALRKRRRR"
FT   sig_peptide     8901..8990
FT                   /locus_tag="Lcho_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.781 at
FT                   residue 30"
FT   gene            10501..11118
FT                   /locus_tag="Lcho_0009"
FT   CDS_pept        10501..11118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0009"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: eba:ebA2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32285"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y555"
FT                   /protein_id="ACB32285.1"
FT                   /translation="MQYHRPHPPVHAHAHAHARPATRRRFLRHAGALALAGAVPVALAA
FT                   PARTSAATGLGGARELALHHTHTGERIALAYAVDDRYVPEALGALNHFLRDHYSGQVGT
FT                   IAPPLFDQLHRLHQVLGAAQPFQVISGYRCPETNNTLRLTRGGGGVAKRSLHMDGRAID
FT                   VRLPGVPLADLRDAALSLGAGGVGYYPGQQFVHLDNGPVRRW"
FT   sig_peptide     10501..10635
FT                   /locus_tag="Lcho_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.834 at
FT                   residue 45"
FT   gene            complement(11180..11866)
FT                   /locus_tag="Lcho_0010"
FT   CDS_pept        complement(11180..11866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32286"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y556"
FT                   /protein_id="ACB32286.1"
FT                   /translation="MARAALSSAVLLLAACAGGPPPPAWQGNARQALDRAVEAHLSGDS
FT                   RAEAQDFARARSEIARTGNPALMARAELIRCAAQVAGLMFGPCEGFERLRADADPAGRA
FT                   YADHLAAMPLSADDIAHLPSAQRDAAAAVASARRGGRSAPGPSAASLQKIDDPLARLIA
FT                   VAVLFQAGQASPAVIAVAADTASAQGWRRPLLAWLNVQAQRAENAGDSAEAQRLRRRIE
FT                   LVRNDR"
FT   sig_peptide     complement(11786..11866)
FT                   /locus_tag="Lcho_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.730 at
FT                   residue 27"
FT   gene            complement(11932..12906)
FT                   /locus_tag="Lcho_0011"
FT   CDS_pept        complement(11932..12906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0011"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: aav:Aave_1818 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32287"
FT                   /db_xref="GOA:B1Y557"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y557"
FT                   /protein_id="ACB32287.1"
FT                   /translation="MPDDRSPDLPAPPPAPEPALAFKATLLLALFVALVAGTALYLMYA
FT                   RGTFEPTQRVVLVADDSEGVRVGMDLTFSGFPIGRVRRIELAADGSARVVIDVPRKDAH
FT                   WLRETSVFTLVRSLVGGASLKAYSGVLTDPPLADGAERRVLVGDATAELPRLVSDARAL
FT                   IQNLTQLTAADGALAGSLTQVQTFAERLAGPRGAVGALLGNEADARQVSAALGRVNTLL
FT                   ARLDGIAVKADAQVLGPDGVVHESRAAIGQLNALLGDTRATLQKVDALLVEAQAIAGNA
FT                   REATTDLGALRSEVDATLRKVEQLVDELNRKWPFARDTELKLR"
FT   gene            complement(12912..13661)
FT                   /locus_tag="Lcho_0012"
FT   CDS_pept        complement(12912..13661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0012"
FT                   /product="ABC-type transport system ipermease component"
FT                   /note="KEGG: pol:Bpro_2659 ABC-type transport system
FT                   ipermease component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32288"
FT                   /db_xref="GOA:B1Y558"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y558"
FT                   /protein_id="ACB32288.1"
FT                   /translation="MQWLIGWWRTVHLGALLVVLALTPSSYGAHNRREMARHIALGTGP
FT                   ALLGFTVLTTLISLVVIRIVLVTALSYGLSQYALEMVVRVLVLELIPLAAALFAALRCT
FT                   IPNAAEIAALRARDGWDAWSPQGLQRLRSEVLPRMAASVFCALLMAAVSCVVTLVVAYL
FT                   LVYGFTSAGFGAYTHTVGRVFSPAVALIFGLKIVFFGLTVALMPIASALDAAPRRLGRA
FT                   SAELQGLVRMFLVILLIEAASLVGNYY"
FT   sig_peptide     complement(13575..13661)
FT                   /locus_tag="Lcho_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.690 at
FT                   residue 29"
FT   gene            complement(13710..14801)
FT                   /locus_tag="Lcho_0013"
FT   CDS_pept        complement(13710..14801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0013"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   rfr:Rfer_2147 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32289"
FT                   /db_xref="GOA:B1Y559"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y559"
FT                   /protein_id="ACB32289.1"
FT                   /translation="MKPSERSSMPERTTPRWLHRTVVAGLLGALLLVGFVVMRPFLVSI
FT                   AWAAILVYVSWPLHVRTLALLRGHRAWAALAMSGVLTLTLGVTLLWLGLLLRGELILAF
FT                   REVTALLQTGPHLPEPIARIPLLGPWLQERLAEFGGDRAALKLQLTELAEQWAGRTLRI
FT                   LGDVGVNALLFGVALVTSFFLFRDGDRLLEQLRRILQGLLGERVDGYFNAVGDTTRAVV
FT                   YGLLLAATAQGLMAGLGYWVAGVKAPVFWGAATAVIALIPFGAPLVWGSIGLWLLLQGQ
FT                   LGAGIGLLLWGGLAVSWIDNLVRPMVISGVADIPFLLVLFGVMGGLAAFGLIGLFVGPV
FT                   VLAVLLALWREWAAVIEPAAAGR"
FT   sig_peptide     complement(14655..14801)
FT                   /locus_tag="Lcho_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.972 at
FT                   residue 49"
FT   gene            complement(14798..15178)
FT                   /locus_tag="Lcho_0014"
FT   CDS_pept        complement(14798..15178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0014"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="KEGG: ajs:Ajs_0603 MazG nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32290"
FT                   /db_xref="GOA:B1Y560"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y560"
FT                   /protein_id="ACB32290.1"
FT                   /translation="MSAPLDVAGLQARLRVFSDERGWEPYQTPKNLAMAMVVEAGELVE
FT                   IFQWMSPEASTRVAGQPAVQQHLSEEIADVLVYLLQIADRCGVDVAQAVERKLRLNAAK
FT                   YPVGQASASLAAARQLGTDEPS"
FT   gene            complement(15175..16038)
FT                   /locus_tag="Lcho_0015"
FT   CDS_pept        complement(15175..16038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0015"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: cvi:CV_0045
FT                   probable oxidoreductase iron/ascorbate family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32291"
FT                   /db_xref="GOA:B1Y561"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y561"
FT                   /protein_id="ACB32291.1"
FT                   /translation="MTLSVFPLIDPAAADAPQRFCASLRDTGFAVLVNPPIEAALIQGI
FT                   YAEWLAFFDSEAKHAYALDPQRQDGYVSAQVSETAKGHTHKDLKEFFHHYPWGRYPREV
FT                   SDAARRYAVQAEALAAQLLGWVEAHSPPEVRARYSEPLPQMIAGSEQTLLRILRYPPLR
FT                   GDEPAGALRSAPHEDINLLTLLPAASEPGLQVRGRDGRWLDVPCARDSTQNLLVINIGD
FT                   MLQEASGGHYPSTTHRVVNPQGEGARVSRISLPLFLHPRPQVRLSARHTAGSYLLERLR
FT                   ELGLKA"
FT   gene            16419..19187
FT                   /locus_tag="Lcho_0016"
FT   CDS_pept        16419..19187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0016"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: ajs:Ajs_0773
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32292"
FT                   /db_xref="GOA:B1Y562"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016925"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y562"
FT                   /protein_id="ACB32292.1"
FT                   /translation="MLGGAHAASRLPASTALYYGAEPPFDELAAFDWVVLEPGHGHDLA
FT                   QAGARMPRTQLLAYLSVGEVLPQAPHYAALPPAWRIGHNASWRSEVLDQRPADWPAWFV
FT                   EQVARPQWQRGYRGFFLDTLDSYQLVAATAEERALQQAGLVRVIRALRAAFPSARLIVN
FT                   RGFELLPQVATQVDMVAAESLYRRWNPVDARYEDVSADDRAWLLAQFEQVREQHGLPLL
FT                   AIDYVAPGDRARARELAARIAAHGLQPFVVNGALDQLGLGAIEVLPRRVLMLHDAPMQR
FT                   ASDITYSVIHQYVDMPVFHLGLIPQHLQVDRDALPDYPLAGRIAGIVTHFDSDRARPAL
FT                   AAFLKRAIAEGIKVVSLGQPGVGSGPALAETFGLQTRPGAPLPLAPVRVSQQGREIGFE
FT                   LAPLPTVAGFRPLAAPPGAQPLLTLRDARGATMDAIAFTPWGGYALWGQALARLPSRPD
FT                   EVRWVVDPIAFLRQALALPPMPVPDLATETGRRLLLAHVDGDGFANFSDQPGSPMASAV
FT                   LLREVFERYRVPTTMSVIEGETAPHGLYPQHAAELEAIARRIFALPHVEIGSHSYSHPF
FT                   NWERAAAARDDGRYRLQLPDYVFDTEREVAGSIRYIEERLAPAGKKVRLYQWSGNTNPG
FT                   EAALAAVERAGIGSINGGETLITRAQPSLTKVAPPGVRKGAHFQVYAPNQNENVYTNHY
FT                   TAPLYGYERVIETFELTGQPYRLKPINLYFHTYAASRQASLEALHKAWRWALAQPVHPV
FT                   FTSAYVARVRNFEQVVIARGADGFLVRGAQALRQLRAPASLGVPQIAGSRALAGYTEPD
FT                   AVEGTDGLAGAGERYLHLAADEAWLRFDRQGDGAPRLVDANGRVEAHEHAGGRTRLRLA
FT                   AQVPLQFSLRHGPRCTVAADPQPVTVSADPSGLSRYAMDPHGSATITIACP"
FT   gene            19153..22902
FT                   /locus_tag="Lcho_0017"
FT   CDS_pept        19153..22902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0017"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ajs:Ajs_0772 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32293"
FT                   /db_xref="GOA:B1Y563"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y563"
FT                   /protein_id="ACB32293.1"
FT                   /translation="MDQRRSRLRAPDASLRERIISTGGLFSVAAMVALVLVLLFPRDTL
FT                   IARLHTEARNDPLSAHYLTILLRSESDNADLRLLLAERHHALGQLERADAVLTPLLAEL
FT                   PDPARQRRARQLHLEVRQRQLAALAPASAPARHLRDELLHELKTLPQADWTPEQLLDFA
FT                   RLASELGEAELARQFHARGGPALAVGADSFEDAVRKALGAGDYLGAAGLHREAMQVAAS
FT                   PDERRQHLMAALRILQSGNRLEDALQLAREHDGVVGSDDRLLRYLIELSLAANRPAVGG
FT                   PYARRLMRMSRHEVREPGWAERLAGALLPSAHAAEPAAAADPAAGDPQRPFDEATYLLA
FT                   YQTFLATGNQADAFRVARAAVRRAPELRAWRERLAQVAEWHGRPADALVQWRWLAAQSP
FT                   EPAQAAHAMAQVLRLAPALNDHATLLDAWQQIARQRPLSQAETLALAALHEQLGQPQDA
FT                   LALLRERDAADPQTVWLEARVALLERLGDVPATLDALAQLVARDGVTRERALRLATLHA
FT                   DRGDVRQAYEAIAPLADRVPEDDDEVWRQLAELSWALQLEPEALRALQVRARRDDFSAD
FT                   EADHLIALLRERRPDEAAQLAEATWRRRQSPDHLMLAIELWWAQRDLVQLQRLFASVTP
FT                   DEQARVGRESAFLYLRSLWQSARGEHAAARLDMRRALVAEPQDVALRSTLIFMLIEAGE
FT                   RDELARLVDETVSVGAADARLDAALAAAWGALGQPRRALPFWRRQAAERRGDALWMFGY
FT                   ADALLAADWPQVTEAVQRQALDAIRRRPAARSADAAPADAESRAVMLQVARLTLARAPG
FT                   DPSLAVLRRLLQQQGGPAADPAFDAAADELALSWLLSGEQFEPARVWLWQRYARLLSAP
FT                   PWAALMLALHERDLDAVQRLYTRHLATLPASTRIEALSALGRRAEAHDLRVAELGRRDD
FT                   DALHEALVNEAWARPRALEWGWTRHRSGVQTDVAALLLRAPVDAATQAELQFERIGLRS
FT                   TDARALTGVPAQAEALLLTLRHAIDPASEATLTLGRHGAWADTPRLALAARTRLDGGVQ
FT                   LQAAIDWNQPTEESSALAVAGVRHRLLLAVDLPIAPTTQAHVELQALAFGLQDGPRLGG
FT                   GVGLEWTLTQWLRLAQPDLAVRVFGSHRRHHAADTVLPAATARLDPSGSVPGAGFFMPA
FT                   GYALYGVGLSSGVALREAASRAWRPFADLRLTRHDQLGVGHGASLGLAGSLLGGDQLAL
FT                   SVSLLRDGAGGSGREAGLRYALRF"
FT   gene            22955..23473
FT                   /locus_tag="Lcho_0018"
FT   CDS_pept        22955..23473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0018"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RSc2274 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32294"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y564"
FT                   /protein_id="ACB32294.1"
FT                   /translation="MFKSLILCLLTLVLTGCAVVSKGPPGVPFEKGARWALLPLANHTE
FT                   TPQAGLRAEAILEPLLRRHGVTQLIHAPRAEGDALFEAGDRKSLADARRWAGEQGARYA
FT                   ITGAVDEWRYKVGVDGEPAVGLALQVIDLRSGAVVWSAVGGRSGWSREALSAVAQKLLG
FT                   ELLDGLVVP"
FT   sig_peptide     22955..23020
FT                   /locus_tag="Lcho_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.560 at
FT                   residue 22"
FT   gene            23470..24855
FT                   /locus_tag="Lcho_0019"
FT   CDS_pept        23470..24855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0019"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: bxe:Bxe_A2972 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32295"
FT                   /db_xref="GOA:B1Y565"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031583"
FT                   /db_xref="InterPro:IPR038367"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y565"
FT                   /protein_id="ACB32295.1"
FT                   /translation="MTVASLRTLWQRAVPVMREALLARNAEGERPFWMLGEVPVLTLVV
FT                   LVGGLLVSPQDPLFTHASVPWSWVAPVLLALRYGVLSGLASMALLLAAWALLMPAAEPL
FT                   PAQVFIGGLLLTMVCGEFSGSWRGRVDRLAEANSYLEDRIERVTGRLFTVQRSHDLLQQ
FT                   ELLQRPTTLRHSLDGLERRALVAEQSVATAAQAFLDHLAASCQLEDAQVIAYDEQAGRP
FT                   GAVLAQLGEATAVEFDDPLVQYALSREGLAHVQVGLPDGPLSTRYLVVAPLRIGRQQLP
FT                   ALLVVARMPFLALHDETLQMIAVLCSAFSSAAQVSEAVAAVLAQVGHCPLRLAEELGRL
FT                   DRIAREHAIVSQLVLLRFDDPARSEEQVNMAQRRARAPDVNWAFADEAGRHRLLTLMPL
FT                   ASAAAVEGYLARFTEMVVGRYRAEVAAPSLAGLNIGVRVLTLGGERPLGEALRLLIADE
FT                   ETT"
FT   gene            24852..25925
FT                   /locus_tag="Lcho_0020"
FT   CDS_pept        24852..25925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abo:ABO_0894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32296"
FT                   /db_xref="GOA:B1Y566"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y566"
FT                   /protein_id="ACB32296.1"
FT                   /translation="MTIAQFGSALFLESGAAVLALRQDQSLSAYYAGLGVHAVVSTLFM
FT                   LLLYLLLPTRLRHPRATVLLLCFALTFFIPFFGLLALWIAVLVTRWLPQRIVRLPFRLA
FT                   DAPDLPQSARAEGRRFRELSVRPVLADARLAPALRTPALNVLSTMPLRVVGDLLHQLLA
FT                   DPVEEMRLVAYGLLDNREKELRHRITEQTAALQRIDAHIQALAEATPKARARIKSDAHT
FT                   SPALHALHLRAMVELNFELVYQRLVQGDLRDFALQQALIYADKAIALAGPEAGLLQLRA
FT                   RVYIEADYLARARVDLEQAQAHGAPPVRVLPYLAEIAYRKGDWAAVRELLEPLQCLPVS
FT                   PRLAALRRYWCGPGETT"
FT   gene            25922..27445
FT                   /locus_tag="Lcho_0021"
FT   CDS_pept        25922..27445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0021"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   reh:H16_B2199 lipopolysaccharide N-acetylglucosaminyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32297"
FT                   /db_xref="GOA:B1Y567"
FT                   /db_xref="InterPro:IPR022622"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y567"
FT                   /protein_id="ACB32297.1"
FT                   /translation="MKPPVTRTATEVDIAFLLEGTFPYVSGGVSSWINTLLKGFPDLRF
FT                   AIYFLGSRAVDYGEMRYELPANVVHFETHYLFDGEDAPPLRPVRTDPAAFEKVRCLHQH
FT                   WRAPRTADEGADPHGLFGEVVDHLGDALGEAHFLRGDQSWDYIREQYGAHCSDPSFVDY
FT                   FWTVRMMHAPMWKLHRIAASMPRVRAFHSVSTGYAGLLGAMCKRRWGRPLILSEHGIYT
FT                   KERKIDLLAAGWIADNRSVLQRDPTQLSYFRDMWIRFFEGIGRACYDASDQIIALYETN
FT                   RLRQVLDGARPERTRCIANGISIPTFGPLRAERPATPPPVLCLIGRVVPIKDIKTFIRA
FT                   MRTVVNRLPEAQGWIAGPTDEDPDYAEECRLLVNSLGLEKQVLFLGFQRLTKLLPQVGL
FT                   VVLSSVSEALPLVLLEGFAAGVPAVSTDVGSCRQLIDGLPGEDASFGRAGRIVGIADPR
FT                   ALADAAVELLADPAMWQSAADAGVARVNRYYALDTMLDHYDDVYKKALE"
FT   gene            27524..28894
FT                   /locus_tag="Lcho_0022"
FT   CDS_pept        27524..28894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0022"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rme:Rmet_4161 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32298"
FT                   /db_xref="GOA:B1Y568"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y568"
FT                   /protein_id="ACB32298.1"
FT                   /translation="MAGIGFELRRLLKRDSYAGLFQAYTYAGIISSGPWVLSIMAILFI
FT                   GVLSGLVVSPAGQISEFQVAVTWLVMLSLILTGPIQLSFTRWIADRLFEHKDALIAPNF
FT                   VGVLLVVVLASGVLGQALVPPLFPDQSNLFRATFSCALVVLSCIWVATIFLSGLKQYKT
FT                   IVAMFALGYGLTVVAALALRHYGLEGLLMGFLIGQCVLLGGMLVLILRTLPSLRLIAFD
FT                   FLRPGAMYVELVWVGLFFNLGVWADKLVFWFSPEVSESIIGPLRASVIYDLPSFLAYLS
FT                   IIPGMAVFLVRIETDFVEYYDRFYNAVREGGSLDHIQHMRNQMVFTIRQGLYEILKIQG
FT                   ITVLLVIVAGPALLRLIGISPLYLPLLYLHVVAAGLQVVLLGVLNVFFYLDQRRVVLGL
FT                   TAMLVVLNVGLTALSVQLGVLYFGYGVALAMMFTVLAAMLVLETKLRTLEFETFMMQ"
FT   gene            28902..29813
FT                   /locus_tag="Lcho_0023"
FT   CDS_pept        28902..29813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0023"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   KEGG: rso:RS01781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32299"
FT                   /db_xref="GOA:B1Y569"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y569"
FT                   /protein_id="ACB32299.1"
FT                   /translation="MAHPLTTPFSRAAPPWPRTAFIGIGRVAVVLAPALKRLGVPIVAL
FT                   ASRQATAAQHLAGQLHDAAVLSAQEAVDRAELVWLTVPDDAIAPTTAALRWRPGQTVVH
FT                   CSGATELTALQAAADAGAVVAGFHPLQIFSDPELAAQRLAGSSVAIEAGGPAEALLQRI
FT                   AAGLGLAVLRLPPGSRALYHAGAAYAASYLLALLDEAAAVWRTLGIDEAAALRALLPLA
FT                   HLTLDAAGQRGLAQAQAGPIARGDAGVVRRQIDALAGIGAPHAALYREMGRRQLELARR
FT                   AGRLDAAALARLAAALGVQDEA"
FT   gene            complement(29798..30430)
FT                   /locus_tag="Lcho_0024"
FT   CDS_pept        complement(29798..30430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0024"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mpt:Mpe_A0049 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, epsilon subunit; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32300"
FT                   /db_xref="GOA:B1Y570"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y570"
FT                   /protein_id="ACB32300.1"
FT                   /translation="METIAVIDFETTGMTPSQGARATEIGAVLVRGGEIVGQYQSLMYS
FT                   GVHIPPFIEQLTGISNAMLRDAPPAEQVMREVAAFTRGCPMVAHNAAFDRGFWLAERER
FT                   AGCEPDLAQEFACTVLLSRRLNTEAPNHKLGTLASWFGLPNNGRAHRALADALTTAHLL
FT                   VRLQDLVAQRYADQLQGRPVRHELLAALQRAPKTQLDRCVARAQASS"
FT   gene            complement(30457..31902)
FT                   /locus_tag="Lcho_0025"
FT   CDS_pept        complement(30457..31902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0025"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: rxy:Rxyl_0136 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32301"
FT                   /db_xref="GOA:B1Y571"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y571"
FT                   /protein_id="ACB32301.1"
FT                   /translation="MPHGTTAPKTPLRLQIYRQLRAAIEQGSFAAGARLPPTREHALAL
FT                   GVARNTVLWAMERLRAEGYVITRVGDGSYVAGDLAALGRPVSRGSQGSAMAPALSRRGQ
FT                   LIADTALRWQPPLQPAQAFRIGAPEIATFPFALWDRLARQASPRQRLAQAQYLDPAGLP
FT                   ALREAIAQWLWVSRGIRCEAAQVLVCAGSQQALDLIGRLLLDPADEVLVEDPGYPGIRA
FT                   SLLGHGATVRPVPLDGEGIDIAHAAARWPAARLAVVTPTHQFPTGVRMSLKRRLLLLDW
FT                   ARAHDAWIVEDDYDGEFQYGAHRIPALCSLPQAGRVLYVGTFSKTLHPGLRLGFIVLPH
FT                   ALAPTFASARALTDRHAPGDAQDVLARFILEGHLLRHLQRMRALYPQRQRVLIEALAQA
FT                   SGGALQLRPSEQGMHLLHELPPGQADAPLAARAGAAGVYLAPLSRYTVESPRRGWLFGY
FT                   AAYDTDALQTAAAIVGALLMPRR"
FT   gene            31970..32434
FT                   /locus_tag="Lcho_0026"
FT   CDS_pept        31970..32434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0026"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rfr:Rfer_3388
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32302"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y572"
FT                   /protein_id="ACB32302.1"
FT                   /translation="MPEFTASVQWQRHAQTFTDNRYSRRHEWHFDGGAVVAGSSSPHSV
FT                   PLPYSDPGAVDPEEALVAAVSSCHMLWFLSLAAKAGWLVDDYRDDAVAVMARNAAGRSA
FT                   ITLITLRPAVRFGGERQPDADTQRRLHHAAHDECTLAHSVTAEVRCEPLF"
FT   gene            32460..33089
FT                   /locus_tag="Lcho_0027"
FT   CDS_pept        32460..33089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0027"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   rfr:Rfer_3387 negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32303"
FT                   /db_xref="GOA:B1Y573"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y573"
FT                   /protein_id="ACB32303.1"
FT                   /translation="MYLPAQFEERRPEVLHALLRAHPLATWVSQRDGELVVEHVPFLLD
FT                   PARGEHGTLIGHVARANPVWRQLAASVLVFQGPQAYVSPAWYPSKQVHGKVVPTWNYAV
FT                   VHAHGQPRAIEDPAALRQIVSRLTDTHEAGRAQPWQVADAPADYIDQMLAAIVGIEMPI
FT                   ERLVGKWKVSQNRSAADRAGVAAGLLADAAPQAAAMAALVQPSTDA"
FT   gene            33103..33546
FT                   /locus_tag="Lcho_0028"
FT   CDS_pept        33103..33546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0028"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bmu:Bmul_4135 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32304"
FT                   /db_xref="GOA:B1Y574"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y574"
FT                   /protein_id="ACB32304.1"
FT                   /translation="MITIDSFTDADQPAWQELARAYKAFYLTGQTDSEYQATWQRLRAG
FT                   EQVHGWAARLDGRLVGIVHCLFHASAWTDDVCYLQDLFVAEAARGQGVAAALIERVAQA
FT                   ARERGAPRLYWLTQDHNARARALYDRVAQNRGFIRYDYVLGPT"
FT   gene            complement(33574..33855)
FT                   /locus_tag="Lcho_0029"
FT   CDS_pept        complement(33574..33855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0029"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   mpt:Mpe_A1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32305"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y575"
FT                   /protein_id="ACB32305.1"
FT                   /translation="MKAIWKDVVVAESDDTVLVEGNHYFPADSLKREYLLASNLRTTCS
FT                   WKGQASYYTLFVNGDANPDAVWYYPEPKEAAAQIAGRVAFWKGVRVVD"
FT   gene            complement(33897..35243)
FT                   /locus_tag="Lcho_0030"
FT   CDS_pept        complement(33897..35243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0030"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   mpt:Mpe_A1379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32306"
FT                   /db_xref="GOA:B1Y576"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y576"
FT                   /protein_id="ACB32306.1"
FT                   /translation="MTPQIPPDPLAPTPAPASESPAARQALLRQIRAVRAHTLQRVATL
FT                   SAEDMALQSMADASPTKWHLAHTTWFFEALVLCPHQPGYQPVDARYFKLFNSYYESLGP
FT                   RHPRPQRGLLSRPSLDEVRAYRNAVDQALARFIEQADDDSWAAAAPLLLLGLHHEQQHQ
FT                   ELLLTDIAHALSLNPLRPACLADEPAAGAGLHGGGGAEWIELPHGEIGIGHAGTGFSFD
FT                   NETPAHRVQLQACAVARALVSNRDYAAFIADGGYRRPELWLSDGWAAVQSLGWQAPLYW
FT                   ALDERGAPSHQFTLYGERPWRADEPVCHLSFYEAAAYAEWAGARLPTEFEWEAAARLAG
FT                   GAHAGAEPGDGPIDPQPRAASLDAAGRRDPQFFGAVWQWTRSSYDPYPRFRPMAGAVGE
FT                   YNGKFMVGQLVLRGSSCATPRGHARPSYRNFFPPTARWQFSGLRLARDL"
FT   gene            complement(35295..36716)
FT                   /locus_tag="Lcho_0031"
FT   CDS_pept        complement(35295..36716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1056 periplasmic protein/biopolymer
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32307"
FT                   /db_xref="GOA:B1Y577"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y577"
FT                   /protein_id="ACB32307.1"
FT                   /translation="MRSCPTPSIPSSNPSSFNARGGTRPAAGRRLGTGLAAIALAVALL
FT                   SACGGGDDTTDGATSSALAVTDTSQGMSVTLHTRTDGDSAAGSGTASAAPARAPSKSSS
FT                   DDTKDDAEQDDDDNDDAATERKWTATQYALDASVTSGPHAGQALGGALLLKGELKSDGT
FT                   TRLKGRFVPTASDSGVAPIVTTLRNSSALQALRQQYRSRIEALVAELRSQIGHDAGGLA
FT                   TPGGQQALSAFRSGHDEATEQLQSATDDLLIASQHGGREAREHRGGAVRVRGTLAADGS
FT                   VTLTLTWRGHAVTLQGTQAADGSLSGNFTDSATGDAGTWNAALENGATPSPAPAPIPPA
FT                   PEPAPSPAPAPAPAPAPTPAPAPAPTPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAPAP
FT                   APATGDIAAGQLKYSVTCAGCHTATVSNNAMNVTKAATLSGIQSAMNKGAHGGFASSLL
FT                   AQDLLNLSAYINSAK"
FT   gene            36993..37784
FT                   /locus_tag="Lcho_0032"
FT   CDS_pept        36993..37784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0032"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; Septum formation inhibitor
FT                   MinC domain protein; KEGG: mpt:Mpe_A3345 putative septum
FT                   site-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32308"
FT                   /db_xref="GOA:B1Y578"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y578"
FT                   /protein_id="ACB32308.1"
FT                   /translation="MAVVTRKSTPSSLELKSAVLTLTALVIKSADLSELARELEAQAKE
FT                   MPGLFDHDPVVIDLGAVRDASIELDVVALIALLRRHSLLPLAVRGGSTRQMAAAREAGL
FT                   AEAPDETHAAPQRPTAALPAQSPSDGEDVDLDDELRRARQLFATQPPPGGTLVIDRPLR
FT                   SGQQVYARGSDLVVLAMVSHGAEVIADGSIHVYAPLRGRAVAGAKGQADARIYSTCMEA
FT                   QLISIAGTYRTTEVPLPANVLGKPAQVRLEGDRLVVEPIKP"
FT   gene            37836..38654
FT                   /locus_tag="Lcho_0033"
FT   CDS_pept        37836..38654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0033"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: ajs:Ajs_0066
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32309"
FT                   /db_xref="GOA:B1Y579"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y579"
FT                   /protein_id="ACB32309.1"
FT                   /translation="MARIIVVTSGKGGVGKTTTSASFSTGLALAGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIHREANLNQALIKDKQCENLCVLAASQTRDKEALTQDGVER
FT                   VFNELIEMGFEYIVCDSPAGIETGAMMAMHYADEALVVTNPEVSSVRDSDRILGMLASK
FT                   TQRAIDGKEPVKEHLLITRYNPSRVQGGQMLSIEDIQDILRIPLIGVIPESEAVLDASN
FT                   QGLPAIHLKGSDVSEAYKDVVARFLGKDDLPMRFTEAVKPGFFKRVFGGR"
FT   gene            38659..38922
FT                   /locus_tag="Lcho_0034"
FT   CDS_pept        38659..38922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0034"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: mpt:Mpe_A3343 putative cell division
FT                   topological specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32310"
FT                   /db_xref="GOA:B1Y580"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y580"
FT                   /protein_id="ACB32310.1"
FT                   /translation="MSLLSFLIGEKKSTASVAKERLQIILAHERSGRNASRPDYLPALQ
FT                   RELLAVISKYVSIEPGDIKVHLERQDNLEVLEVKIELPDVQR"
FT   gene            39093..39410
FT                   /locus_tag="Lcho_0035"
FT   CDS_pept        39093..39410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32311"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y581"
FT                   /protein_id="ACB32311.1"
FT                   /translation="MIDFPLVLLSCLFMALLTAAFGSLFPAAHRPWWHPLRRAEPATRA
FT                   SAVATEIDPHLAETQPVTLPLQVVESVDRRGQPLPFVGKDRRKAARAAARHEHRRHGNG
FT                   R"
FT   sig_peptide     39093..39179
FT                   /locus_tag="Lcho_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.603 at
FT                   residue 29"
FT   gene            39642..40580
FT                   /locus_tag="Lcho_0036"
FT   CDS_pept        39642..40580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0036"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   pol:Bpro_2353 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32312"
FT                   /db_xref="GOA:B1Y582"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y582"
FT                   /protein_id="ACB32312.1"
FT                   /translation="MHTQPAPPADAVIVREVGLRDGLQSIHRTLATDHKLDWLRAAHAA
FT                   GLREIEVGSFVPAKLLPQLADTAELVAVARTLPGLVTSVLVPNLKGAQAALDSGADLML
FT                   LPLSASHAHSLANLRKTPDDAVAEVGRIRALRDASGSRCLIEVGMSTAFGCTIQGRVDE
FT                   AEVLRLLQAALDAGADRVGLADTVGYADPQQVARLFEKSFAVAGDRLACGHFHDTRGLG
FT                   MANVYAAWLAGVRRFDACLGGIGGCPHAPGASGNVATEDLAYLFASMGAPTGLDFDALI
FT                   ALRARLAQWLAGETLHGSLWRAGLPKTMLSA"
FT   gene            40584..41813
FT                   /locus_tag="Lcho_0037"
FT   CDS_pept        40584..41813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0037"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_2352 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32313"
FT                   /db_xref="GOA:B1Y583"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y583"
FT                   /protein_id="ACB32313.1"
FT                   /translation="MNTPSAESVMPTATSAPQPLAGLRVVEFTHMVMGPTCGMVLADMG
FT                   AEVIKIEPIDGDRTRRLLGAGSGFFPMFNRNKLSIAIDLHHADGAEVARRLAASADVVA
FT                   ENFKPGTMVKYGLDYASLAAVNPRLIYASHKGFLPGPYDHRTALDEVVQMMGGLAYMTG
FT                   RPGDPLRAGTSVNDIMGGLFGAIGVLGALIQRGISGRGMEVQSALYENNVFLMGQHMLQ
FT                   FAMTGKPAAPMPARESPWAIYDVFTVKDGEQIFLAAVSDAQWFTFCDALGFADLKADPA
FT                   LATNNQRVRERPRLLPALRERLALRSAAELSDTMEAAGLPFAPIRKPEDLLDDPHLLAT
FT                   GGLADITLPDGAKAGQSVKTTLFPITMDGARLGVRLQPPRLGEHTRGLLESIGYDPAQI
FT                   DTLQANAVVV"
FT   gene            41903..42886
FT                   /locus_tag="Lcho_0038"
FT   CDS_pept        41903..42886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pol:Bpro_2351 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32314"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y584"
FT                   /protein_id="ACB32314.1"
FT                   /translation="MKNIQTRRQTLRQLGALTLAGAAGSAWAQAAGDKTVRIVLPNAVS
FT                   SGVDTITRTAQNALSKALGHPVVVENQPGAGGVLGVQTVVRAAPDGLTLGVVSNNVVIF
FT                   PSVLKSLPFDLHTDVTPIAICGYTPVVLVVNPKVPATNAKEFTAFLKSKNGEANFASGG
FT                   NGTILHLAAEMFLDEAGVKARHIPYKGVGPMLTDLIGGQVEFATAALPSVQQHLKSGAL
FT                   RAIGIATSQRVPAAPDLPTFVEQGLPGYVVEAWFGVIGPKGLPAADVKRINAAVVTAFA
FT                   DPGVMEAMAKQGNVINVSTPERAQTFFKDEMLKYAKLVKKAGIEAQ"
FT   sig_peptide     41903..41989
FT                   /locus_tag="Lcho_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 29"
FT   gene            42900..44074
FT                   /pseudo
FT                   /locus_tag="Lcho_0039"
FT   gene            complement(44116..45387)
FT                   /locus_tag="Lcho_0040"
FT   CDS_pept        complement(44116..45387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0040"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: pna:Pnap_0797 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32315"
FT                   /db_xref="GOA:B1Y585"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y585"
FT                   /protein_id="ACB32315.1"
FT                   /translation="MSHPKQPGLYQAFDDVHLIDGLRTPQVDHLGAFADANPIDLGIHA
FT                   ARAVIERSGVDATAIDSVLGGNMAPGGFDQFYLPRHIGLYAGVPVEVPALMAQRICGTG
FT                   FELFRQAGEQIDAGIASLALVVGTESMTRHPIAMFDHRGGFKLGQTPALKDYLWESLTD
FT                   PVAAVSMIQTAENLAQKYGITRAEVDAFAARSFARAVAAQEAGWFDGEIAPVESSVFEL
FT                   PGYQPRALRLSGKNKRADRDTHPRPTPADVLALLRPVFKDGVQTAGNCSALTDAAAAAL
FT                   VASGVVVRDWQARTGRAPLARIAATAVVGVPPEIMGIGPAPAIRRLLDGAGLTLDDIAR
FT                   FEVNEAQGAQTLAVARELGLAEDRLNVHGGAIALGHPLAATGVRLTITVARQLQAIGAR
FT                   WGVASACIGGGQGIALLVENTAVG"
FT   gene            complement(45695..46909)
FT                   /locus_tag="Lcho_0041"
FT   CDS_pept        complement(45695..46909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0041"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: pna:Pnap_3557
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32316"
FT                   /db_xref="GOA:B1Y586"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y586"
FT                   /protein_id="ACB32316.1"
FT                   /translation="MNPRKILVAQGGGPTAVINQSLAGVVLEARRHRGVELVYGARHGV
FT                   RGIVNEDLVDLTQETSHNLEMVAATPASALGSTRDKPDIKYCQEIFKVLQAHEIGQFYY
FT                   IGGNDSSDTVRIVSEQAQAANYALRCIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAG
FT                   ANLDNAALPGVYVGVVMGRHAGFLTAASALGKKFADDGPHLIYVPERVFEVEKFLADVK
FT                   ATYERFGRCVIAVSEGIHDAAGTPIISTLAKELEHDAHGNVQLSGTGALADLLCEEIKQ
FT                   RLGIKRVRGDTFGYLQRSFIGCVSDVDQREAREVGEKAVQFAMWGGSDGSVAIKRAGYY
FT                   AADYELLPLSAVAGKTRTMEDEFIAPNGTDVTDAFRLYLRPLLGSGMPDAYRLRPNPVA
FT                   KVLNR"
FT   gene            complement(47049..47597)
FT                   /locus_tag="Lcho_0042"
FT   CDS_pept        complement(47049..47597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0042"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: tbd:Tbd_1196
FT                   outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32317"
FT                   /db_xref="GOA:B1Y587"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y587"
FT                   /protein_id="ACB32317.1"
FT                   /translation="MPRHHRLTLCALSALTALAVLAGCSTTPTAPLPTVATVDLARYAG
FT                   GWYEISALPNRFQAMCVADTKAHYRAIGDDIEVINRCRQADGSVTRATGIAKVVADSGN
FT                   AKLRVSFFRPFYGNYWVLALDPDYRWVLVGEPKRRFGWVLSRTPQMAPADLDAALQRAV
FT                   ERGYARADFKPTPQSQPLD"
FT   sig_peptide     complement(47529..47597)
FT                   /locus_tag="Lcho_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.615 at
FT                   residue 23"
FT   gene            47734..49365
FT                   /locus_tag="Lcho_0043"
FT   CDS_pept        47734..49365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0043"
FT                   /product="transcriptional regulator domain protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: jan:Jann_3721 transcriptional regulatory
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32318"
FT                   /db_xref="GOA:B1Y588"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y588"
FT                   /protein_id="ACB32318.1"
FT                   /translation="MSHRYTTGEFEVRPDERRVLLRGEPVPLGARAFDVLMCLIAQRER
FT                   VVTKNELLEQVWPGMVVEENNLTVHVSALRKVFGAQAVATIPGRGYRFVMALDETTGAP
FT                   AVAPVPAPAPASVVGADGPTGLTLPDRPSIAVLPLDNLSGDAQQDLLIEGLSEDVITEL
FT                   SRFRSLFVIARNSSFSFRGLAHGERDVRAIARELGVRYVLEGSLRRAGDRVRVAVQLVD
FT                   AVSATQLWAEKYDRAVDDLFALQEELTRAIVGAIAPQIEAGEFQKIRSARGRDLNAYTL
FT                   AMRARDTARRADREGDATTRDEALRLAHEAVEIDPGCGVALATIAFVQWQQIWAGSAAS
FT                   PVDAAVAGLAAARRAIALDGSDHHAHLWKAMLQLFTHQHAAGLADLQRAHELNPNDALT
FT                   LSLLGQYLAAEADSAADAATGVRHVLDALRLSPRDPLRWSFLNSLAWASFAAFDHAGAV
FT                   DAASRALGEAPQFPPARLCRVIGQVGLGAIDAARADFETLRALAPQMVATRLAGDWSYA
FT                   NPALVQRATAFLRVAAGLDEPGRLDT"
FT   gene            49496..49888
FT                   /locus_tag="Lcho_0044"
FT   CDS_pept        49496..49888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32319"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y589"
FT                   /protein_id="ACB32319.1"
FT                   /translation="MTTAPSLAAALAIAAAGIFPAQAAPADEQLQDVLQQYRSAETRGQ
FT                   WVNALMPEATGLASAATSGDQHLDRIVATYTREQLDRGGWANAWVREDHYAAGEPLLAV
FT                   RVGEGVTTRVASAPLPVQQFALGLRR"
FT   sig_peptide     49496..49567
FT                   /locus_tag="Lcho_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(49890..51038)
FT                   /locus_tag="Lcho_0045"
FT   CDS_pept        complement(49890..51038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0045"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   response regulator receiver; KEGG: rpb:RPB_0891
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32320"
FT                   /db_xref="GOA:B1Y590"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y590"
FT                   /protein_id="ACB32320.1"
FT                   /translation="MNTPADAPNPAHDPAHILVVDDVEQNVRLLADLLVFQGWRVSTAM
FT                   SGEQALERIATDAPDLVLLDVMMPGLSGYDVCRRLRAEPDHALLPIVLVTALDPTAERV
FT                   KGLEAGADDFISKPINRPELMARVRSLLRIKLLHDQVQRQRAELADWNHTLERRVADGV
FT                   AQVERLSQLKRFFSPALAEAILRGGADDPLKSHRREIVVVFLDLRGFTAFTETADPEEV
FT                   MAVLREYHAAMGALILAHEGTLERFTGDGIMVFFNDPQPLPDAADHALRMALQMQAAMA
FT                   ALAAGWQRRGHALQLGIGVAMGYATIGGIGFDGRIDYGAIGKVTNLAARLCTEARGGDI
FT                   LAEPRVIAALGAGFVVEAAGEVVLKGFARPVVASRVVGWQPA"
FT   gene            complement(51035..51412)
FT                   /locus_tag="Lcho_0046"
FT   CDS_pept        complement(51035..51412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0046"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   xau:Xaut_3859 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32321"
FT                   /db_xref="GOA:B1Y591"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y591"
FT                   /protein_id="ACB32321.1"
FT                   /translation="MSTILIVEDNARNMKLVRDILQHHGHSTLEAATGAEGVQLALAQR
FT                   PDLILMDIQLPDIDGITALARIRADPALAAVPVLAVSASVMPDEQQKIVASGFDAYVTK
FT                   PLSLRPFVAMVDSFLQRGRPA"
FT   gene            complement(51409..52935)
FT                   /locus_tag="Lcho_0047"
FT   CDS_pept        complement(51409..52935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0047"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cau:Caur_0402 histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32322"
FT                   /db_xref="GOA:B1Y592"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y592"
FT                   /protein_id="ACB32322.1"
FT                   /translation="MTSPLLPGLPRAVARLPLSIRSKLSGVLLAIVGLLIAIGSVGLYE
FT                   LGEVNARTEDLVRLQRKVAAFRQIQQDTMGQLHNVANVMLAPDERTLETTLRQLSQFGY
FT                   DLDRLQFVSTDEAELYARVRHDYDAFIGEVGAVIALVRSGRLAEAREAQARRAVPLAER
FT                   LERMTNELVNRAEADMLAQVDAGAAGYARSRALVLSIAAGSVVLALLLGYALSWSLVEP
FT                   VREMDARLAEIAAGQFERRIDIPNRDELGALAADLNRMSAELGRLVREVEAANRNKSAF
FT                   LANMSHELRTPLNAIIGFSEVLIEQMFGEVNAKQLEYLRDIHASGHHLLTLINDVLDLS
FT                   KIEAGRMELQPSRFHLPELLDNSLTLVRERAANHGLRLTLDVQDGLGDWVADPRKIKQV
FT                   VVNLLSNAVKFTPAGGHVTLRARRIDAGTAEIAVIDTGVGIAPEEQAQVFEEFRQAGTD
FT                   PLRKSEGTGLGLALARRFVELHGGTLRVDSAPGRGSTFAFTLPDRTLEPT"
FT   gene            complement(52932..53558)
FT                   /locus_tag="Lcho_0048"
FT   CDS_pept        complement(52932..53558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0048"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   scl:sce2899 SCO1/SenC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32323"
FT                   /db_xref="GOA:B1Y593"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y593"
FT                   /protein_id="ACB32323.1"
FT                   /translation="MRRRALYRPLALGAWLAACGLFGPLRTLAHGSTGAPAHDDADERL
FT                   PQLGPATPFSLIDQSGQRLALAELRGKVVVLTFIFTTCTDTCPILTARLAALQAPLGAA
FT                   FGPRLRFVSISVEPEVDTPEVLHAYARTHGADLRGWSFLTGRAGAVQAAVRGYGSYARR
FT                   RGTGEIDHLTLTSLIDRRGRLRVQYLGTRFRDDEMLRDLHALLAE"
FT   sig_peptide     complement(53469..53558)
FT                   /locus_tag="Lcho_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.913 at
FT                   residue 30"
FT   gene            complement(53567..54580)
FT                   /locus_tag="Lcho_0049"
FT   CDS_pept        complement(53567..54580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0049"
FT                   /product="putative nitrate transport protein NrtA"
FT                   /note="KEGG: gdi:GDI2643 putative nitrate transport protein
FT                   NrtA"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32324"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y594"
FT                   /protein_id="ACB32324.1"
FT                   /translation="MNDAIRHSASRRELLQGAAALAAFGSLAGACNPAAAQERPETGTV
FT                   RFNHSPSICLAPQYLAGELLRNEGFDDVRYLPVGTRAAPDALADGRLDVGMWYTTGYLP
FT                   VLDADRPVVLLAGLHLGCWELFGNHKVQSLRDLRGKTVVCEKMQGGDQILLSSMLAYVG
FT                   IKPAEVNWLARPPGSAMSAFIAGMADAFLAFPPEPQELKQRQIGHVLLDTNVDKPWSQY
FT                   YCCMIGANRDFVARHPIATKRVLRAILKATELCTAQPVQVAGYMRDHGYEPRYDIGLAA
FT                   LQRINYDYRAADPADTLRFHALRLRDIGVIRSTPQRLIERGTDWRFLNELKRELKA"
FT   sig_peptide     complement(54470..54580)
FT                   /locus_tag="Lcho_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.979 at
FT                   residue 37"
FT   gene            complement(54594..55736)
FT                   /locus_tag="Lcho_0050"
FT   CDS_pept        complement(54594..55736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0050"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rha:RHA1_ro10186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32325"
FT                   /db_xref="GOA:B1Y5X8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5X8"
FT                   /protein_id="ACB32325.1"
FT                   /translation="MSTGLARFFAAVLPILFATCSTAHWPDQPPHQMARLGEFKFERGG
FT                   SIPDLRISYVTHGKLNEARDNAVLLMHGYGGNHHVYDLLIGPGRAFDTDRYFFICPDAL
FT                   GATQTGPEHSSSATSSGLRMAFPKYNIRDLVEAQHRLVTQVFGVTRLLAVAGASSGGSF
FT                   AVQYAVRHPQAMTGIVPIVGGAFAGVNSRLRRPWSLSVIESCAGWEGGNYEKNPQVCAT
FT                   NALMVQIPYFYSRDWWERNLDTPEAFERWRVGFGAFYIDVQDTRDLWYLNQSYGNGWIH
FT                   DTPGFGGDVRAALASIRARALYIHVQQDEIFPPEKIAAEVALIPGARALKLDSIAGHTV
FT                   WYNADPQATVVMSNAIRAFLAELAGSRASAESPNSQPPQR"
FT   sig_peptide     complement(55665..55736)
FT                   /locus_tag="Lcho_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(55774..56934)
FT                   /locus_tag="Lcho_0051"
FT   CDS_pept        complement(55774..56934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0051"
FT                   /product="homoserine O-acetyltransferase"
FT                   /note="KEGG: sus:Acid_4622 homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32326"
FT                   /db_xref="GOA:B1Y5X9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5X9"
FT                   /protein_id="ACB32326.1"
FT                   /translation="MGATNMHRSCLERLAGAVQALVAALLIGICAAATAHWPDQPPHQM
FT                   ARLGEFKFERGGSIPDLRISYVTHGKLNAAKDNAVLFLHGFGGNHHNLDAFIGPGRAFD
FT                   TDKYFVICPDALGATQTGYAHSSSPTSTGLKMKFPKYNQRDMVEAQHRLVTKVFGIPRL
FT                   LAVTGISSGGAYAVQYAVSHPQAMAGIIPISGGTFFGAYGRFEGQLTRSILDTCAGWQH
FT                   GNYRRNPAACATNALSVLIPRFYTPEWWDKYVDTPEAYQRWRVAFGAYYLDVQDARDLY
FT                   YLNDSFDRGWLGDTPGFNGDVAAAQASIKARALFVHPVQDAFFPQPNIANEVAAIAGAR
FT                   AASIDSLAGHTIWYNADPQATAAMTTAIRAFLAELHAPGSRVAAER"
FT   sig_peptide     complement(56827..56934)
FT                   /locus_tag="Lcho_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.933 at
FT                   residue 36"
FT   gene            57209..57577
FT                   /locus_tag="Lcho_0052"
FT   CDS_pept        57209..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0052"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: ade:Adeh_1754 globin like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32327"
FT                   /db_xref="GOA:B1Y5Y0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y0"
FT                   /protein_id="ACB32327.1"
FT                   /translation="MTQSLYERLGGEDRIQRLVTDIVDNHLRNPLIRTRFEKYNDAERA
FT                   VIERHVTEFFCMGSGGPQAYTGKDMLTTHKGMNISEQELIAAIDDIVAAMAKHGYGDTE
FT                   RNEVVAILYSLKGDVVRV"
FT   gene            57758..58564
FT                   /locus_tag="Lcho_0053"
FT   CDS_pept        57758..58564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32328"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y1"
FT                   /protein_id="ACB32328.1"
FT                   /translation="MLNKNSQQIMPVRVRTSWRRPIRTVATACTWLALAVAAQAGMDGG
FT                   GGSSRKTDTGHDGSQAARSSESARSEHSRGNWQGRPMAQWVPTFWRWFFSVPASVGATD
FT                   TTGVQCGLHQEGPVWFLSAPLGGQGPFERTCTVPRGKAIFTPVATFLNDYPCPDPTFKP
FT                   AAGQSLDDFLGSGLVDIIDSFTLLEASLNHRPIKVLRLTTRTFGFTGAVDWKGIDQCIT
FT                   GSPQSGLSDGYFVAIEPLPPGTHELRVKSFSSFFGLTEGTFKLEVR"
FT   sig_peptide     57758..57880
FT                   /locus_tag="Lcho_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 41"
FT   gene            complement(58623..59270)
FT                   /locus_tag="Lcho_0054"
FT   CDS_pept        complement(58623..59270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0054"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: rru:Rru_A3213 PAS/PAC sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32329"
FT                   /db_xref="GOA:B1Y5Y2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y2"
FT                   /protein_id="ACB32329.1"
FT                   /translation="MFGELNQRQLEYLHDIHASGHHLLQLINDILDLTKIEAGRMELEL
FT                   APCDLAQLLESAIGLIRERATRQGLRLHCEIAPGLGGWTADARKLKQAVLNLLSNAVKF
FT                   TPEGGRVTLRARRADEGDAHVAEIAVIDTGVGIAPGDQALVFEEFRQASGSYLRKSEGT
FT                   GLGLSLVRRFVELHGGTVRVDSVLGRGSSFVIRLPERPLPAALSAATATPSD"
FT   gene            complement(59309..61462)
FT                   /locus_tag="Lcho_0055"
FT   CDS_pept        complement(59309..61462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0055"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: GAF domain protein; histidine kinase HAMP
FT                   region domain protein; KEGG: bja:blr2862 two-component
FT                   hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32330"
FT                   /db_xref="GOA:B1Y5Y3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y3"
FT                   /protein_id="ACB32330.1"
FT                   /translation="MPEVPPHKPSRGRLFRQYALLINALVGTLLLASAVLSLTFSYRES
FT                   RDHLVALQFEQAQGAAARIEQYIAGIEQQIGWTALSGMNAGADPLEARRIDSLKLLRQV
FT                   PAITEVAWLDAQGREQLRVSRLALDTQDQGLDRSAEPLFTEPAAGRVWRGPVSFRKQTE
FT                   PYMTIARRAGPGRSGGVTVVEVNLKFVWDVVARIRPGHPDGGGLAYAVDQSGALIAHPD
FT                   ISLVLKQTNLRALPQVAASLAADAIDRPPGPAHVADAAGGVAVEDAQDLAGQPVLSAYA
FT                   RLEPLGWRVFVESPRSQTLAPVYASLQRLGLLLAAGLVISMMASAWLARTLVRPIRQLQ
FT                   DGAARLAAGDLDHRLTVATHDELEDLAGEFNRMAGELKGSYEGLERKVREHTAELAEAL
FT                   ARQTATAEVLQVIGRSVADAGPVFAKILESCEQLIPDTVASLLDLVDGDRIVLADFRMR
FT                   VTDNATAEVRAARDRRVRAGYPHPLRGSATEAALDAGRVVEFSDTLNGPDTPPQTREFA
FT                   LSAGYPFSLMVAPMRWEGRPIGSIGVVRYTLVPFRPKERELLQTFADQAAIAIQNARLF
FT                   TETREALEQRTATTEVLQAISRSVADPQPVFEKILDHCERLFGSDQPGIFLVDDEGQLR
FT                   VGAFRGPDRARVLASYPKPLGDTLSAVAIRAHRPVELADVLADPAAPAYLRTLAEQTGN
FT                   FAVMVAPLIHAERAIGSIVVTRR"
FT   gene            complement(61499..61963)
FT                   /locus_tag="Lcho_0056"
FT   CDS_pept        complement(61499..61963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:pRL110111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32331"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y4"
FT                   /protein_id="ACB32331.1"
FT                   /translation="MKPFATAHRLGAALVLLASLLLPFAAAAADPPERVVRIGYLALNP
FT                   PLLNVSSARLALAKLKVDVIYAVTSPAAFAAKNATRSIPIVAWAAHGAVETGLTRLAVL
FT                   DDTSDQGAAPGDLPVEQPTRFVRVINLKTARALGLTVPQGLLLRADAVIE"
FT   sig_peptide     complement(61877..61963)
FT                   /locus_tag="Lcho_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 29"
FT   gene            62156..62470
FT                   /locus_tag="Lcho_0057"
FT   CDS_pept        62156..62470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32332"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y5"
FT                   /protein_id="ACB32332.1"
FT                   /translation="MKTARRLISAAACIATAVLLAASPALSQAEVVAKVVADYTVFVDP
FT                   PTGFVFVKLPAGWKFVGKVEAAELARLPGSVVTALLTGEHDDDLPVRTAGEPPRPAPGR
FT                   "
FT   sig_peptide     62156..62239
FT                   /locus_tag="Lcho_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 28"
FT   gene            62524..62937
FT                   /locus_tag="Lcho_0058"
FT   CDS_pept        62524..62937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32333"
FT                   /db_xref="GOA:B1Y5Y6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y6"
FT                   /protein_id="ACB32333.1"
FT                   /translation="MNRSPSHIARRAALAVLLGWAGAAHAAPVGDDADWPGDVRRGWAA
FT                   LRAFDCARCHGRDHRGWSAPDLVAAVRDGSRERFMHSVREGEITRGMPGYRSQDAVVAE
FT                   LDAMYAYLRARAEGVIAAGRPPSARTPETGAPR"
FT   sig_peptide     62524..62604
FT                   /locus_tag="Lcho_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(63036..64025)
FT                   /locus_tag="Lcho_0059"
FT   CDS_pept        complement(63036..64025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0059"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rfr:Rfer_3683
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32334"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y7"
FT                   /protein_id="ACB32334.1"
FT                   /translation="MATTPPRLRLQLLSDLHLDNNPGFAAQAAPGADLLVLAGDVGSHV
FT                   PGSWLLQDGDFGLGAFSPKRPGAPWSTVIYVPGNHEYDTLPYAQTRERLRALCDALGII
FT                   WLDRASHVIDGVRFIGCTLWTDFDALASDTALQLKAAGQGGGLLTGTPHRKTVRRAARQ
FT                   ATAARNEGADSLLTWQMQERDKALRAANFYLRKNTTLAADGSLMLAAELRELGLQDQAW
FT                   LRAALAEPHDGPTVVVTHFAPSLRSADPRYGLVPGTAGFCNALDDLLPLADLWLHGHLH
FT                   CRVDYVAEGARTDGRTGQCRVIANPLGYAGKGEQAAFEPMRVIDVPGS"
FT   gene            complement(64025..65026)
FT                   /locus_tag="Lcho_0060"
FT   CDS_pept        complement(64025..65026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0060"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bmu:Bmul_2136
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32335"
FT                   /db_xref="GOA:B1Y5Y8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y8"
FT                   /protein_id="ACB32335.1"
FT                   /translation="MTSLSVLDLAPIAEGSDAATALTCALDLAQHAERWGYRRYWLAEH
FT                   HNMDGLACSATAVLVGHIAGGTHTIRVGSGGIMLPNHAPLVVAEQFGTLATLYPGRIDL
FT                   GLGRAPGTDQATARALRRHLQAGDEEGFPQDVMELQRYLAKPEPGEPGHAVRAIPGTGT
FT                   QVPIWLLGSSLYSAQLAAWLGLPFAFASHFAPDMLMQALEVYRSSYRPSAEWPKPHAMV
FT                   GMNVVAADTDEEAARLYTSIQQRFLGMVRGRRGPLPPPVASMDGLWNEAERRQVERMLA
FT                   VSVVGSPSSVTQGLRALLARTGADELIVAGAIHDHAARLRSYELAAQCAAAC"
FT   gene            complement(65087..66136)
FT                   /locus_tag="Lcho_0061"
FT   CDS_pept        complement(65087..66136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0061"
FT                   /product="Thioredoxin-related protein-like protein"
FT                   /note="KEGG: mgm:Mmc1_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32336"
FT                   /db_xref="GOA:B1Y5Y9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041737"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Y9"
FT                   /protein_id="ACB32336.1"
FT                   /translation="MKHLPIRLLCGLLCLAATLLGAPARAADAKPADAAHAVPLAIDIP
FT                   PWFTEGFLDFKEELASAGQAGKQLMVYVGQDGCPYCRELMQTNFSQKPIADKTRVHFVA
FT                   IALNLWGDRELSWTDGRTLSEKALARELKVQFTPTLLFLDARGQVRLRLNGYQPPQRFS
FT                   AVLDYLIGGHDQRETLAQFLARSPAAPARPQLTDEAFFMPAPLDLRRRTGARPLAVLFE
FT                   TRHCRACDEMHDQGFKRPEVRTQLARFDVARLALSDGAEIVTPADRRQRADAWARELGV
FT                   SFTPTLVFFDAGGAEVFRLDGYTRPFHLASAFEYVADGGYRREPEFQRYLRDKADRLRA
FT                   RGQPVELWK"
FT   sig_peptide     complement(66056..66136)
FT                   /locus_tag="Lcho_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 27"
FT   gene            complement(66202..66423)
FT                   /locus_tag="Lcho_0062"
FT   CDS_pept        complement(66202..66423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0062"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: bbr:BB1266
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32337"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z0"
FT                   /protein_id="ACB32337.1"
FT                   /translation="MNAITNPQDIETRLTDLEVKASFTEDLVEHLNQIVVRQQRQIDLL
FT                   TRELLQLQQQSGEGATVRSLRDELPPHY"
FT   gene            complement(66471..67256)
FT                   /locus_tag="Lcho_0063"
FT   CDS_pept        complement(66471..67256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0063"
FT                   /product="putative cytochrome c"
FT                   /note="KEGG: bja:bll2732 putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32338"
FT                   /db_xref="GOA:B1Y5Z1"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z1"
FT                   /protein_id="ACB32338.1"
FT                   /translation="MKPMRVTAAFALSFAWLAAATAMAQSVTDPRRSGFDDMGAQTQAM
FT                   QRDDTLNPGLLWVQDGEALWSQPVGEAAKSCASCHGERATSMRGVAARYPAFDTLLGRP
FT                   VDLAQRINLCRQRHQQAPTLAAESQPLLALESALAHASRGLPLASADDPRLAPFRDRGE
FT                   ALYRQRIGQIDLSCAQCHDQRAGLRLGGSRIPQGHVNGYPTYRLEWQGIGSLQRRLRNC
FT                   LTGVRAQVPDWGAPALVELELYLAWRSRGLPVEAPAVRP"
FT   sig_peptide     complement(67182..67256)
FT                   /locus_tag="Lcho_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(67253..67573)
FT                   /locus_tag="Lcho_0064"
FT   CDS_pept        complement(67253..67573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0064"
FT                   /product="Sulphur oxidation protein SoxZ"
FT                   /note="PFAM: Sulphur oxidation protein SoxZ; KEGG:
FT                   bja:bll2733 probable sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32339"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z2"
FT                   /protein_id="ACB32339.1"
FT                   /translation="MARTLITAPPTARRGEVIEIRTLIAHPMETGYRPGPDGTLLPRNL
FT                   IRRFSCDYNGERVFSAELHAAIAANPYIAFTTVATDSGTLSLRWEGDEGFAQTENVRIT
FT                   VT"
FT   gene            complement(67600..68076)
FT                   /locus_tag="Lcho_0065"
FT   CDS_pept        complement(67600..68076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0065"
FT                   /product="sulfur oxidation protein SoxY"
FT                   /note="KEGG: bbt:BBta_2763 sulfur oxidation protein SoxY"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32340"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR030997"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z3"
FT                   /protein_id="ACB32340.1"
FT                   /translation="MKRPPPLDPLPRRDLLALGLTLGAGAVASVFVRPARAQALDLAAA
FT                   ITTYAAGAVVREGRVRLDVATLVDNGNVVPVTVSVDSPMTAADHVTGIALFNERNPQRD
FT                   VARFELGPRAGRATVSTRIRLATSQQLVAVARMNDGSCWLQRVDVIVTLAACIE"
FT   sig_peptide     complement(67963..68076)
FT                   /locus_tag="Lcho_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.969 at
FT                   residue 38"
FT   gene            complement(68084..68527)
FT                   /locus_tag="Lcho_0066"
FT   CDS_pept        complement(68084..68527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0066"
FT                   /product="putative cytochrome c, putative SoxX protein"
FT                   /note="KEGG: bbt:BBta_2764 putative cytochrome c, putative
FT                   SoxX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32341"
FT                   /db_xref="GOA:B1Y5Z4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z4"
FT                   /protein_id="ACB32341.1"
FT                   /translation="MRQSAITLGLLAGWLGSAAANGVVAFEVVGDAIPAPLTTAPADAA
FT                   RGRAIVASRQTGLCLLCHRGPFPEVRFQGNLAPDLGGAGARWSAAQLRLRLVDGRRLDP
FT                   QSIMPAYHRVDGLVDVAAAWQGRPLLSAQQIEDVVAYLVTLKE"
FT   sig_peptide     complement(68465..68527)
FT                   /locus_tag="Lcho_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.470 at
FT                   residue 21"
FT   gene            complement(68548..70818)
FT                   /locus_tag="Lcho_0067"
FT   CDS_pept        complement(68548..70818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0067"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bja:bll2736 putative aldehyde
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32342"
FT                   /db_xref="GOA:B1Y5Z5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z5"
FT                   /protein_id="ACB32342.1"
FT                   /translation="MNTPAIFAFDQPDAMLQTPSGSHAEPVTPAGLTRRQFIGSASAGA
FT                   LVVAFHIPLAGDANAQTGAAAPEINAWVVVQSDDTVIVRIARSEMGQGTLTGLAQLVAE
FT                   ELDCNWAKVRTEYPTPGQNLARNRAWGNFSTGGSRGIRESHEYVRKGGALARTLLVQAA
FT                   ANQWQVPATECRAAASVITHTPSGRTLTYGQVAGAAARLTPPADVALKDPKQWQLAGKR
FT                   LARLDTLDKLTGKQVYGSDLQLPGLLNAAIRDCPVFGGKVKSFDAAAAMRRPGVKKVVR
FT                   VGDSAVAVVADTWWRARSALEAMPIEWDEGPHAQASSAAFSAVMRAALDAPDAVVGNSN
FT                   GDARAALATAARRIDAIYAYPHQNHATMETMNATAKITLSAAGAPARCEVWTPTQNGEA
FT                   ALAAAAEAAGLPPAQCEVYKLHLGGGFGRRGAVHDWVRQAVAIARELPGTPVKLIWSRE
FT                   EDMQHGRYHPATMCKLSAGLDAQGNLTALHMRIAGQSILAGVFPQNIKDGKDPVVFQGL
FT                   NAPGPEASIGYSVPHLLIDHAMRNPSVPPGFWRGVNLNQNAIYLECFIDEIAHATGQDP
FT                   LALRRKLMANHPKHLAVLNAAAERAGWGKPAPAGVFRGLAQTMGFGSYVAACAEVSVSD
FT                   AGKLKIHRIVAATDCGHAVNPQQIEAQVEGSFVYGLSAALYGECTLKNGRIEQSNFNSY
FT                   PVLHMDEMPQVETIVMPSGGFWGGVGEPTIAVAAPAVLNAIFAATGRRIRELPLKNQSL
FT                   KKA"
FT   gene            complement(70815..71318)
FT                   /locus_tag="Lcho_0068"
FT   CDS_pept        complement(70815..71318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0068"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: smd:Smed_6324 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32343"
FT                   /db_xref="GOA:B1Y5Z6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z6"
FT                   /protein_id="ACB32343.1"
FT                   /translation="MATLHVNGVRRDFDAEPDTPLLWVLREQLGLTGTKYGCGIAQCGA
FT                   CTVHIDGVPTRSCARPLSSVGAAQKVVTIEGLSPDGSHPVQKAWAALDVPQCGYCQCGM
FT                   IMAASALLAEKPKPSDADIDAAITNICRCGTYNRIRAAIKVAAQGGDPKGAALGIVHID
FT                   GSRA"
FT   gene            72214..74025
FT                   /locus_tag="Lcho_0069"
FT   CDS_pept        72214..74025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0069"
FT                   /product="Bilirubin oxidase"
FT                   /EC_number="1.3.3.5"
FT                   /note="PFAM: multicopper oxidase type 2; KEGG:
FT                   mgr:MGG_08046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32344"
FT                   /db_xref="GOA:B1Y5Z7"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z7"
FT                   /protein_id="ACB32344.1"
FT                   /translation="MGLMAGPAALVAATPRVRAKDIVSPSTTPFLEPLPIMPVLPERAL
FT                   TDPAFKLKPRAQPNRDINPATGLPYEGRGEAHQFRGRNPPQFFYAQRFGAVPPVSIHPQ
FT                   LQKQRNFWGSNLGGADLSVDPPMTPMPTIVSRYQAGANTAILVRRFNDLPAGIPSGGFG
FT                   KNQMSTHFHNFHSAPDSDGGPCDPRLGGLAEDPYTQGRFFFPGQYYDYYYNMKRAGFLN
FT                   ADTPDGDVRETLGTCWYHDHREAHTAENVYKGIAGFHLIFNEHDTGDERTGFRLPSFPA
FT                   FDIPVLVTDLLIDPNTEQAVFDVLDDDGHIGDKYVVNGKIQPYCEVFQRRYRFRVLNIG
FT                   PSRFHQLFLTNPDNPRQSIPFWQISSDGNLLPKPLQVTSVRLSCAERADLIFDFRKLTA
FT                   PGGPAAGATRLWLENRLLQDNGRGPEDELLSAGRAANALIEFRIGAVVADDSVDPATIT
FT                   SFAPITLPPLQTPRITRTFEWGRGNGGWVVNDRPMSCDEIRFTMKRGAMERWIYRTGGG
FT                   WSHPIHHHFVEGRIIKRNGRAIPPTSPEFGRKDVVWLGEGDEVEYWVKATDYLGVYPIH
FT                   CHNVVHEDKGMMMLFAVDTVGDDNTKP"
FT   sig_peptide     72214..72273
FT                   /locus_tag="Lcho_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.921 at
FT                   residue 20"
FT   gene            74058..74654
FT                   /locus_tag="Lcho_0070"
FT   CDS_pept        74058..74654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0070"
FT                   /product="Uncharacterized protein SCO1/SenC/PrrC"
FT                   /note="involved in biogenesis of respiratory and
FT                   photosynthetic systems; KEGG: ppf:Pput_2533 electron
FT                   transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32345"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z8"
FT                   /protein_id="ACB32345.1"
FT                   /translation="MLEGNLRRALIGASLFAGAGLVSAIATPARAEDPRERLRRKRLHN
FT                   LPLLTQDGRTVRFYDDVVKDRKVVISVMYTGCSNICTPATRNLMEARERLGDFGRDIHF
FT                   VSISLTPLTDTPAELRAYKKAHGIGADWTFLTGKPAHVEQVTRGLGLLSEDPADDLLSH
FT                   SGSAVIADEKLLKWGHGSTLTGGRALARMIRFELV"
FT   sig_peptide     74058..74153
FT                   /locus_tag="Lcho_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 32"
FT   gene            complement(74662..75261)
FT                   /locus_tag="Lcho_0071"
FT   CDS_pept        complement(74662..75261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0071"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: rfr:Rfer_2757
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32346"
FT                   /db_xref="GOA:B1Y5Z9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y5Z9"
FT                   /protein_id="ACB32346.1"
FT                   /translation="MTPIPLHWLDWLQLLGHFAALSLLSVGGAITVASDLHRRLVLDHH
FT                   WLSDGQFSASIALAQAAPGPNLLFVGLVGWHVGLNAGATTGLNAGGYATATAGLLLSLS
FT                   GALLPSSVLTLTATRWARRHRDDRAVRAFKQGMAPLVIGMMLATAAVLNLASGPLLPHW
FT                   PMWALSAAAAWAVWATGVHLLWLLAAGALLGALGWV"
FT   gene            complement(75258..75959)
FT                   /locus_tag="Lcho_0072"
FT   CDS_pept        complement(75258..75959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0072"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: vei:Veis_3786
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32347"
FT                   /db_xref="GOA:B1Y600"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y600"
FT                   /protein_id="ACB32347.1"
FT                   /translation="MPPNPPSAPAHPPIPEAPAAPRSVGELFWAFSVMALQGFGGVLAI
FT                   VQRELVERRQWLSREGFVEDWAVAQVLPGPNVINLSLMIGDRHFGLRGALAAMLGLLLF
FT                   PLLLLMALTLAFAQFQHLAAVQGALRGMGAVAAGLIVATALKLAGALRSNVLGRPTAAL
FT                   VGALTFGAIVLLRVPLPWVLLGIGLPACLVAGWRLGRVQSAAAVPIATPTSHTSPAAPA
FT                   PATSTGSEPRP"
FT   gene            complement(76003..76926)
FT                   /locus_tag="Lcho_0073"
FT   CDS_pept        complement(76003..76926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0073"
FT                   /product="Acyl transferase"
FT                   /note="PFAM: Acyl transferase; KEGG: dac:Daci_1762
FT                   (acyl-carrier protein) S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32348"
FT                   /db_xref="GOA:B1Y601"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y601"
FT                   /protein_id="ACB32348.1"
FT                   /translation="MTLGLLFPGQGTQHPDMLPWLGHGCAPLPALALLESRLGADWRNR
FT                   LADSAWATRNEVAQTLLTGLSLAAWQQLQPLLPAPAVVAGYSVGELAAFSAAGVFGADD
FT                   ALAMASLRARLMDECVQGQPTGLLSISGAAPGAIDDLCRRHALAVAIRIGADRVIVGGL
FT                   RSDLQAAEDEAGAAGASCTRLAVSIASHTPWMAAGVPRLAEALAARPFERPRVALVCNH
FT                   TGTTLRTVDALRQALAAQIAATVPWDRCMDTVAERRVRCVLEVGPGNTLARMWNARHPA
FT                   IPARSVDEFQAPDAAARWVHEALGTD"
FT   gene            complement(76985..77872)
FT                   /locus_tag="Lcho_0074"
FT   CDS_pept        complement(76985..77872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0074"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase MdcB"
FT                   /EC_number="2.4.2.52"
FT                   /note="KEGG: mpt:Mpe_A2891 triphosphoribosyl-dephospho-CoA
FT                   synthase; TIGRFAM: triphosphoribosyl-dephospho-CoA synthase
FT                   MdcB; PFAM: triphosphoribosyl-dephospho-CoA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32349"
FT                   /db_xref="GOA:B1Y602"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y602"
FT                   /protein_id="ACB32349.1"
FT                   /translation="MKHRLERAADRGLPHVSSPLAAETLQRVGRAATVALYDELALAPK
FT                   PGLVSFVDSGSHTDMDAGTFLRSLFALRHYFAQIAALGARQAVFAELEQAGIEAERRML
FT                   QATAGINTHRGAVFSLGLLCAAAGRLLARGEPLAPATLRRSLVDGWGPALRERCTHSRD
FT                   SNGQRAALNHGLRGVGEEAADGFPVLFEVAMPALHQALANGLNTRHARLQTLFAVMAAL
FT                   DDTNLAHRGGLAGLRHAQQMAAGFLAAGGAARPDAIAHAQAIHHDFVARRLSPGGAADV
FT                   LAAACWVHKVCAST"
FT   gene            complement(77869..78630)
FT                   /locus_tag="Lcho_0075"
FT   CDS_pept        complement(77869..78630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0075"
FT                   /product="holo-ACP synthase, malonate
FT                   decarboxylase-specific"
FT                   /note="KEGG: dac:Daci_1764 holo-ACP synthase, malonate
FT                   decarboxylase-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32350"
FT                   /db_xref="GOA:B1Y603"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y603"
FT                   /protein_id="ACB32350.1"
FT                   /translation="MAFIPAVITHARNADMSRPPLALRRHQLVRLSPAGWQTVLAQTHA
FT                   ESARPCLAHWAAHDLPLVVTRQPESAADAEAIHLGLPAPTCWQRQRLSLAVARSAVRAV
FT                   GEFPAAIDITGQLPDAAQAPWRRLCDQLGALGLHAQVYGSHGWQQLTGLAYLRAQSDLD
FT                   LFVPVPDAHAADAAAALLADATAALLAEAGIDAPRLDGELGFVDGSAVAWREWRDWRAG
FT                   RVAQILVKRLQGVALASGTDWLPRTGAERVR"
FT   gene            complement(78637..79338)
FT                   /locus_tag="Lcho_0076"
FT   CDS_pept        complement(78637..79338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0076"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, gamma subunit;
FT                   PFAM: malonate decarboxylase gamma subunit; KEGG:
FT                   dac:Daci_1765 malonate decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32351"
FT                   /db_xref="GOA:B1Y604"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y604"
FT                   /protein_id="ACB32351.1"
FT                   /translation="MDWHTLLQRLFGDAHAVQADGDFLHGTAQLDGATLAIVGTTGHAP
FT                   IGVALALRQARAVLDTLALHPGRAIVLLIDTQGQQLRRRDELLGINRAMAHLGCCIDQA
FT                   RRQGHRVIGLVYDQALSGGFITSGLIADACYALPEAEIRVMRIPAMARVTKISEERLTA
FT                   LSKDNPVFAPGVQNYVAMGGIRALWSGDLAAALRDALAHAPTDDVRAADGAERGGRQLA
FT                   AAVVQRVLDAA"
FT   gene            complement(79341..80243)
FT                   /locus_tag="Lcho_0077"
FT   CDS_pept        complement(79341..80243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0077"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, beta subunit; KEGG:
FT                   dac:Daci_1766 malonate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32352"
FT                   /db_xref="GOA:B1Y605"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y605"
FT                   /protein_id="ACB32352.1"
FT                   /translation="MSLSYAECSARERVKLLLDDGAFHEWLPPSERLTSPHLAQLGVPS
FT                   SFDDGVVIGRGRLDGQVVFVASQEGAFMGGGVGEVHGAKLVGLFKRALRDRPAAVLLLA
FT                   ESGGVRLHEANAGLIAVSEVMRALLDVRAAGIPVIVLIGGANGCFGGMGIVARCADHLI
FT                   ISDIGRLAMSGPEVIEASHGVDEFDSRDRALVWRTTGGKHRWLCGDCDDLVDDDVAAFR
FT                   AAAIAALDRRRPMDAAELEREHRLLAQRLADAPAGADALALWRQLGVPRAEQVSDLDAA
FT                   ELCALRSAATTTTTTPQGA"
FT   gene            complement(80240..80578)
FT                   /locus_tag="Lcho_0078"
FT   CDS_pept        complement(80240..80578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0078"
FT                   /product="malonate decarboxylase acyl carrier protein"
FT                   /note="TIGRFAM: malonate decarboxylase acyl carrier
FT                   protein; PFAM: malonate decarboxylase delta subunit; KEGG:
FT                   dac:Daci_1767 malonate decarboxylase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32353"
FT                   /db_xref="GOA:B1Y606"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y606"
FT                   /protein_id="ACB32353.1"
FT                   /translation="MSNAVGIEKMQFEFDGNRPVAPFAPVLVGVVGSGNLEVMVEPAAG
FT                   SHCSVEVETSARGFRPIWQAVLSDFHDRHALAGVRVSINDMGATPAVVSLRLEQAVAQM
FT                   QGARGAQL"
FT   gene            complement(80583..82283)
FT                   /locus_tag="Lcho_0079"
FT   CDS_pept        complement(80583..82283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0079"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="TIGRFAM: malonate decarboxylase, alpha subunit;
FT                   KEGG: mpt:Mpe_A2895 alpha subunit of malonate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32354"
FT                   /db_xref="GOA:B1Y607"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y607"
FT                   /protein_id="ACB32354.1"
FT                   /translation="MNAVATSPAAAAATTTAWDHKARRRQARLARAAEEVAARGKCVPH
FT                   ADAVALLHAVLEPGDRVCLEGNNQKQADFLARALTQLDPQRVHDLHMVQSVLALPEHLD
FT                   LFEDGIASRLDFSFSGPQGARLAQLVSAGQIRIGAIHTYLELFARYFVDLTPQVALIAA
FT                   QSADREGNLYTGPNTEDTPAIVEATAFSGGIVIAQVNQIVDRLPRIDVPAGWVDFVIEA
FT                   PTPHFIEPLFTRDPAQISEIQVLMAMMAIKGIYAEYGVQRLNHGIGFDTAAIELLLPTY
FT                   GESLGLKGKICRHWALNPHPALIPAIEAGWVESIHSFGSELGMEDYIRARSDVFFTGAD
FT                   GSLRSNRAFCQAAGHYACDLFIGSTLQMDLAGNSSTATLGRIAGFGGAPNMGADARGRR
FT                   HASPAWLKAGAQAREGLTGARGTPRGQKLVVQMVETFREHMQPAFVERLDAWQLAEQAG
FT                   MALPPIMIYGDDVSHVLTEEGIANLLLCRSDEEREQAIRGVAGYTPLGLGRDRRAVENL
FT                   RDRGVIRRPADLGIDPRDATRNLLAARSMRDLVRASGGLYQPPKRFRNW"
FT   gene            complement(82296..83327)
FT                   /locus_tag="Lcho_0080"
FT   CDS_pept        complement(82296..83327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mpt:Mpe_A2898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32355"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y608"
FT                   /protein_id="ACB32355.1"
FT                   /translation="MTQPRSPRAPRTAPTRRLALQQAGLCLAGVLVAGLSVPASAQTQA
FT                   WPSKPVTVVVPFPAGGGTDAFARPLYAQLTKQLGMQVVIDNKGGAGGNVGATVASKAAP
FT                   DGYTWFMGAVHHAIAPSIYPKLDYNLGNDFVPVALISNVPQVIVVNPQKVPANNLKELL
FT                   AHLKANPGKLSYGSAGNGSSHHLAGELFKMQTQTFITHIPYRGAGPALQDLIGGQVDMM
FT                   FDGLGSSAIHIKSGRLRAIAVASEKRAPGFPDIPTSIEAGVPTYQVATWYGLWAPKGTP
FT                   KEIVERMAAELRTAFASKEIKDAWTNLGSEIPTLAGPAFGDFVTSETRRWATVVKDGNI
FT                   KME"
FT   sig_peptide     complement(83202..83327)
FT                   /locus_tag="Lcho_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 42"
FT   gene            83480..84202
FT                   /locus_tag="Lcho_0081"
FT   CDS_pept        83480..84202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0081"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: mpt:Mpe_A2899 putative GntR-family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32356"
FT                   /db_xref="GOA:B1Y609"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y609"
FT                   /protein_id="ACB32356.1"
FT                   /translation="MKISDRLRETIEEQIATGELAPGSALDEALLVERHGVSRTPVREA
FT                   LIQLAAEGLVELRPRRGAVVAALGPTRLIEMFEVMAELEAMCARQAARRATEADLAAIQ
FT                   AAHERCRSAAGELDPDAYFYANEGFHRAIYDSAHNAFLAEQAQALQRKLRPYRRLQLRV
FT                   RNRLQRSFEEHQGIVDAIRNGDAELAVNAVRNHVIVQGERFADLLAGLRQLESAVPRPS
FT                   AAPAAHTSVNTDPAARIA"
FT   gene            84204..85490
FT                   /locus_tag="Lcho_0082"
FT   CDS_pept        84204..85490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0082"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   pol:Bpro_1410 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32357"
FT                   /db_xref="GOA:B1Y610"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y610"
FT                   /protein_id="ACB32357.1"
FT                   /translation="MRVGRSCGHVARTVPGAHVKVIDMSSASTGKRRFARIDRLPPYVF
FT                   NITAELKLAARRRGEDIIDLSMGNPDGATPAHIVAKLTEVAQRADTHGYSASKGIPRLR
FT                   RAISHWYQDRYAVDINPDTEAIVTIGSKEGLAHLMLATLDRGDTVLVPDPSYPIHIYGA
FT                   VIAGADIRSVPLIPGVDFFAELERAIRGSYPKPKMMVLGFPSNPTAQCVELDFFERVIA
FT                   LAKKHDIFVVHDLAYADIVFDGWKAPSIMQVPGAKDVAVEFFTLSKSYNMAGWRIGFMV
FT                   GNPDLVAALARIKSYHDYGTFTPLQVAAIAALEGDQQCVKDIAANYQKRRDVLYKGLIE
FT                   AGWQVECPKAAMYIWAKIPPAYAALGSLEFARQLLEKAKVCVSPGIGFGDHGDDHVRFA
FT                   LIENEARIRQAVRGIKAMFKADGVVVPAG"
FT   gene            complement(85554..86225)
FT                   /locus_tag="Lcho_0083"
FT   CDS_pept        complement(85554..86225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0083"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: mpt:Mpe_A0744
FT                   2-hydroxychromene-2-carboxylate isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32358"
FT                   /db_xref="GOA:B1Y611"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y611"
FT                   /protein_id="ACB32358.1"
FT                   /translation="MTTDDCNDAAPPRQVEFWLDFGSNYSYLSAMRIEAAAQQLGLTVA
FT                   WRPFLLGPIFKSFGWDSSPFVLQKEKGAYMWRDMERQCAKHGLPWRKPSVFPRSAVLPM
FT                   RVAAAHAEQPWIGAYCRETMRLNFALDRDLDSEDSVAGVLRGLGLPAAELIDAARDGPR
FT                   RGRLRELTAEAQRRGLFGAPSLFARGELFWGNDRLDDALAFAAQGTAGRVRPTDTARWP
FT                   Q"
FT   gene            86507..87097
FT                   /locus_tag="Lcho_0084"
FT   CDS_pept        86507..87097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0084"
FT                   /product="restriction endonuclease"
FT                   /note="KEGG: aav:Aave_3831 restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32359"
FT                   /db_xref="GOA:B1Y612"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y612"
FT                   /protein_id="ACB32359.1"
FT                   /translation="MAKNSLFAVLLRSRWWVSVCIAGVMALLAWVVLPEDYRVAGVLGC
FT                   FPFLVIGAMAAWRQRDLPSPARVGQTLEAVGAMPWPAFSALLEQAFRRDGHALQRRSGA
FT                   VDFALERQGRHTLVSARRWKSARTGLEPLRELQAARVAREGDALPDAIYIGLGEPSDNA
FT                   RAYAAEHGITLWQAAELAHALRGLPLPATPPTR"
FT   sig_peptide     86507..86602
FT                   /locus_tag="Lcho_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.514 at
FT                   residue 32"
FT   gene            complement(87210..88604)
FT                   /locus_tag="Lcho_0085"
FT   CDS_pept        complement(87210..88604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0085"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; leucine-rich repeat-containing protein
FT                   typical subtype; KEGG: pfo:Pfl_3676 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32360"
FT                   /db_xref="GOA:B1Y613"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y613"
FT                   /protein_id="ACB32360.1"
FT                   /translation="MHSLEQLRSGALAGTRRLDLSAGLSHFPPEIYTLADTLEVLNLSG
FT                   NQLNALPDDLPRLHRLKVIFCSDNAFTTLPAVLGRCAQLEMVGFKANRIADVPAESLPA
FT                   QLRWLILTDNAITQLPATLGWRPRLQKLMLAGNRLRDLPDLSRCTQLELLRLAANRFET
FT                   LPAWLLDLPRLSWLALAGNPLRAPFGARPQQPLRPDRPDIARIAWSQLQLEHALGEGAS
FT                   GVIHRALWQPPDQHAPQDGREPPARQHSPARPVAVKLFKAAMTSDGLPDCEMAACIAAA
FT                   GHPGLIAVEGVLHAHPEGSAGLVLALLDPAYRALAGPPSLASCSRDVYADTLRLPVAAA
FT                   LAIARRIADVAAHLHAQGLMHGDLYAHNILWNGETQQPQCVLSDFGAASFHDPASPAAE
FT                   ALQRLEVRAFGCLLEELIERADAAHAAETDALAAMAALRDACLQPQVHARPSLAQVVGQ
FT                   LAQIGH"
FT   gene            complement(88612..89895)
FT                   /locus_tag="Lcho_0086"
FT   CDS_pept        complement(88612..89895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0086"
FT                   /product="D-serine deaminase"
FT                   /note="KEGG: pol:Bpro_0661 D-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32361"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y614"
FT                   /protein_id="ACB32361.1"
FT                   /translation="MPAPTADALIDPQLDASFKGYPPDAPPLRRSQIAARGWNVLAGDL
FT                   PLPLAVIRREPLAHNLGWMQRHVAAAGIALAPHGKTTLSPQLFAAQVEAGAWGITFANV
FT                   HQLALGVAGGVRRALIANQVIQAGDLHQLAALRAQHPGLRAPFFIDSAAQLALIEAQAL
FT                   PAPLEVLLELGLPGGRTGCRGHEQALALARAVHASPALQLAGISTYEGLWGSGDDAADR
FT                   ALAEGLMQRVHALALACEHEALFDTDEVIVSAGGSALFDRVSQALRPPLRKPVLGLLRS
FT                   GCYVTHDDGHYRRMVHVANRRLGCADADGLRAALQVWTLVQSCPEPGLAILNAGKRDLS
FT                   FDMGLPVPVMFCPQGERTARAVPAGWQISALNDQHAYLRLGDDASALQVGDRVALGISH
FT                   PCTTFDKWRWMPVVDEALRVVDAITTLF"
FT   gene            90047..92119
FT                   /locus_tag="Lcho_0087"
FT   CDS_pept        90047..92119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0087"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: pna:Pnap_0620 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32362"
FT                   /db_xref="GOA:B1Y615"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y615"
FT                   /protein_id="ACB32362.1"
FT                   /translation="MPSSALAHAPSQRAHMATVMQVADAGVAAPAAARHDALIRASWQR
FT                   CVHQHRLDPTRMQEAVILPQPRLREHQGQMEDFLQIARHGLEALYQQVAGLGYVVLLTD
FT                   ARGVTVDFIGDLLVEPGLRKAGLYLGADWSEHHAGTCGVGTCISTGQALTVHLDDHFDA
FT                   THIPLTCTAAPVFDTVGRLNAVLDISQLSSHQPKASQHLALQLVKVYAQHVENAAFLQR
FT                   HRHDWVLRLSEAPQFLDVNPDYLLALDAAGRVIGHNRRAQLLFEPGLPGLSGRTTTAPD
FT                   RGPSALIGQPIGRLLALSVGDLGRFVQGRAADRRAVLRSGARHVLFLHAAPPPAPLRTA
FT                   ASEPGRVTTERQLPAPLAALSGGDAALDRQIARAARLVDSPVSLLITGETGSGKEYFAK
FT                   ALHASSERRGGPFVAVNCAAIPESLIESELFGHLPGSFSGAGPKGKKGLIQEADGGTLF
FT                   LDEIGDMPRALQARLLRVLAEREVLPIGATRPTPVDLRVIAATHCPLEALVREGRFRDD
FT                   LYYRLNGAHVVLPPLRERQDLDVLIDRMLAPCGDAPAPRQRAAALREPATRLAADARAA
FT                   LHAHPWPGNLRELRNALDYARTLCDDGLIRLGDLPDALLAASPPVARRPSGPDIWQPGS
FT                   TLHAPVADEAAQLLQALRAARWNVSAVARELGCSRMTLYRRMKRLEIRSPLEARE"
FT   gene            92178..92639
FT                   /locus_tag="Lcho_0088"
FT   CDS_pept        92178..92639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0088"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: mgm:Mmc1_2517
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32363"
FT                   /db_xref="GOA:B1Y616"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y616"
FT                   /protein_id="ACB32363.1"
FT                   /translation="MRLSLIATTLCAAALHLAPLPALAEDKAVIDAMEGYLDFVDYGGA
FT                   TIFPEQIPKDDWKSFFVIDARDKEQFAKEHIPGAVNIEWRRALAERGRIPKDKPVLLYC
FT                   NTGTLSAQAGFALRVAGYENVRILQGGYAEWKAKGGFDAAARATGAVKH"
FT   sig_peptide     92178..92252
FT                   /locus_tag="Lcho_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            92887..94695
FT                   /locus_tag="Lcho_0089"
FT   CDS_pept        92887..94695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0089"
FT                   /product="putative flavoprotein involved in K+ transport"
FT                   /note="KEGG: pna:Pnap_0619 putative flavoprotein involved
FT                   in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32364"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y617"
FT                   /protein_id="ACB32364.1"
FT                   /translation="MTQISPPISPTQRAADWLARFEAAAAARDADAATALFDDECYWRD
FT                   LVSFTWNIRTFESRDDIRAMLAARLNDVQPSAFKVEGDATEAGGVTEAWFTFETAVSRG
FT                   RGLLRLKGDRAWTFLTTMVELKGHEEKKGPRRIKGAEHGVQRGRQTWLEKRQHEQATLG
FT                   YSEQPNTLIIGGGQGGIGLAARLRRLGVPTIVIEKNPRAGDSWRNRYKSLCLHDPVWYD
FT                   HMPYLPFPDDWPVFCPKDKVGDWLESYTKIMELNYWASTVAEKARWDEDKQEWEVRVVR
FT                   EGQPVTLRPKQLVFALGVSGYPNVPKITGAETFEGTQHHSSKHPGGAAWAGKKCVVLGS
FT                   NNSAHDICADLWENGADVTMLQRSSTHIAPSDSLMELALGGLYSEAAVAGGISADKADL
FT                   IFASVPYKIMHTFHIPVYEEMKKRDADLYARLEKAGFMLDFGEDGSGLFMKYLRRGSGY
FT                   YIDVGASELIANGSVKLRSPVNIERINPKSVTLTDGSELPCDLLVYATGYGSMNGWLAD
FT                   LISPEVADQVGKCWGLGSATTKDPGPWEGELRNMWKPTPVQNLWIHGGNLHQSRHYSQF
FT                   LSLQLKARMEGIATPVYRPQPAHHRR"
FT   gene            complement(94738..95370)
FT                   /locus_tag="Lcho_0090"
FT   CDS_pept        complement(94738..95370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0090"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: pol:Bpro_1051 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32365"
FT                   /db_xref="GOA:B1Y618"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y618"
FT                   /protein_id="ACB32365.1"
FT                   /translation="MEIDFAELTAYQRYKLMASLIVPRPIALVTTLGANGVANAAPFSM
FT                   FNMLGEDPPIVMLSINRLHDGRLKDTAANILASGEFVVHLCDEPLAAQMHACGESLPPQ
FT                   VSELAKVGLHAVPSQTVAPPRIAEAPVAFECVLHEKLETASRYIFIGRVQWLSVREGLV
FT                   DRETWRVRLQDYHPVGRFGASFYVTTRDRFAIGDTQDPSRSTSIDEI"
FT   gene            95507..96154
FT                   /locus_tag="Lcho_0091"
FT   CDS_pept        95507..96154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0091"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   mms:mma_1862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32366"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y619"
FT                   /protein_id="ACB32366.1"
FT                   /translation="MHQKSVAQPRRPTCSACHLPQRTCLCAWLRPTPNAVEVLILQHPL
FT                   EAHQAKGSARLLALSLQRCRRVVAETLDAAALADWLGPDDAAPGDTVLLYPATASAPGP
FT                   LADPAVMPRRLVVLDATWRKSLRLLHLNPRLQALPRWPLVDPPAARYGALRKAALPEQL
FT                   STLEATCLALAQIEADAPRYAPLLDAFGAWVADTSTAFRPTPAAITPGETPP"
FT   gene            complement(96129..96875)
FT                   /locus_tag="Lcho_0092"
FT   CDS_pept        complement(96129..96875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0092"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: ter:Tery_0392
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32367"
FT                   /db_xref="GOA:B1Y620"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y620"
FT                   /protein_id="ACB32367.1"
FT                   /translation="MIVRSEHIDLPAGDGVMRCFMAMPEQPGRYPGIVFYSDIFQLTGP
FT                   MQRACVRLAGHGYTVLAPEIYRRIEPAGTVIAFDDAGRSRGLSDAERTPVAHFDADCRL
FT                   ALDHLASHPAVAPGQLGAAGFCIGGHLAMRAALQPDVKATACFYATGVHNGKLGQDADA
FT                   GTLQRLGEIGGRLLLVWGTADPHIPAAGRDLIEATLRAKNVDFEQRLYAAEHAFMRDVG
FT                   ARFDPEAADLAFAEAVAFFRAAFRPA"
FT   gene            complement(96911..97954)
FT                   /locus_tag="Lcho_0093"
FT   CDS_pept        complement(96911..97954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0093"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bmu:Bmul_3074
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32368"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y621"
FT                   /protein_id="ACB32368.1"
FT                   /translation="MAYTAAATRYESMPYRACGRSGLKLPAMSLGLWHNFGDATPMALQ
FT                   RALVTTAFDLGITHFDLANNYGPPYGSAEINFGRILREDLKPYRDELIISSKAGWDMWP
FT                   GPYGAGGGSRKYVLASLDQSLQRLGLDYVDIFYSHRYDAETPLEETAAALAHAVSQGKA
FT                   LYIGISSYSPAKTAEMAQLLRGHGVPLLIHQPSYNLFNRWIENGLLDTLAEQGAGCISF
FT                   TALAQGLLSDKYLNGIPADARINRPGGGSLKAEHLSEANLAKVRALNGIAQKRGQTLAQ
FT                   MALAWVLRDPRVTTTLLGASSPAQIRENVAALQNLAFSADELAEIDRHAQEGGVDLWRA
FT                   PSSDWNI"
FT   gene            98264..98836
FT                   /locus_tag="Lcho_0094"
FT   CDS_pept        98264..98836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0094"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   mpt:Mpe_A0366 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32369"
FT                   /db_xref="GOA:B1Y622"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y622"
FT                   /protein_id="ACB32369.1"
FT                   /translation="MESFLVSTGVVALGEMGDKTQLLAMLLAARFRKPVPIILGILVAT
FT                   LANHALAGAVGGWVAQALGPDVLRWVIGASFIAMAAWMLIPDQIDNEDAGGRQLFGVFG
FT                   TTVLAFFLAEMGDKTQIATVALAARYGDLVAVVAGTTLGMMLANVPAVFLGDRIAKAVS
FT                   MTLVHSIAATIFAVLGMLTLLNVGQIF"
FT   gene            complement(98859..100721)
FT                   /locus_tag="Lcho_0095"
FT   CDS_pept        complement(98859..100721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0095"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   mpt:Mpe_A0560 glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32370"
FT                   /db_xref="GOA:B1Y623"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y623"
FT                   /protein_id="ACB32370.1"
FT                   /translation="MCGIVGAVSQRNIVPILIQGLQRLEYRGYDSCGVAVHQGGELRRA
FT                   RSTSRVAELDAQVLQDGVEGLIGIAHTRWATHGAPAVHNAHPHFSHGTGADAKSAKAGR
FT                   IALVHNGIIENHDELRAELQARGYEFSSQTDTEVIAHLVDSLYEGDLFDAVQRALPQLR
FT                   GAYAIAVFCREEPQRVVGAREGSPLVLGVGKGETFLASDAMALAGVTDQIVYLEEGDVV
FT                   DMQQGKYWITARADGGARPRVDRPVKTVHAHSGAAELGPYRHYMQKEIFEQPRAIGDTL
FT                   EGVEAIAPELFGDGAAQVFAEIDKVLILACGTSSYSGMTAKYWLESIAKVPAQVEVASE
FT                   YRYRDSVPDPKTLVVTISQSGETADTLAALKHARSLGMTNTLTICNVSTSAMVRECKLA
FT                   YITRAGVEIGVASTKAFTTQLAGLFLLTLALAKVRGHLTAEAEADHLKAMRHLPVALQA
FT                   VLALEPQVIAWAEDFASKENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHG
FT                   PLALVTSAMPVVTVAPNDALLEKLKSNIQEVKARGGQLYVFADADTRIESDAGVHVIRM
FT                   PEHYGALSPILHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            100889..101395
FT                   /locus_tag="Lcho_0096"
FT   CDS_pept        100889..101395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0096"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   pol:Bpro_0674 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32371"
FT                   /db_xref="GOA:B1Y624"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y624"
FT                   /protein_id="ACB32371.1"
FT                   /translation="MTSSIPLDEIDLRLLDELQRDASRSNQALAEAVQVSPATSLRRLR
FT                   RLGEAGVIERTVAVLSPEALGHGLTAIVEITLDVQAAERLAAFEARVVADAGVQQCYRT
FT                   SGGPDFVLIAQVADMAAYQALVQRLFNADANVRNVRCFFSVQRAKCGLQIALPAADVTA
FT                   PARPA"
FT   gene            complement(101370..101852)
FT                   /locus_tag="Lcho_0097"
FT   CDS_pept        complement(101370..101852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0097"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32372"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y625"
FT                   /protein_id="ACB32372.1"
FT                   /translation="MDFALSANPPSTRPMRARRAPVMQFSVELLTPTHYARLGLAEDAD
FT                   AAAIEDAWQRLRPPPSLSAEVDEVRATLKAMAWPQPGLAESPAIRARQRELAYGVLSDP
FT                   ARRAVYDRWLAEHRSRITRPPETPRWQAWLHSHRGHWQIGVGAALLASVTLAWLAL"
FT   gene            complement(101859..103268)
FT                   /locus_tag="Lcho_0098"
FT   CDS_pept        complement(101859..103268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0098"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: mpt:Mpe_A0557
FT                   UDP-N-acetylglucosamine diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32373"
FT                   /db_xref="GOA:B1Y626"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y626"
FT                   /protein_id="ACB32373.1"
FT                   /translation="MRLDVVIMAAGKGTRMKSARPKVLHPLAGRALLQHVLEMGAGLGA
FT                   DRLITITGHGAESVEAAMRAALPAAPLAFVRQEPQLGTGHAVQQAVPALGDEGTTLILN
FT                   GDVPLVRPETARALIAACGGEKLALLTVELADPTGYGRIVRDAADRERVLAIVEHKDAT
FT                   PEQRAITEGYTGMMAVPTRHLKRWLAALRNDNAQKEYYLTDIVAMAEADGVPVVATLAG
FT                   NETEVLGVNSPLQLAELERRFQRVQAESLMEAGVRLMDPARFDLRGVLRCGRDVAIDVN
FT                   CVFEGEVELGDEVQIGANCVIRNARIAAGAVIHPFTHIDGEAAGVEVGEGALIGPFARL
FT                   RPGARLGRAVHIGNFVEVKNSTLADGAKANHLAYLGDATVGERVNYGAGSITANYDGAN
FT                   KHRTVIEADVHIGSNCVLVAPVTIGAGATVGGGSTITKDVAPGQLGVARGKQVVLDGWV
FT                   RPSKNKPAKPA"
FT   gene            103357..104235
FT                   /locus_tag="Lcho_0099"
FT   CDS_pept        103357..104235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0099"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: mpt:Mpe_A0556 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32374"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y627"
FT                   /protein_id="ACB32374.1"
FT                   /translation="MTAAALLLATLLIGGCSTLRWGYSQGDTLAYWWLDRHAGFTETQA
FT                   PQVRAALAQWFDWHRREQLADDVALLEQIALAAPDDLSAAQVCGWWGTLEKRRARYMAM
FT                   AVPALARIAPTLSAEQWRSVQQRFDRTNATWRDEQLGADPRERERKAVERVVERAEKLY
FT                   GRLDGAQRDFVTERMRRSPWDAQRWLDERQIDQRDTLRTLSGMSANGQTEAQRQEIVHA
FT                   WLGRVVQPSDAAAGRWRASLRDDQCALSAELHNRSSAAQRRQAVETLRGWAQDLRSFLP
FT                   PVSAKQAAKAP"
FT   sig_peptide     103357..103425
FT                   /locus_tag="Lcho_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.834 at
FT                   residue 23"
FT   gene            complement(104204..104854)
FT                   /locus_tag="Lcho_0100"
FT   CDS_pept        complement(104204..104854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0100"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: mpt:Mpe_A0555 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32375"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y628"
FT                   /protein_id="ACB32375.1"
FT                   /translation="MNRSPRPSRPLPSRRRHFLKAAAAASALWWLAGCASIDQVSVDVT
FT                   TYGAWPSGRAPGRYAFERLPSQVQAGAAQDQLEAAAGAALERVGFSRAADAAQADVLVQ
FT                   FGARQGKLVDPPPMFGWGIGLGFPIGGRSSMGLGMHTGSGWYGDRVRDYRELGLLLLDR
FT                   ASHRVLVEVQARHESRYGGDDLSEALFDAALSGFPALPAGERRVTVPLPPASR"
FT   sig_peptide     complement(104747..104854)
FT                   /locus_tag="Lcho_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.582 at
FT                   residue 36"
FT   gene            complement(104905..105885)
FT                   /locus_tag="Lcho_0101"
FT   CDS_pept        complement(104905..105885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0101"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mpt:Mpe_A0554
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32376"
FT                   /db_xref="GOA:B1Y629"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y629"
FT                   /protein_id="ACB32376.1"
FT                   /translation="MNTPTATLNAPAADAESAAASAADKKAAFELNKLSKRLHRQVGQA
FT                   ITDFNMIQEGDRVMVCLSGGKDSYGMLDILLGLQQRAPITFSIVAVNLDQKQPGFPEHI
FT                   LPAYLKARGVEFHIENQDTYSIVKRVIPEGKTMCSLCSRLRRGILYRVADELGATKIAL
FT                   GHHRDDFLGTVFLNMFFGSKLKGMPPKLVSDDGRHTVIRPLAYVAETDLERWAEHRAFP
FT                   IIPCTLCGTQDNLQRVQIKHMLRDWDQRFPGRIDNMHRAFSQVVPSHLMDRALFPFETL
FT                   VPTGVADPAGDRAFDEDDSELCAPSGSADAAGDEVSVPVALIRRV"
FT   gene            complement(105882..106280)
FT                   /locus_tag="Lcho_0102"
FT   CDS_pept        complement(105882..106280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0102"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="KEGG: reh:H16_A0259 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32377"
FT                   /db_xref="GOA:B1Y630"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y630"
FT                   /protein_id="ACB32377.1"
FT                   /translation="MISQLAHPSLMDCRRLFLLDYEVWINIGVHDFEKRGEQRVLINVD
FT                   IYVPLALSTPTQDELDEVVDYDFIRRSIAERISKGHVHLQETLCDDVAEIMLGHPKVRA
FT                   VRVSTQKPDVYPDCRSVGVEVFRMKSPT"
FT   gene            complement(106331..107143)
FT                   /locus_tag="Lcho_0103"
FT   CDS_pept        complement(106331..107143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0103"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mpt:Mpe_A0552 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32378"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y631"
FT                   /protein_id="ACB32378.1"
FT                   /translation="MPVSPSAAATDRPVVRRPLTLVTGGARRLGRAIALELADARHDIA
FT                   LHYRGSVADAEATAADLRALGAEVALFQADLSDEAACRALVPAVVARLGRLDAVVNNAS
FT                   TFEYDEPASFGHAAMERHWRANTAAPVLLAQALHAHLGERNGRGCVVNLLDQKLVNLNP
FT                   DYFSYTLSKAALQAATQMLALALAPRLRVVGVSPGVTMVSGPMSEAEFEAAHKLTPLQR
FT                   SSTPEDIARAVRFALESPAITGSTLLVDGGQHLLGQPRDVLYLVQPPA"
FT   gene            107261..108475
FT                   /locus_tag="Lcho_0104"
FT   CDS_pept        107261..108475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0104"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   mpt:Mpe_A0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32379"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y632"
FT                   /protein_id="ACB32379.1"
FT                   /translation="MNRPQPPATTDSVASAPDAQAQSDIPHRSPHEASPDSHALLVRIA
FT                   AAIEDAGGWISFERYMALALYTPGLGYYSRGDRQFGLMPASGSDFVTAPELSPLFGRAL
FT                   ARQVAQALQATGTQEVWEFGAGSGALAAQLLGELGDRITRYTIVDLSGTLRARQRERIE
FT                   AAHPALAHKVRWLAELPERFEGVVVANELLDAMPVTLLHWDGHHWHDRGVALEPGSAAA
FT                   GAPRLRFADHPTHLAPPVDQHWPVGAVVELPRIAVAYILTLAERLARGAAFFIDYGFPE
FT                   HEFYHPQRSAGTLMCHRAHRADPDPLSDPGDKDITAHVDFTAIAVAAQDAGMGVLGYTS
FT                   QARFLMNCGLIGDLEHADLRERAMAQKLITEHEMGELFKVLGVASAGAEFDAIGFTAGD
FT                   RSHTL"
FT   gene            108525..108716
FT                   /locus_tag="Lcho_0105"
FT   CDS_pept        108525..108716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32380"
FT                   /db_xref="GOA:B1Y633"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y633"
FT                   /protein_id="ACB32380.1"
FT                   /translation="MRWLLTLVFAFIVLNGLRGWLSRIGLGRVPGDIAFKVRGREWYFP
FT                   FGSTVLLSLIGWALARWI"
FT   gene            complement(108666..109925)
FT                   /locus_tag="Lcho_0106"
FT   CDS_pept        complement(108666..109925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0106"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   mpt:Mpe_A3298 tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32381"
FT                   /db_xref="GOA:B1Y634"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y634"
FT                   /protein_id="ACB32381.1"
FT                   /translation="MRCLLVGGAVRDQLLGRPVGDRDWVVVGATPEQMVAAGYLPVGRD
FT                   FPVFLHPRTHEEYALARTERKTAPGYHGFVFHTGADVSLDDDLARRDLTINAMALDEAG
FT                   TLIDPWGGRRDLAHKCLRHVGAAFAEDPVRILRLARFAARLGDFSVAPETLALCRRMVE
FT                   AGEVDALVPERVWQELSRGLMEARPSRMFEVLRDCGALARLLPEVERLFGVPQRADYHP
FT                   EVDTGVHLMMVLDTAAQRGVSLPVRYACLGHDLGKGTTPAHILPRHIGHEGRSAALLAP
FT                   MSARLKVPAACHELADLVAREHSNVHGSGNFDAAALVRLFDRCDAWRRPERFELALQAC
FT                   ECDARGRLGFEQAHYPQAPRLRQALAAARGIDAAAVMASARARGLNGPALGRALHEARI
FT                   EAVASDPACQRPADQAQQNG"
FT   gene            complement(109970..110695)
FT                   /locus_tag="Lcho_0107"
FT   CDS_pept        complement(109970..110695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0107"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   aav:Aave_4206 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32382"
FT                   /db_xref="GOA:B1Y635"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y635"
FT                   /protein_id="ACB32382.1"
FT                   /translation="MLQLYIGNKNYSSWSMRPWVLMTDAAIPFTEVKVRFDAFTPGSTF
FT                   KRTMGALVPTGKVPALVIDDGVDDGVAGSSGPQVVWDTLAIAETLAERHPDRQLWPADA
FT                   ARRALARSLCAEMHSGFGALRNACPMNIEARLPEIGARVLAEQPAVQADLARIVAMWTG
FT                   CLERFGGPWLFGERFGIADAYYAPVASRLRSYALPVPAPVADYIEHIHQRPSVAAWVAD
FT                   ALAEHDFLDFEEPYRTSRG"
FT   gene            complement(110723..112120)
FT                   /locus_tag="Lcho_0108"
FT   CDS_pept        complement(110723..112120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0108"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: pfo:Pfl_2004 two
FT                   component, sigma-54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32383"
FT                   /db_xref="GOA:B1Y636"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y636"
FT                   /protein_id="ACB32383.1"
FT                   /translation="MARAILIIEDEATLARNLAIYLERLGDEVRVAGRAEEGLALLEKF
FT                   RPDIVILDHNLPGMTGLEALSRIRAIDADAQVVMVTGYGSTELAVEAMKAGAADFLTKP
FT                   LVLGELKLLLERLTEQGKLANTVDYYAQRDAQDSGLDKIVGDSEPIRNLRQMLVSLLES
FT                   ESRLADRDPPAVLIVGETGTGKELVARALHYGGPRRTEPFVEINCGALPSQLIEAELFG
FT                   YEKGAFTDARQRKAGLVETAEHGTVFLDEIGETELGTQVKLLKLLEEKRMRRLGGLREQ
FT                   QVHARIISATNRPLDQMVRDGRFRADLFFRLRIVEIRVPPLRERGHDIVMLAEHYLNLH
FT                   GQRYRKAGLVLGEEARQALLQYSWPGNVRELRNVMEQAVLVVEGSEVGVRHLRLTGPVG
FT                   HGSELPIDDSDLHLERMERRLILRALERTRQNVSAAARLLGVSRDTLRYRLERLELRPG
FT                   ESGDAQT"
FT   gene            complement(112164..113549)
FT                   /locus_tag="Lcho_0109"
FT   CDS_pept        complement(112164..113549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0109"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: pen:PSEEN2417
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32384"
FT                   /db_xref="GOA:B1Y637"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y637"
FT                   /protein_id="ACB32384.1"
FT                   /translation="MRWLKLMRGDASGGFPLVRWFSLVSLLAVGVVSITMALVLARFLE
FT                   TRLLDHDASLSRDFVQNIVDTQNVSKGFLIGGETVREADFAEFFTHVAALPDVLRANVY
FT                   SLDRRVLWSSNAALIGRYFGRNDELEAALKGTLVWERGEVEDHTAVAKGEHVALGTRRA
FT                   SFVENYLPVYSSAGTNRTLIGVVELYRVPRTLNDTLRQGTLLVWVCSLLGGAVLYLSTL
FT                   GLVRKASRLMHEQRRRLVEADALALVGEIAAATAHSIRNPLASIRSTAELQREIGDMSP
FT                   EMANETILHVDRIERLVRTLLTYSRDAVEVLGDTELDHVLRATAEQFRPAFDSQNKHLV
FT                   LDWAGPLPAVRGDPVLLQQVLNSLLSNALEASGPQATVTVKAQADQDSVRVEVHDHGDG
FT                   IPAEHLANVFRPFYTTKPRGLGMGLALVKRVLDRLGGAVEIKSAPGQGTSVILQLPLAR
FT                   TPA"
FT   gene            complement(113673..114638)
FT                   /locus_tag="Lcho_0110"
FT   CDS_pept        complement(113673..114638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0110"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: mpt:Mpe_A3296
FT                   nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32385"
FT                   /db_xref="GOA:B1Y638"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y638"
FT                   /protein_id="ACB32385.1"
FT                   /translation="MNKVLVLGGTGFVGRAFAAAWVAAHGGTGAGLRIPSRRPARAKAL
FT                   AMLPTVELVEADVHDPAQLLALMAGCDAVVNLVAVLHGDARRFEQVHVTLPQRIAGACA
FT                   AAGVTRLVHVSALGVDDAADAPPAPSLYLRSKTQGEQVLRAAPGLALTLLRPSVIFGAE
FT                   DRFINLFAALQALAPVMPLAGAAARFQPVWVDDVAHAIVACLTDPRHIGRTFECAGPQV
FT                   LTLRELVQLAGRWSGHPRPVLPLPEWAGRLQAAALGLLPGEPLMSGDNLASMRVPNVAG
FT                   GRLPGLAELGIRAASLADVMGPWLGGGGQRTNQLRMLAGR"
FT   sig_peptide     complement(114582..114638)
FT                   /locus_tag="Lcho_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.882 at
FT                   residue 19"
FT   gene            complement(114704..116776)
FT                   /locus_tag="Lcho_0111"
FT   CDS_pept        complement(114704..116776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0111"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   mpt:Mpe_A3295 putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32386"
FT                   /db_xref="GOA:B1Y639"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y639"
FT                   /protein_id="ACB32386.1"
FT                   /translation="MKYLVSLFLGSCALLSPCAAQSPQAVDTAAPALVAEPIAPTGAAA
FT                   LAIRPIDQRLLDAREALRSRDRARLASARDALVAARHPLAMWADYWEIGLRLGEVGQDD
FT                   LEAFYARWPGTYVEDRLRNDWLLELGIRRDWARFGAELPRFRMADDRQVNCYAMLLRHQ
FT                   AGDDVRASARSSWLGQREPAAGCALMAGTLFEARRLSSADVWLKARISAEAGRPKLARE
FT                   ALALISETLADKPLTELWDQPLRYFNKHADAGHRQGAEMVVLALVRLATSDPQTAATLL
FT                   EDRWQAQLAPDAAAWTWAAIAKQAAWKRLPEADGWFQRALTVPQARDVDWSDDTLAWRA
FT                   RAALRATDAQRWERVLSAINAMTAPAQADPTWVYWKGRALMATAAAGTDGDARRTGAAV
FT                   LFERIAGGYNFYGKLAADALGRTQSLPPRPAALGADERRAAEQNPGLNRALMLIGLGLR
FT                   SEGVREWNFSVIGMNDRALLAAAQRACEREIWDRCIHTSERTRTEVDMAQRFPTPFRAE
FT                   VVAAAQEVGLDAAYIYGLIRQESRFITDVRSSAGAAGLMQLMPGTARWTARKLGVPYTA
FT                   DRITDRNLNLRLGAGYLKLVLDDFEGSQALATAAYNAGPSRSRRWREGPPIEVAAWAES
FT                   IPFNETRDYVKKVLSNASYYAALLGGQSVVNLKQRLGPPVTPRAETALTENRDLP"
FT   sig_peptide     complement(116699..116776)
FT                   /locus_tag="Lcho_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.636 at
FT                   residue 26"
FT   gene            complement(116889..117851)
FT                   /locus_tag="Lcho_0112"
FT   CDS_pept        complement(116889..117851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0112"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mpt:Mpe_A3294 LysR family
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32387"
FT                   /db_xref="GOA:B1Y640"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y640"
FT                   /protein_id="ACB32387.1"
FT                   /translation="MSTRNRPLSLQSLRAFEAVARRLSFRLAGEELFLTQSAISRQIKG
FT                   LEEELGAVVFQRDTRQVTLTAAGLTLQRAVQPLLERLDGAVRQIRSAGARPRVAITTFA
FT                   SFATLWLIPRLEAFQRRHPALDIRIAAHDTLHDMDDPDIDMALRYCHPDDAPPGALLLF
FT                   GEVLAPVVSPWYLERARRGEIAALDQPVDLAGHTLLEVEGLYLGSSPYRSWEHWLAARG
FT                   LQALQPRSWVHLNYDHQRVQAAQASQGVVLARLPLVADMLARGELVEPFGPAGRDAVPY
FT                   GYWLILASGAVQRPEVQQLRDWVAEQAAPVRQALGEHAP"
FT   gene            117947..118411
FT                   /locus_tag="Lcho_0113"
FT   CDS_pept        117947..118411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32388"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y641"
FT                   /protein_id="ACB32388.1"
FT                   /translation="MSIELWMRKTHESGDFSKAAGGSVSALQTHQWRVARAGVLQVQDG
FT                   PLWLTRDGDPDDHVLQPGDHLHLRAGERVTVGAWRPAQATAWQWRPDPVESVGQRFGRA
FT                   LVFLAAGALDRLARGLEGWAALARTAAASASRAHGCISAGDSMASSGALK"
FT   gene            complement(118240..118644)
FT                   /locus_tag="Lcho_0114"
FT   CDS_pept        complement(118240..118644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0114"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: afw:Anae109_0262
FT                   TfoX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32389"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y642"
FT                   /protein_id="ACB32389.1"
FT                   /translation="MAEELVNHVLELLAPLGRARSRRMFGGQGFYVDDLFIALIADGRL
FT                   YLKVDAQSRAVFESAGCEPFAYQRAGGERAVMSYFSAPDDAMESPALMQPWARLALAAA
FT                   VRARAAQPSRPRASRSSAPAARKTSARPKR"
FT   gene            118764..119354
FT                   /locus_tag="Lcho_0115"
FT   CDS_pept        118764..119354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0115"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   mpt:Mpe_A3291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32390"
FT                   /db_xref="GOA:B1Y643"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y643"
FT                   /protein_id="ACB32390.1"
FT                   /translation="MPSFKLPEPPRDKATLRKQLQAERMGMSDRHQRSVHLQEVLQVWL
FT                   LSRREKTIGAFWSIKGEFDALPALYRWSESDPARRIGLPVIDKKTKQLRFHVWYPGCPM
FT                   EEDAFGILKPKDTEEFHPELLLVPCVGFGPKGIRLGYGGGFYDRTLAQLKPMPYTAGVG
FT                   YSHGYIPWLEAESHDVPLDAMLTEDGAVWDRDA"
FT   gene            complement(119438..120034)
FT                   /locus_tag="Lcho_0116"
FT   CDS_pept        complement(119438..120034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0116"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: dac:Daci_4836 OmpW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32391"
FT                   /db_xref="GOA:B1Y644"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y644"
FT                   /protein_id="ACB32391.1"
FT                   /translation="MKKLCIALAVAALAPVAMAQSAGDIVVRARAVYLDAANKDTVAIT
FT                   DVSINSKWLPEVDFTYYVTPNFAAELILTYPQKQDVSSTAHGGFIGTLKHLPPTLTAQY
FT                   HVTGLGAIKPYVGAGVNYTRFSSVNLLNGALSVEKNSFGLAFQAGVDYAIDKQWSLNLD
FT                   VKKVQIRTDLSLGATNLGTLKVDPTLIGIGLGYKF"
FT   sig_peptide     complement(119975..120034)
FT                   /locus_tag="Lcho_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            complement(120284..121123)
FT                   /locus_tag="Lcho_0117"
FT   CDS_pept        complement(120284..121123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0117"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: aav:Aave_4058 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32392"
FT                   /db_xref="GOA:B1Y645"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y645"
FT                   /protein_id="ACB32392.1"
FT                   /translation="MTTTPSLPLSLEFFPPKTPEGVTKLAAARQALYALQPQFCSVTYG
FT                   AGGSTQDGTLATVQAILDEGWQGASHFTCIGATRESVRERLAQFKAMGMRRIVALRGDL
FT                   PSGYGAFGEFRYASDLVAFIRAETGDHFHIEVAAYPEMHPQARSPQADLQAYAAKVQAG
FT                   ADSAITQFFFNADAYWRFVDDAQALGARIPVVPGIMPITNSSGIIRFADGSGAEIPRWI
FT                   RLRLQSYGDDSASIKAFGLDVVTDLCERLRAGGVPALHFYTMNSSAAVLQICERLGL"
FT   gene            complement(121159..122067)
FT                   /locus_tag="Lcho_0118"
FT   CDS_pept        complement(121159..122067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0118"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   RNA-binding S4 domain protein; KEGG: mpt:Mpe_A3287 putative
FT                   hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32393"
FT                   /db_xref="GOA:B1Y646"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y646"
FT                   /protein_id="ACB32393.1"
FT                   /translation="MAPEDAAARRPPPPEGDQVDPATARIDLIPLEAAVVRRPDSLPAM
FT                   RIDQLILHKGLAPTRSAAQRLIERKAVRWLGPKGWTVPSKAGEDVPDEAQVEITDASEL
FT                   RFVSRGGLKLEGAIAKCGFDVRGRTCLDVGQSTGGFTDLLLDKGAVKVVGLDVGRDQLA
FT                   AKLRGDERVVCYEGINARDVAGSAFAAEWPEASFGFITADVSFISLTHVLPTLFSYLAP
FT                   GGDLLALVKPQFELQPAQIGKGGIVRNKAYFQDVETRVRQCCRDWPMKVHAYFQSPIEG
FT                   GNGNTEFFIWVRHPEPATPAA"
FT   gene            complement(122067..123500)
FT                   /locus_tag="Lcho_0119"
FT   CDS_pept        complement(122067..123500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0119"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: mpt:Mpe_A3286 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32394"
FT                   /db_xref="GOA:B1Y647"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y647"
FT                   /protein_id="ACB32394.1"
FT                   /translation="MNAAVKALHENDYLVADLSLAAWGRKEIRIAETEMPGLMAIREEF
FT                   AAKQPLKGARVTGSLHMTIQTAVLVETLQALGAQVRWASCNIFSTQDHAAAALAVQGTP
FT                   VFAYKGETLADYWDYTHRIFEFGAAGTDGEGPNMILDDGGDATLLMHLGKRAEKDLSLL
FT                   DNPKSEEETCLYAAIRAKLAVDPTWYSRKGAQIIGVTEETTTGVHRLKEMSAAGTLLFR
FT                   AINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVACVAGYGDVGKGSAQALRAL
FT                   SAQVWVTEIDPINALQAAMEGYKVVTMEYAADKADIFVTTTGNRDVIRHEHMAAMKDQA
FT                   IVCNIGHFDNEIDVASLEGYEWDEIKPQVDHIIFPDGKKIILLAKGRLVNLGCATGHPS
FT                   FVMSSSFANQTIAQIELFCHPDGYDVGKVYVLPKHLDEKVARLHLKKVGAMLTELTDDQ
FT                   AAYIGVPKNGPYKPDTYRY"
FT   gene            123915..124490
FT                   /locus_tag="Lcho_0120"
FT   CDS_pept        123915..124490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0120"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   pol:Bpro_3458 intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32395"
FT                   /db_xref="GOA:B1Y648"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039387"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y648"
FT                   /protein_id="ACB32395.1"
FT                   /translation="MPALWLGPRAQNTAGLRPTPSQTEGPFYPLQLPADSDFDLLRNGA
FT                   ARASRGEPAWVEGTVSDLRGRLLEGAVVEIWQCDADGHYHHPGDGGRADPAFQGFGRVT
FT                   VGADGRYRFRTLRPAPYSGRTPHIHFKVRHQGHELLTTQLYVQGDPGNERDGLWRRLRD
FT                   PRDRAALTVPFEPGVDGLRARFPIVVEA"
FT   gene            124582..125424
FT                   /locus_tag="Lcho_0121"
FT   CDS_pept        124582..125424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32396"
FT                   /db_xref="GOA:B1Y649"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y649"
FT                   /protein_id="ACB32396.1"
FT                   /translation="MSSNEFPAAAPDLTPAVSPAEAPMAETVTAETVTAGAPEAVVPEA
FT                   PQAEGATDAAAADAPVVASAPKVVIPDMSPAACAQQLKSRFPALFSGAPRPVKLRIQAD
FT                   IQARVPGVFTKQVLSAFLRRHTGTTAYLIALTKASQRFDLDGQPAGEVSDEHRQAANEE
FT                   LQRRRGVHDERRAAEDERRALEQQQWHNRAQLLRDFQVTTLTRANFCALKGVAEDQLDG
FT                   LLDIARREAAEWAANRPPVQEREQREPRDARGPRRDDHRGNNPRPAGNRPAGGRPPRR"
FT   gene            125496..126713
FT                   /locus_tag="Lcho_0122"
FT   CDS_pept        125496..126713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0122"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rme:Rmet_1820 phosphoribosylglycinamide
FT                   formyltransferase 2; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32397"
FT                   /db_xref="GOA:B1Y650"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y650"
FT                   /protein_id="ACB32397.1"
FT                   /translation="MKPLGTPLSPDATRVMLLGSGELGKEVLIALQRLGVETIAVDRYD
FT                   NAPGQQVAHQSHTIAMSDPAALRTLIEAERPDLVVPEIEAIATQTLEALEAEGVVRVIP
FT                   TARATRLTMDREGIRRLAAETLGLPTSPYRFCDSLAELQAAIDGADGQPAIGYPCIVKP
FT                   VMSSSGKGQSKIDGPADVQAAWDYAMVGGRVSNGRVIVEGFIDFDYEITQLTVRALGAD
FT                   GQVETHFCDPIGHVQVRGDYVESWQPHPMQPAALALSRHIARTVTDNLGGQGLFGVELF
FT                   VKGDLVWFSEVSPRPHDTGMVTMITQWQNEFELHARAILGLPVSTALKSPGASAVIYGG
FT                   VDAPGVVYDGVDEALRVPNSEIRLFGKPESFERRRMGVALVHDADVDVARTQAKLAAGK
FT                   VKARPA"
FT   gene            126766..126960
FT                   /locus_tag="Lcho_0123"
FT   CDS_pept        126766..126960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32398"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y651"
FT                   /protein_id="ACB32398.1"
FT                   /translation="MKALQSSLARDVLADPRACEQLRHFLSTPAPAAGTRASAPGPVIE
FT                   LRSGGRTQRFKPVVVPKAR"
FT   gene            126976..127782
FT                   /locus_tag="Lcho_0124"
FT   CDS_pept        126976..127782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32399"
FT                   /db_xref="GOA:B1Y6S1"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S1"
FT                   /protein_id="ACB32399.1"
FT                   /translation="MTLALPALLLLLACWPGWIARSCIRRVGGHAPDGATRPQAWTEAL
FT                   LWAAGLHAGLIGGSNVLGWPLLPAGELLQLLSPEPARQAGAWTALAAHGAGLAAYAAAV
FT                   LGLAAAGPWALRRLVSRFRLDRCASPLGPLLRPARAHWYYLLSGADFTADALPDLIAVT
FT                   TVVDVAGQPWVYKGVLDEYFVDPQGQLDRLILQQVVRRPLGVQAAPQTRPQDRFERIDG
FT                   DCVVLHHGEITTLQVDYVRLGRTTEQPPRLQPVDDLVDAFAPTQPV"
FT   gene            complement(127798..128880)
FT                   /locus_tag="Lcho_0125"
FT   CDS_pept        complement(127798..128880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32400"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S2"
FT                   /protein_id="ACB32400.1"
FT                   /translation="MTLRLEQLRRHALARSLFAPTTLPAALQRLGFVQADPLRAPAKAQ
FT                   DLTLRHRVRDYRAGELEQRYPRLGVEEDFFVNYGFVPRRVQALLQPRQARRAWDDDRWQ
FT                   QARAVQDFVRQRGVAHPREVDAQFDHGTVGNWFGGRSRASTELLDGMHYRGLLRVARRE
FT                   GGTRLYAVREATPEAADPLLALDTLTDLLLQTYAPLPAPSLSQLLGLLLGGGVPQWRHL
FT                   RAATLQRAQARWPGAEVDGLRWHWPVGEDPARSRRHSPERVCLLAPFDPVVWDRRRFEI
FT                   FWGWAYRFEAYVPAARRQRGHYALPLLWRDQVIGWANVKVQAGRLMPDMGYVDKRPAEV
FT                   AFGQALDEELDRLHHFLGLG"
FT   gene            complement(128926..130107)
FT                   /locus_tag="Lcho_0126"
FT   CDS_pept        complement(128926..130107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0126"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ajs:Ajs_0705 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32401"
FT                   /db_xref="GOA:B1Y6S3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y6S3"
FT                   /protein_id="ACB32401.1"
FT                   /translation="MANDFLFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAET
FT                   LTNTGLVVLAGEITTNAHVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSNDI
FT                   AQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPF
FT                   LRPDAKSQVTMRYVDGKPHSIDTIVLSTQHSPEQSLGDKMIPSFYEAIREELIKPVLPK
FT                   EWITAETQYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDR
FT                   SAAYAARYVAKNIVAAGLARQCQIQVAYAIGVARPMNITVYTEGTGVIPDAEIAKLVEA
FT                   HFDLRPKGIIQMLDLLRPIYQKTAAYGHFGREEPEFTWERTDKAQVLRAAAGL"
FT   gene            130351..131220
FT                   /locus_tag="Lcho_0127"
FT   CDS_pept        130351..131220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0127"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   mpt:Mpe_A3251 putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32402"
FT                   /db_xref="GOA:B1Y6S4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S4"
FT                   /protein_id="ACB32402.1"
FT                   /translation="MGGPLGWLAYWASPSYRRRMHDHVAQAGLAWPQARAAVASTGRMM
FT                   AELPWLWSRPPEARFGALVQWQGEAHVEAALAAGRGLVLMTPHAGAFEVIAQAYAERFG
FT                   HVQPMTALYRPARKAWLRDLVAGSRNRPGLLTAPATLSGVRQMIRALRNGGTIGLLPDQ
FT                   VPPEGMGVWAPFFGRPAYTMTLAARLVQQTGAAWLPVVCERLPDARGYVIRVDPPTEPM
FT                   PGTPGAPPVDTSTDPNAVAIAAATLVNRAMERLILGLPGQYLWGYHRYKNPRQAEAASD
FT                   APQAGGNP"
FT   gene            131217..132101
FT                   /locus_tag="Lcho_0128"
FT   CDS_pept        131217..132101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0128"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   mpt:Mpe_A3250 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32403"
FT                   /db_xref="GOA:B1Y6S5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S5"
FT                   /protein_id="ACB32403.1"
FT                   /translation="MSDFSANVLLGLLKLLQRLPLRLQAALGRGLGWLFWHLASARRKV
FT                   ALRNLALCLPELGEAERERIAREHFGWLGRSLLERGLLWYASPERLRSLIQVEGDVGLA
FT                   ERSARPVMWLVPHFLALDVAGTATQLFQTRRVGSIYQTQSNPVFDAAMRRGRLRFGGGE
FT                   VFPRSDSAKPLIRAIKRGDAFFNLPDMDFGARDAAFVPFFGVPAATLLAPSRMARALDM
FT                   VVQPVVAELLPGGEGYRVRFLPAWNDFPSADAEADTARMNRWIESEIRRNPAQYLWVHK
FT                   RFKTRPPGEPGFY"
FT   gene            132156..133049
FT                   /locus_tag="Lcho_0129"
FT   CDS_pept        132156..133049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0129"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: pol:Bpro_1058
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32404"
FT                   /db_xref="GOA:B1Y6S6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y6S6"
FT                   /protein_id="ACB32404.1"
FT                   /translation="MRLHFTKMQGAGNDFVVLDATRAPLALSAADYRFLGDRRFGVGAD
FT                   QILVVERSTTPGVDFRYRIFNGGSGDEVEQCGNGARCFARFVRDNGLSQQVRVKVETVN
FT                   SLIELHVEADGRVTVDMNQPIFEHALIPFDSAGLSARPHNGHGNGFELWPLQLPGASLP
FT                   SVDVAVLSMGNPHAVQRVHDVDTAPVAEIGPRVETHARFPRHVNAGFMQVMSRREVRLR
FT                   VFERGAGETLACGTGACAAVVAGIRLGWLDPEVDVQTRGGLLTIAWAGLGHPVLMTGPA
FT                   QTVFTGDIDLPTTSVQ"
FT   gene            133159..133839
FT                   /locus_tag="Lcho_0130"
FT   CDS_pept        133159..133839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0130"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   mpt:Mpe_A3244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32405"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S7"
FT                   /protein_id="ACB32405.1"
FT                   /translation="MTIQGITEGDIANYLANTPGFFERHAQLLASVELANPHGQRAVSL
FT                   QQRQMEMLRERIRGLERRIMDMIRHGQENAALTDRLHQWTRALMLVEDARDLPDMLVLD
FT                   LQEQFQIPQAALRLWDLAPAFAGAAFASDVSDEVRSFTAGLSTPYCGANAAFEPVHWLE
FT                   APQTVASLALIPIRRLASSPAFGLLVLASPDPTRYSAEMGTEFLVRLGEIASAALARLL
FT                   PRDE"
FT   gene            133836..134774
FT                   /locus_tag="Lcho_0131"
FT   CDS_pept        133836..134774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0131"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: mpt:Mpe_A3243 putative
FT                   site specific integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32406"
FT                   /db_xref="GOA:B1Y6S8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S8"
FT                   /protein_id="ACB32406.1"
FT                   /translation="MTSEAAPLGDTSIAFLQHLQVQRRLAPRTLTMYGAALLRLEHAAA
FT                   EQQLALTQVRPPHVRRWAAMLHGQGLGPRSIAIHLAAWRGLYRWLGREGQVSANPVDGL
FT                   RPPKAGRPLPKALAVDEAVVLADHHDPATDPLLDLRDHAMTELLYGCGLRAAELIGLDC
FT                   IAGPDAAGWIDLEGGDAQVLGKGSNRRIVPVGPPAVAAVQAWLAVRHQMARAGELALFV
FT                   SRRGTRLTDSQLRRRLAQRAQSAGLTSHVHPHMLRHSYASHLLQSSGDLRAVQELLGHA
FT                   QISTTQVYTRLDYQHLARIYDAAHPRARRKP"
FT   gene            complement(134806..136296)
FT                   /locus_tag="Lcho_0132"
FT   CDS_pept        complement(134806..136296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0132"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bpd:BURPS668_0884 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32407"
FT                   /db_xref="GOA:B1Y6S9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6S9"
FT                   /protein_id="ACB32407.1"
FT                   /translation="MYLGIDLGTSEVKFLLLDAAHHIVASVGEPLAVQRPQPLWSEQNP
FT                   AHWWAATDRALTRLAAEQPQAMRAVRAIGLSGQMHGAVLQDARGEVLRPAILWNDGRSG
FT                   AECAELEAALPTLHAITGNLAMPGFTAPKLLWVKQHEPELFARMRRVLLPKDWLREQLT
FT                   GEAVSEMSDASGTLWLDVAQRRWSAEVLAACGMDESQMPRLVEGSEVSGTLKPALAARW
FT                   GLTAGIPVAGGGGDNAASAVGIGAVRPGEGFVSLGTSGVIFLASDRFRPNPAHAMHAFC
FT                   HALPGRWHQMSVMLSAANGLRWVKNLLGAHSEAALLDTVAALTPLQRAQAPVFLPYLNG
FT                   ERTPHNNPHAQGVFFGLNNEHDAAALAYAVVEGVTFGLLDGWHSLGTAPGEVQSLSLVG
FT                   GGARSALWAQLLADAIGVPMVTRQGGEAGGALGAARLAWLADGARIEDVCLAPPVAAVF
FT                   EPDAARAAQLLPRHRRFRRLYAALREEFSATSATGAAG"
FT   gene            complement(136350..137297)
FT                   /locus_tag="Lcho_0133"
FT   CDS_pept        complement(136350..137297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0133"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: vei:Veis_3165 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32408"
FT                   /db_xref="GOA:B1Y6T0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T0"
FT                   /protein_id="ACB32408.1"
FT                   /translation="MPAKPARPRAVPRQLKPELEHDYARSPDLGYESPGDVGLIRCLEH
FT                   GFPTPLARWHYHDEYELHLITSTSGKVFVGDWIGQFQPGQLVLTGPRLPHNWVSMDVPE
FT                   GGVPLRDLVIQFPHEPLVRAAETIPELAELLPLLERARHGIEFFGISDRAQAHWQRVKA
FT                   SRGLRRFTEFCTFLCDLSACTDYRLLSNVQLQSVDDDHSLDQIDAVVMRLTDNLAQPIS
FT                   AADVAAELGMSESRFSRFFRRATGNTFTDFVNRVRINRACQLLMESDRLITHICYEVGF
FT                   NNVANFNRRFLEIKGMTPSEFRKQADNRFSGSSV"
FT   gene            complement(137319..138716)
FT                   /locus_tag="Lcho_0134"
FT   CDS_pept        complement(137319..138716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0134"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: vei:Veis_3167 mannitol
FT                   dehydrogenase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32409"
FT                   /db_xref="GOA:B1Y6T1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T1"
FT                   /protein_id="ACB32409.1"
FT                   /translation="MSSPQPFVMLHLGLGSFHRAHQAVYLHELQQTGDTSWVLAGGNTR
FT                   PDMADTIAALQSQGGAYTLETVTPQGQRTYTRIRSIRQVVSYTPDLAGLIALGADPATR
FT                   IISFTVTEAGYYLDAKNRLDLGFADLAGDLEAARKGKPGGTIYGALTAILRARMLAGAG
FT                   PVTLLNCDNLRHNGERSRSGLLQFIELTSQTGLLDWVKAHTTSPNAMVDRITPRPTPAV
FT                   RERVLAATGVDDAAALMGESFIQWVIEDDFIAGRPAFERVGVEMVKSVQAYEEAKIRLL
FT                   NATHSCIAWAGTLVGYTYIHEGTLDPVIRQMAYDYVTDDVIPVLSPSPLDLAAYRDVVL
FT                   DRFGNPAIADTNQRVAMDGFSKIPGFIAPTLRERLARNESIDSVAMLPALFLAYLQRWH
FT                   RGEIAYTYQDQAMDPAVAHAICEAADPVAAFCADAPLWGNLAGDARLVTAVRAAAERVA
FT                   RFVAEHR"
FT   gene            complement(138751..139803)
FT                   /locus_tag="Lcho_0135"
FT   CDS_pept        complement(138751..139803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0135"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_3168 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32410"
FT                   /db_xref="GOA:B1Y6T2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T2"
FT                   /protein_id="ACB32410.1"
FT                   /translation="MAYLELKGIEKFFGDLRAIKGIDLAINPGEFIVFVGPSGCGKSTL
FT                   LRLIAGLEHIDGGRLMLDGRDITDLPSSKRDLAMVFQSYALYPHMSVFENMSFALKLAG
FT                   VDPSVIKDKVERAAKILNLTQYLDRTPKALSGGQRQRVAIGRAIVRAPKVFLFDEPLSN
FT                   LDAALRGQTRVEIAKLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGVIEQVGTPLELY
FT                   DKPANQFVAQFIGTPQMNVVAADKLPQLEAVYGLPVPAGGFVGLRPEYVTLKTAGSGVV
FT                   QGTVELVEALGAETLIYVATDRGAQLVSRQSTRTNLRAGDSVGVDIDADAAHLFDAQGR
FT                   ISRPALAAAH"
FT   gene            complement(139830..140660)
FT                   /locus_tag="Lcho_0136"
FT   CDS_pept        complement(139830..140660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0136"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_3169
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32411"
FT                   /db_xref="GOA:B1Y6T3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T3"
FT                   /protein_id="ACB32411.1"
FT                   /translation="MARPSTFTPALAVRTLVAWLVTLILFFPLGWLLLTAFKTELQAIS
FT                   VPPLLVFTPTFENFHEVQERSDYLLYAKNSLITSVASTILGLLLAAPAAYSMAFFRGRH
FT                   TKDILMWMLSTKMMPAVGALMPIYVLSQWSGLLDSWVGLTIIFTLSNLPIMVWMLYSGY
FT                   KEIPPDILEAARMDGATLWQEARLVLLPLSMGGLASTGLLCLVLSWNEAFWSLTLTAAK
FT                   AGTLAALIASYSSPEGLFWAKLSAASLMAIAPIVVFGWFSQKQLVQGLTFGAVK"
FT   gene            complement(140669..141541)
FT                   /locus_tag="Lcho_0137"
FT   CDS_pept        complement(140669..141541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0137"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_3170
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32412"
FT                   /db_xref="GOA:B1Y6T4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T4"
FT                   /protein_id="ACB32412.1"
FT                   /translation="MQSAAPRFIPRLLMAPAVTTLFLWMIVPLVMTIYFSVIRYNLMQP
FT                   ENVGFIGLENFEYFVTDPSFGTAVMNTLLLLGSVILITVLMGIAIALLIDAPFPGRGLV
FT                   RILLISPFFVMPTVNALLWKHMMMNPIYGVLAQVWIFFGATPVDWLTDWPLLSVIIMVA
FT                   WQWLPFATLIFITALQSMDREQLEAARMDGANYGQQLRYLYIPHLGRSVAVVVMIEMIF
FT                   LLSVFAEIYTTTGGGPGDASTNVAFLIFKQALLNFDAGVASAGALFAVLLANIAAIFLI
FT                   RLVGKNLDK"
FT   gene            complement(141654..142958)
FT                   /locus_tag="Lcho_0138"
FT   CDS_pept        complement(141654..142958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0138"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vei:Veis_3171 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32413"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T5"
FT                   /protein_id="ACB32413.1"
FT                   /translation="MKLKASLALAFGLMAGMAHAATELVIATVNNGHMIEMQKLGKNFE
FT                   AANPDIKLKWVTLEEGVLRQRVTTDIATKGGQFDVMTIGMYETPIWGKKGWLQELKTDA
FT                   KYDADDILPAMRNGLSVDGKMYAAPFYGESSMLMYRKDLADKVGVTIPDRPTWAQVKDL
FT                   AAKIHDPKNGVYGICLRGKPGWGDNMAFLSTLVNTHGGQWFDMGWKPQLESKPWKDAIT
FT                   YYVDLLKNYGPPGSSANSFNEILALYNEGKCGMWIDATIAASFISDPKQSKVADKVAFA
FT                   QAPTMVTPKGANWLWAWALAVPSGSKKVDAAQKFVSWATSKEYIELVAKTNGWAAVPTG
FT                   TRKSTYASAEFQKAARFAAAEKMAIDSANPNDSTLPKSPYVGVQFAAIPEFQAIGIAVG
FT                   QQMSSALAGKTTVDAALKASQVAAEREMKKAGYYK"
FT   sig_peptide     complement(142896..142958)
FT                   /locus_tag="Lcho_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            143174..144367
FT                   /locus_tag="Lcho_0139"
FT   CDS_pept        143174..144367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0139"
FT                   /product="PUA domain containing protein"
FT                   /note="SMART: PUA domain containing protein; KEGG:
FT                   mpt:Mpe_A3242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32414"
FT                   /db_xref="GOA:B1Y6T6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T6"
FT                   /protein_id="ACB32414.1"
FT                   /translation="MKTIRLRSGKERSLQRKHPWVFEGSIASGKADAGETVRVEAADGR
FT                   FLAWASYSPSSMIRVRAWSWDEAERIDAAFIARRVQAAVAMRARLGLASDGVRLIHGEA
FT                   DGLPGLVVDRYADILSAQFLSAGAERWKGVIADALLAATGCTRLYERSDASVRKLEGLE
FT                   PATGWLRGGSEKEGSTEVTITEHDWRLTLDVAEGHKTGYYLDQRDNRALFARLVRQFGI
FT                   RRVLNCYSYTGGFSVAALAGGASEVVSVDSSGPALARASAHVTLNGFDAARHTALDADV
FT                   NATLRQLLAEGRTFDAIVLDPPKFAPTPASAERAARAYKDINRLALKLLVPGGLLLTFS
FT                   CSGGISADLFHKIVAGAGMDADVDGYLLQRLEAASDHPTTICFPEGEYLKGLVVLRR"
FT   gene            144486..144839
FT                   /locus_tag="Lcho_0140"
FT   CDS_pept        144486..144839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32415"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T7"
FT                   /protein_id="ACB32415.1"
FT                   /translation="MLRKFLFLFLLTSVFWQAIGVAGKGTLVSGQADLAHAALHWQEAS
FT                   HHHHDDGSYGFDDSKASAKHLTADGVVASPALVQSTSLAVAAYGAARPPMTDDAASTPP
FT                   YLERLRRPPRLSA"
FT   sig_peptide     144486..144548
FT                   /locus_tag="Lcho_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.370 at
FT                   residue 21"
FT   gene            144947..146185
FT                   /locus_tag="Lcho_0141"
FT   CDS_pept        144947..146185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0141"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dac:Daci_1739 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32416"
FT                   /db_xref="GOA:B1Y6T8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T8"
FT                   /protein_id="ACB32416.1"
FT                   /translation="MSLPTRIIACGVLAGVLLGAQLAAAQTPAPQPATTLADAVRAAWR
FT                   RSVHATEVAGQQRRAQAERTAASAPWAEPPSVELDYRTDRLQTDAGSRETELGVAIPLW
FT                   LPGQRAARRASAEAEESAANAAQAAGELQAAALVREAAWGLTRQQAEVDLAAQQVQVLD
FT                   ALASDVERRVAAGDLARVDALAARAELLAATAGLSQARQALHAAVIQWSALTGYASAPE
FT                   DLQAEQAPADATLGDAHPALRAARLGIELGRKRLDAVQASSRSAPEFVARLRQDRSARG
FT                   EPAANSIGVGLRIPLGTDDRNAPLQAAALNELAAAQATEQQLKVQLQAEVDQARAAALA
FT                   AEQQLAHESERSKLMRERASLIERSFRAGETPLPELLRALSDAARAEADLHRQSAALGL
FT                   ARARLQQALGILP"
FT   sig_peptide     144947..145024
FT                   /locus_tag="Lcho_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 26"
FT   gene            146182..146805
FT                   /locus_tag="Lcho_0142"
FT   CDS_pept        146182..146805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32417"
FT                   /db_xref="GOA:B1Y6T9"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6T9"
FT                   /protein_id="ACB32417.1"
FT                   /translation="MKPSLSFVRQGLLALALAISFPPLHAGPGAHGPNGEHLDSPAPAT
FT                   ARSSTSPRFETRTEAFEMVGRLEGGELTLFINRFETNEPVLDAQVELESGALKVKAPFL
FT                   ADHGTYSVADAAFLKALAEPGQHPLVITVVAGNDADLLEATLTGAGATAVAVADRGHDD
FT                   PHGQAATPWRSVTIGLGAVAAVAAIGWFAIRRRSAGKTSMGASL"
FT   sig_peptide     146182..146262
FT                   /locus_tag="Lcho_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            146802..147908
FT                   /locus_tag="Lcho_0143"
FT   CDS_pept        146802..147908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0143"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: dac:Daci_1741 conserved hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32418"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U0"
FT                   /protein_id="ACB32418.1"
FT                   /translation="MKIILTLLSLALVATAHAGPGAHGPNGEHLDTPSVSTPDGLARLP
FT                   DGSVNVPMLAQRRLGLRTLLAVESDAAATVELPARVVMDPNSAGRVQTLIGGKVEPGPK
FT                   GLPIAGQRVRRGDVLGYVAHHVDPLAAASQQAQLVELRSSRQLAEQRVQRLQSLEGTVP
FT                   RKEIDAAKLELDSYTARENAIGASLGSKERLVAPVSGVIARADVVNGQVVESKDVLFEV
FT                   IDPARMLIEASVADVKLSTQLAGATLAGIADWKLQFLGAAGALRDGTLPLTFKATGTGA
FT                   TPLALGQPVTVVAALTNKVKGIVLPAQAVTRNSANETVVWIKAGAERYIPQPVQVRPLD
FT                   AQTVVITQGLGADNRVVVQGAPLIAQIR"
FT   sig_peptide     146802..146858
FT                   /locus_tag="Lcho_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 19"
FT   gene            147928..151071
FT                   /locus_tag="Lcho_0144"
FT   CDS_pept        147928..151071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0144"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: dac:Daci_1742 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32419"
FT                   /db_xref="GOA:B1Y6U1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U1"
FT                   /protein_id="ACB32419.1"
FT                   /translation="MFNWIVRYSLHNRLLVLAFAAILMVYGAMTALRTPVDVFPDLNKP
FT                   LVTVLTEAGGMAPEEVEQLVTFPLETALNGMPGVTRVRSTSGVGLAVVYAEFDWGTDIY
FT                   RNRQLVAERLALVREQLPAGINPSMGPVSSIMGEVMLLALPLDGGKDGARATPMQAREY
FT                   ADFVLRPRLLSIPGVSQVIPIGGDVRQLRVEPDTARMAQFGVSLSQIESALQGFSSNAG
FT                   GGFIDLNSREYLIRHIGRTNRVEDLQGLAVAWSGGRAILLEQVASVRYAAGQKRGDGGY
FT                   NGVPAVVVSIQKQPAADTVRLTRDIESALDELKQGRPAGLSEPRVLFRQADFILASVGN
FT                   VSEALRDGAVMVAIVLFAFLLSARTTLISLVAIPLSLAVTALILKLMGQSINVMTLGGL
FT                   AIAIGELVDDAVVDVENILRRLKQNRALARPLPLLEVVRQASVEVRSGIVYATIIVALV
FT                   FVPLFALPGIEGRLFTPLGIAYIVSILASMFVSMTVTPVLCSYLLPRMKRLGHGDSPVV
FT                   ARLKRLDERLLNWSFARARLLMSLAVMAVVVAATTVPYFPRAFLPPFNEGSLVLGMVFN
FT                   PGTSLAEANRMGSLAETLIQEVPEVTQVGRRTGRAELDEHAEGVHSAEIDVDLKRSDRN
FT                   REQIMAHLRAKLAVLPAQVAIGQPISHRLDHLLSGVRAQIALKVFGDDTDTLRGLAEQL
FT                   RQGLVSVPGLVDLTVEKQVLIPQITVRIDHRKAAQAGLSPGEAIRVLQALTDGAHGAQI
FT                   VDGARRYDLVLRLPDAARSPQDLARTLIDTPAGRLPVSAIASVEENDGPNQIGRENGRR
FT                   RIVVYANTDGSDMSRIVADVRAVIASTPMPQATFVSLEGQFQAQEQATQLIVGLSLVSL
FT                   LLVALVLYSRYKSMVLAGIIMANIPLALIGSVVAMWIAGVSLSVASMVGFITLAGISTR
FT                   NGILKVSHYVNLCRLEGEQFGPAMVVRGSLERLTPVLMTALVAAFALTPLLLSADAPGK
FT                   EILHPVAVVIFGGLVSSTLLDTLLTPVLYLKFGRKATERLLEQEQQPGTTTQGPQEAY"
FT   sig_peptide     147928..148020
FT                   /locus_tag="Lcho_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.477 at
FT                   residue 31"
FT   gene            151151..151522
FT                   /locus_tag="Lcho_0145"
FT   CDS_pept        151151..151522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32420"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U2"
FT                   /protein_id="ACB32420.1"
FT                   /translation="MKKVLIAAALSLMAVGFNAQAHGNDKAQHGGVVQAAGDMSFELVA
FT                   QGDGALLYIGDHGSPMDASQFTGKLTVLNGAEKTEAELKPAGGNKLSAGPVKLGKGAKA
FT                   VATVTLPSSKTLTVRFSVK"
FT   sig_peptide     151151..151216
FT                   /locus_tag="Lcho_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 22"
FT   gene            151677..152081
FT                   /locus_tag="Lcho_0146"
FT   CDS_pept        151677..152081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_1251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32421"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U3"
FT                   /protein_id="ACB32421.1"
FT                   /translation="MRTLRLNHRQLRPIAWVTLMVWLFAFTAGVVNACALTLAGAAGDS
FT                   SGHVYAESVVRQGHHEDAGKAGCLKLCDDGSSAIAKVKLPVVDLGSILLTLVEPWNAIA
FT                   ATTGAGIRQSLERPASHGPPLVIRFLRLTL"
FT   sig_peptide     151677..151778
FT                   /locus_tag="Lcho_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 34"
FT   gene            152223..152666
FT                   /locus_tag="Lcho_0147"
FT   CDS_pept        152223..152666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32422"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U4"
FT                   /protein_id="ACB32422.1"
FT                   /translation="MSSFKTLVALSALALVTACAAPGGPGAASSAKADEHAGHHPDAAP
FT                   TAPAATMPAMQDRMKAMREMHDKMMNAKTPAERQALMDEHMKTMQDGMAMMKGMGGMGA
FT                   MGDGKGMPADMAKRQQMMEGRMEMMQTMMEMMMQRLPNPPAAK"
FT   sig_peptide     152223..152324
FT                   /locus_tag="Lcho_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.319 at
FT                   residue 34"
FT   gene            152768..154960
FT                   /locus_tag="Lcho_0148"
FT   CDS_pept        152768..154960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0148"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: pol:Bpro_1178 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32423"
FT                   /db_xref="GOA:B1Y6U5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U5"
FT                   /protein_id="ACB32423.1"
FT                   /translation="MDTKTHAGHVGHLQPASSAATPAVDAPAGTIYTCPMHPEIRQDQP
FT                   GNCPKCGMTLEPVIPDLDETENPELADFKRRFWWTLPLTVIVTVLAMFGHRFGWFDMAR
FT                   QSWIELALTLPIVLWAGAPFFVRGVRSIAHRSPNMWTLIGLGTGAAFVYSVVATVAPQV
FT                   FPASFVSMGRVAVYFEAAAVIISLTLLGQILELKARSQTSAAIRSLLGLAPKTARRIAA
FT                   DGSESDVPLAHVHVGDRLRVRPGEKVPVDGVVIEGSSALDESMLTGEPLPVTKRVGDKL
FT                   IGATLNTSGALVMRSEHVGSATVLAQIVQMVAMAQRSRAPMQRMADTVAGYFVVGVVGV
FT                   AVLTFFGWGLFGPEPSWVYGLINAVAVLIIACPCALGLATPMSIMVATGLGATHGVLFR
FT                   DAAAIENLRRIDTLIVDKTGTLTEGRPSFERAVGTAGYTDDEVLWLAASLDQGSEHPLA
FT                   AAIVAAARQRGLALDKPEQFDSESGIGVRGRVGGQALALGNTALMAQLGVDVSPLATQA
FT                   EALRSQGASVMHLAVDARLAGLLAVSDPIKATSAEALASLRAAGLRVVMATGDGLTTAR
FT                   AVGQRLGLTEIHGEVKPADKLRLVEQLQAEGRRVAMAGDGINDAPALARADVGIAMGTG
FT                   TDVAMNSAQLTLVKGDLRGIATARALSVATVANMKQNLAFAFVYNALGVPLAAGVLFPF
FT                   TGWLLSPMIAALAMSLSSASVITNALRLRRAALRQD"
FT   gene            complement(154994..155707)
FT                   /locus_tag="Lcho_0149"
FT   CDS_pept        complement(154994..155707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0149"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: pol:Bpro_4103 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32424"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U6"
FT                   /protein_id="ACB32424.1"
FT                   /translation="MRHPNLTDRALLAALAALLGAMPAAAQVGPAEAEIAAYARSAETA
FT                   LHAAAQRGDLPALRALLARPDAAVRIKARDGHGRTALHVATFARQREAIRLLAGAGTDL
FT                   GALENDRYDAVTIAAVADDETTLRVLLELGASAKLVTSRYDGTALIAAAHLGHDGVVRQ
FT                   LIAAGAPLDHVNNLHWTALIEAVVLGDGGPRHQATVRALVEAGADRSLKDRHGRTALEL
FT                   ARERGYAELVRLLGA"
FT   sig_peptide     complement(155627..155707)
FT                   /locus_tag="Lcho_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.953 at
FT                   residue 27"
FT   gene            complement(155763..156281)
FT                   /locus_tag="Lcho_0150"
FT   CDS_pept        complement(155763..156281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0150"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   dac:Daci_1203 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32425"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U7"
FT                   /protein_id="ACB32425.1"
FT                   /translation="MSLRTPVLVLATLAALGSTSLAAQAQSAAAPAVRTERNIGLELAN
FT                   QIAAGAVASCSAAGYNVTATVVDRAGGVRAVQRADNAGAHTLEASRLKAYTSASAKNAT
FT                   LAMMEGAQKNPAAANLVHIPGFLLLGGGVPVKVGNEVIGAVGVGGAPGGHLDEQCAVAA
FT                   LDKVKDQLK"
FT   sig_peptide     complement(156204..156281)
FT                   /locus_tag="Lcho_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 26"
FT   gene            156582..156905
FT                   /locus_tag="Lcho_0151"
FT   CDS_pept        156582..156905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0151"
FT                   /product="flagellar transcriptional activator"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   mpt:Mpe_A2869 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32426"
FT                   /db_xref="GOA:B1Y6U8"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U8"
FT                   /protein_id="ACB32426.1"
FT                   /translation="MNTEQILAEIREANLSYLMLAQSLIRADREQALFRLGISEESAAI
FT                   LDTLSPSQIMKIASSNTLLCRMRVDDDLVWGLLTNHGKSAANDGISRLHASILMAGRHH
FT                   EAA"
FT   gene            156940..157476
FT                   /locus_tag="Lcho_0152"
FT   CDS_pept        156940..157476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0152"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="PFAM: flagellar transcriptional activator FlhC;
FT                   KEGG: mpt:Mpe_A2870 transcriptional activator FlhC"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32427"
FT                   /db_xref="GOA:B1Y6U9"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6U9"
FT                   /protein_id="ACB32427.1"
FT                   /translation="MRAKSILTEAKQIDRAVTLIKLGARLQVLESETDLSYERLLRLYK
FT                   EVAGKSPSKGQLPFSTDWFMTWQPNIHASLFLNTHEYLNKVAEMDEIDTVIKAYQLYLE
FT                   QTQSQGLEPLLSVTRAWRLVKFVDNGMLTMTACSKCGGHFVTHPHEIAKHYVCGLCNPP
FT                   ARAGKGKASGGLQLH"
FT   gene            157652..158707
FT                   /locus_tag="Lcho_0153"
FT   CDS_pept        157652..158707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0153"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: aav:Aave_0260 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32428"
FT                   /db_xref="GOA:B1Y6V0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V0"
FT                   /protein_id="ACB32428.1"
FT                   /translation="MTHALVEPARVSADEPDAQVRVAVVGVGAIGGVFAGWLGSRLPAG
FT                   RIRLSALARGDTLRALQAQGLVLQEAAGPVHVPLHASDDPAALGPQDLVILAVKGPALA
FT                   AVAPAVRALLAPHTTVLVAMNGVPWWFFDGLPGSCEGLALDTVDPGGVIAAAIPGRHVL
FT                   GCVVHVSASAPGPGEVANVRHNSLIIGEPAGGLSPRVDATAALLAEAGFAVTRSERIQH
FT                   DIWFKLWGNMTMNPVSALTGVTCDRILDDPLVRAFCSAVMTEAQAIGRHIGCDIDQQPD
FT                   DRHAITRGLGAFKTSMLQDLEAGRALEIDGLVGAVREIGQHLGLHTPHTDALLGLVRLM
FT                   AQGRGLYPVRT"
FT   gene            159054..160397
FT                   /locus_tag="Lcho_0154"
FT   CDS_pept        159054..160397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0154"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="PFAM: flavin-containing monooxygenase FMO; KEGG:
FT                   mlo:mlr7328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32429"
FT                   /db_xref="GOA:B1Y6V1"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V1"
FT                   /protein_id="ACB32429.1"
FT                   /translation="MNKRVAVIGAGPSGLAQLRAFQSAAAKGAEIPEVVCFEKQGNWGG
FT                   LWNYTWRTGLDQYGEQVHCSMYRYLWSNGPKEGLEFADYSFDEHFGRPIASYPPRAVLF
FT                   DYIEGRVKKAGVRDWIRFNTAVRQVTFDAESAQFTVTVHDLVNDRTYSELFDYVVVASG
FT                   HFSTPNVPSFAGFEGFNGRVLHAHDFRDAREFAGKDVLLIGTSYSAEDIGSQCWKYGAR
FT                   SITISHRTKPMGFNWPDNWSEVPLLERVDGHTALFRDGSSKHIDAIILCTGYVHHFPFL
FT                   GDDLRLKTSNRLWPLGLYNGVVWEKNPQLFYVGMQDQWYTFNMFDAQAWYARDVMLGRL
FT                   PLPDLATMQAESADWRKREEALADDYAAIRYQSEYTAGLAALTDYPPLNIEGMNEAFFQ
FT                   WKKHKKEDIMGFRNNSYRSAITGTISPPHHTPWKDALDDSLESYLGKP"
FT   sig_peptide     159054..159131
FT                   /locus_tag="Lcho_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.203 at
FT                   residue 26"
FT   gene            complement(160551..162923)
FT                   /locus_tag="Lcho_0155"
FT   CDS_pept        complement(160551..162923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0155"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   pmy:Pmen_3460 glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32430"
FT                   /db_xref="GOA:B1Y6V2"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V2"
FT                   /protein_id="ACB32430.1"
FT                   /translation="MGLPSDAAMPGRRPVVTRAREPSLFARTPSLERYKVAGGGLTVIA
FT                   LAAGDQLEVIDPEGLQACELQVWDAQGREALAALGLRSSPGAVAIATMLQRDSASVRPV
FT                   RTGLQRRGIDLAALPSACQLWPADGLAGQRQRCTATDDVLVVVAAPGPSGSVHAQDAPT
FT                   PLALHVHRHATRILQAVPLPAPLGEVVDEFTIAPGTARSYTVSPGQYIQVIDVAGRQCS
FT                   DFVAFNRRALERGIEQELDPTVTRTLSGRAYPGPGLHSRFFDRQMQPVLEVVQDTVGRH
FT                   DTFGLACAARYYESMGYFGHANCSDNLSAALAAYGVQARPGWPAINFFYNTGVDAHDQL
FT                   TMDEPWSRPGDHVLLRALDEMVCANTSCPDDIDPANGWMPTDIHIRIYAAQERFSMAIA
FT                   HRATPDAEPVLTRESGFHPATSALTRQFTEYRGWWTPSRYDGHGAIEEYHACRERVAVM
FT                   DLSALRKFEVIGPDAEALMQHCLTRDIKKLAVGQVVYSAMCYPHGGMLDDGTLLRLGPD
FT                   NFRWICGEDYAGIWLREQAQKLGMKVWIKSASDHIHNIAVQGPRSRELLSQMVSSPGTQ
FT                   PTLDKLGWFRFLVGRLDDHNGCPIMVSRTGYTGELGYEVWCHPSDAPRVWARIWELGAP
FT                   LGLTPLGLEALDTLRIEAGLVFAGYEFCDQTDPFEAGIGFCVPLKSKTDDFIGRDALIE
FT                   RAAHPQRKLVGLVLDGNETAAHGDGVYIGHAQVGVITSATRSPLTGQNIALCRISVTSA
FT                   APGTRVEVGKLDGHQKRLPASVGPAIFYDPDKSRVRA"
FT   gene            complement(162923..163261)
FT                   /locus_tag="Lcho_0156"
FT   CDS_pept        complement(162923..163261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0156"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mpt:Mpe_A0171 nitrogen regulatory protein P-II-2"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32431"
FT                   /db_xref="GOA:B1Y6V3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V3"
FT                   /protein_id="ACB32431.1"
FT                   /translation="MKLVTAIIKPFKLDEVRQALSDIGTQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIRIEAAVEDSVLARVIEAIETSARTGKIGDGKIFVTTLEEVIRIRT
FT                   GETGKEAL"
FT   gene            complement(163308..164651)
FT                   /locus_tag="Lcho_0157"
FT   CDS_pept        complement(163308..164651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0157"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: mfa:Mfla_0434 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32432"
FT                   /db_xref="GOA:B1Y6V4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V4"
FT                   /protein_id="ACB32432.1"
FT                   /translation="MKLFQALRWLAPAALSVSPTALWAEEATAAATAVAAVAAPVLSAG
FT                   DTAFIFACCIAVWLMTIPGLALFYGGLARTKNVLSILMQVFTVSSLITVLWALYGYTLT
FT                   FTDGGSAQSFIGGLDKLFMKGVGADALQGTIPELLYFFFMLLFAAITPTIIVGAFAERI
FT                   KFSAVLVFMAIWFTINYVPMAHMGWGGGWVFKLGAQDFAGGNVVHVNVGIAALVGAWMV
FT                   GARKGAGTGAMSPHNMTMTMTGGSMLWVGWLAFCGGCALAANGFAMLVVVNTMLAAAAG
FT                   AMSWVLVEWLHRGRPSMLGAVSGAIAGLVAITPACGFVGPMGALAIGVIVSPICIWAVE
FT                   KLKPMIGLDDSFDVFGVHGVGGIVGGILTTIFAMPSLGGLGFAEGRDFGSQMQVQLMVI
FT                   GFSVVYSAISSWIAFKLTSIVCRGLRVDEDEEDEGLDLISHGEPGYKY"
FT   sig_peptide     complement(164577..164651)
FT                   /locus_tag="Lcho_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(164806..166515)
FT                   /locus_tag="Lcho_0158"
FT   CDS_pept        complement(164806..166515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0158"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   pol:Bpro_5295 electron-transferring-flavoprotein
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32433"
FT                   /db_xref="GOA:B1Y6V5"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V5"
FT                   /protein_id="ACB32433.1"
FT                   /translation="MESTLSAQALIEQFGPREAMEYDVVVVGAGPAGLATAIRLKQLAA
FT                   DKGREVSVCVLEKGSEPGAHILSGAVMDPIALAELFPDWKARGAPLNQPVTGDDLLILS
FT                   ETGARRTPDWLMPRNFHNHGCHVVRLGAVAKWLGEQAEALGVEIFPGFAAAEVLYNDDG
FT                   SVKGVATGHLGLGKDGQPTDGFQLGMELHAKYTVFAEGARGHLGKQLIARFQLDAGRDP
FT                   QSYSIGIKELWEIDPAKAQPGRVVHTAGWPIADDTFGGGFLYHLEDNKVTLGFVVGLDY
FT                   QNPWMSPFEEMQRWKSHPAIRAHIEGGKRIGYGARAINNGSPQALPKTVFPGGALVGCD
FT                   AGYMNAARIKGSHAAIKSGMLCAEAVFEALAAGRAHDELSAYPQAFEASWLHEELQQSR
FT                   NFKLWFKKGPLMGQLMTGVEQWLMPKLGIASPPWTLHRDQADHTALKPAAQMPPISYPK
FT                   PDGKLTFDRLSSVFVSSTNHEENQPAHLTLKDPGVPVAINLATYAGPESRYCPAGVYEF
FT                   IQSDDGNGQMSERLQINAQNCVHCKTCDIKDPTQNIVWITPEGGGGPNYAGM"
FT   gene            complement(166535..167347)
FT                   /locus_tag="Lcho_0159"
FT   CDS_pept        complement(166535..167347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0159"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase; KEGG:
FT                   azo:azo3002 conserved hypothetical formylglutamte
FT                   amindohyrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32434"
FT                   /db_xref="GOA:B1Y6V6"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V6"
FT                   /protein_id="ACB32434.1"
FT                   /translation="MNTETAIYSLSQGTLPLLISIPHLGTELPPEFEADMRDPAPLKQD
FT                   TDWHLDHLYGFAASLGASILKAKVSRYVIDLNRPPSGESLYPGQTTTGLCPTETFRGEP
FT                   LYGRDGWPDAAEQARRLSGYWQPYHDALRAELDRLKAAHGAVLLWDAHSIASVLPRLFD
FT                   GKLPDLNFGTASGSSCTPAIIDSVVELARASSFSHVLNGRFKGGYITRHYGSPDDGIHA
FT                   IQLEMGQDLYMREEPPFTYLEHKATTVQPLLQKMLLAALDSLARTTTA"
FT   gene            complement(167344..168375)
FT                   /locus_tag="Lcho_0160"
FT   CDS_pept        complement(167344..168375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0160"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reh:H16_B2188 transcriptional
FT                   regulator, LysR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32435"
FT                   /db_xref="GOA:B1Y6V7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V7"
FT                   /protein_id="ACB32435.1"
FT                   /translation="MPPSAPGSRNTRNARRSRRLPDLHSLEAFVAVCDSGSMVMAAQLL
FT                   GLSQSAISQSIKALETELELQLFDREVRPAVTTHAGRALRERATELLTQARAMVDQVRA
FT                   TARHEHTHIHLGCVDSFAATVGPRLIRAMSGSAQQILMWSGLTPMLIEQLRGRELDFAI
FT                   CTDAAIDDPRIVPRLLCSESWVAVFPRAHPVRSLQSARELAELPGSLPLIRYSQRSVIG
FT                   QQVERFLRHVGVQAPRSYEFDATDPLLSLVASGLGWALSTPLCLWQSRQYLDDVTVLPL
FT                   PPTRLGQRHFHLLSREDEWAGLDQRIARVTRDVIRQETGPAIRLRMPALPADALFCPDE
FT                   ETS"
FT   gene            168525..169709
FT                   /locus_tag="Lcho_0161"
FT   CDS_pept        168525..169709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0161"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reh:H16_B2189 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32436"
FT                   /db_xref="GOA:B1Y6V8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V8"
FT                   /protein_id="ACB32436.1"
FT                   /translation="MQSFDAIVIGAGVIGSSVAYHLARLGAQKVLVLDRLQIGSGTSTQ
FT                   SSGILRTHYSVIENVELAKRSWSVFNDFAGYLGDEEMSAGLVKCGYLICSPDGPKLAPL
FT                   RAALEGQRSMGIEVQLIDAAAAREMLPIAHFDDAALIGYEPEAGFADAYLVATGFARAA
FT                   RRLGVKIMEGVNVERLLMDGGRVVGVETSQGTFLSPTVISTQNIWAGDIERWTGVPTPV
FT                   KAERHAVLALEGPEAYSFKMPVFKDLGSPGMLYCRSYGGNQMLVSEGTVGETLAQPDNE
FT                   QGDISMDYVVEVGAQVAERFPSFGEAGLASSWTGVYDVTPDWNPVLGRLPDVPGLIVGY
FT                   GFSGHGFKLSPGVGRVLAQEALGLPTDVSLAPYAHERFRSGHLLSGKYGLGAVS"
FT   gene            169726..170487
FT                   /locus_tag="Lcho_0162"
FT   CDS_pept        169726..170487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0162"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: azo:azo3005 probable electron
FT                   transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32437"
FT                   /db_xref="GOA:B1Y6V9"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6V9"
FT                   /protein_id="ACB32437.1"
FT                   /translation="MHILVPVKRVVDYNVKVRVKSDGSALDIGGVKMSMNPFDEVAVEQ
FT                   AVRLREAGLATRVTVVACGAAICQDVLRTALAMGADAAVLLETETASPAGPALLDALTE
FT                   LVRRDGIGLVLCGKQAIDDDLGDTAPMLAALLDWPQAISVNRLEIDGASLRVSCDGDQG
FT                   LELWSLPLPAVLGVDLRLCDPRSITLPNMMKAKKAVITRLPLAAPAEGGAERCSVLGFA
FT                   TPPDRPAGVRVPDVQGLIDHLRQLPALTPTA"
FT   gene            170499..171452
FT                   /locus_tag="Lcho_0163"
FT   CDS_pept        170499..171452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0163"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: azo:azo3006 probable electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32438"
FT                   /db_xref="GOA:B1Y6W0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W0"
FT                   /protein_id="ACB32438.1"
FT                   /translation="MTTLVIAEHDSLQLDATTLRLLTAAQQLGDPVHMLVLGQGCTAVA
FT                   EAAATLHGVSQVLLIDAAAFATPSAETLARQIEVLMPGYRTLVAAHQVLYRGALPRVAA
FT                   RLKAAFLTDILAIESRQRLTRPMYAGSVLARVSIDAEQALLTVRPSAFAPCAQDAQSPC
FT                   PVRPVAPVAADTRTRLDRREALASDRPELSRARVVVAAGRGVGALAHMQLVEQLADHLG
FT                   GAVGASRAAVDAGFAPNAIQVGQTGKTVAPDVYLAFGISGAIQHLAGIKDAGVIVAVNK
FT                   DPDAPIFSVADIGLVGDLFEVLPALKAALPSLQVVA"
FT   gene            171449..172054
FT                   /locus_tag="Lcho_0164"
FT   CDS_pept        171449..172054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0164"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   azo:azo3007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32439"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W1"
FT                   /protein_id="ACB32439.1"
FT                   /translation="MTTPRRGQGWRRFALDHLQPEPWRNGAGQTRPVASRQDGAGIVWR
FT                   VSVAEIEAAGPFSRFEGIDRTAVMVEGTDLRLVAPQRQLTFDGPGSQVHFPGEQDWHCE
FT                   APASPTRLWNVMVRRGAACAVVRSVEDQVVLVPEGQAAAQVADWLVLVVRGAFELAGPD
FT                   GQSGHLVGGDGLHLRTPAAFLRLTPCQPGSLLVITALF"
FT   gene            complement(172064..172666)
FT                   /locus_tag="Lcho_0165"
FT   CDS_pept        complement(172064..172666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0165"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: azo:azo3009 putative
FT                   DNA binding helix-turn helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32440"
FT                   /db_xref="GOA:B1Y6W2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W2"
FT                   /protein_id="ACB32440.1"
FT                   /translation="MNRHGEGATASLEESVGAAIKEQRQRHGLTIAQVSEQASISRGML
FT                   SKIENGQTSAGMDTLARIARALGVSMSMLFSKYDVTASSAQHIKKGMGMEVVRRGTKNG
FT                   HTYHLLAYDQGPVKLFEPFLITMNDDSERYPTFQHPGTEFLYMLEGKIEYRCGQETYLL
FT                   EPGDSLTFQGEVPHGPEKLVKYPIKFLSFIVYPRAAE"
FT   gene            172841..174235
FT                   /locus_tag="Lcho_0166"
FT   CDS_pept        172841..174235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0166"
FT                   /product="glutamine synthetase, type III"
FT                   /note="TIGRFAM: glutamine synthetase, type III; PFAM:
FT                   glutamine synthetase catalytic region; KEGG: reh:H16_B2191
FT                   glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32441"
FT                   /db_xref="GOA:B1Y6W3"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W3"
FT                   /protein_id="ACB32441.1"
FT                   /translation="MNTVADPFSARPSADLVTPQRFRTVEETQRHLKSEGVSYVLAQFV
FT                   DIHGVAKAKSVPVEHLNTVMTDGAGFAGFAICGVGIEPHGPDFMAVGDLSTVSVVPWQP
FT                   GLARIVCEGHVEGEPWQFDSRVVLKKQVERLSSQGLTMFTGLEPEFSLLRRNADGTIVP
FT                   HDASDNLAKPCYDYKGLSRTRVFLERLSNAMRATGIDVYQIDHEDANGQFELNYTYTDC
FT                   LTSCDHFIFFKMAASEIANELGLICSFMPKPFANRPGNGMHMHLSIGDGKRNLFQDKSD
FT                   PNGLELSPMAYQFMAGLLHHAPALTALCAPTINSYKRLVVGRSLTGATWAPAYISYGDN
FT                   NRSTMVRIPKGRLELRLPDGACNPYLATAAVIAAGLDGIEKRMDPGTPRNVNLYEWSEA
FT                   QLKEAGIGLLPQNLNAALDALEGDSVIREALGPVTGEFLKFKRMEWLEYMRHVSEWEVK
FT                   QYLEFF"
FT   gene            174247..175155
FT                   /locus_tag="Lcho_0167"
FT   CDS_pept        174247..175155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0167"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   reh:H16_B2192 glutamine amidotransferases class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32442"
FT                   /db_xref="GOA:B1Y6W4"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W4"
FT                   /protein_id="ACB32442.1"
FT                   /translation="MCGIVGLLLKKPALHGHLGELMVPMLIGMTERGPDSAGMAVFTQP
FT                   LAESRRKISVYSGMTEAAAAYDWNGLLAALNGALKVDARITIKGNHAIFAFEGPAEPVK
FT                   AFVKAHDAKLHLLSTGRSIDLYKDIGTPAQVAARYDFSKLVGSHLVGHTRMATESAVTP
FT                   DRAHPFTAGEDFCLVHNGSLSNPNGVRRMLEPRGIKFETDNDTEAACRFLEWRLREGDD
FT                   LHAALQKGFEALDGFYTFLMGTATELALIRDPFACKPAVVAETDDYVAIASEFRSLAHL
FT                   PDIKHAKVFEPAPEEMYVWKI"
FT   gene            175143..175832
FT                   /locus_tag="Lcho_0168"
FT   CDS_pept        175143..175832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0168"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: mfa:Mfla_0458 glutamate synthase, alpha
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32443"
FT                   /db_xref="GOA:B1Y6W5"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W5"
FT                   /protein_id="ACB32443.1"
FT                   /translation="MENLTFDLSRQTVRELNQHLHAPAETLKGQHVTVLNPDGAHNIAV
FT                   GINAPVKVTVAGHAGYYAAGMNKFADVTIDGSASTGVAENMMSGKVHVKGFASNGAGAS
FT                   AHGGLLVIDGDAGLRCGISLKGADIVVGGSVGSFSGFMAQAGRMVVCGNAGDALGDSLY
FT                   EAVIYVRGTIKSLGADARIEPLADADISALAGLLDQAGLSHDPHDFKRVASARTLYHWN
FT                   ADADQDY"
FT   gene            175834..177204
FT                   /locus_tag="Lcho_0169"
FT   CDS_pept        175834..177204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0169"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; ferredoxin-dependent glutamate synthase;
FT                   KEGG: rxy:Rxyl_2501 ferredoxin-dependent glutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32444"
FT                   /db_xref="GOA:B1Y6W6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W6"
FT                   /protein_id="ACB32444.1"
FT                   /translation="MSDTEHPIAFKRLQLEESAGYDRSTLDYIHRASSTGLYEIRGLGA
FT                   KRKLPHFDDLVFLTASLSRYPLEGYREKCSTRTVLGTRFAKKPVVLETPITVAGMSFGS
FT                   LSANVKSALGKAATAMGTTTTTGDGGMTSEERQSSKTLVYQCLPSRYGFNPDDVRRADA
FT                   IEVVLGQGAKPGGGGMLLGQKVNPRVAKMRTLPEGVDQRSASRHPDWTGPDDLAIKIQE
FT                   LRELTDWQIPIYVKVGATRVFNDVKLAVHAGADVVVVDGMQGGTAATQTCFIEHAGIPT
FT                   LAAVRLAVAALEDLDMIGKVQLIVSGGIRTGADVAKALALGADAVAIGQGVLMALGCNR
FT                   DTYQQAGQTHSAEADYAALGTKAGFCHHCHTGKCPVGVTTQDAVLEQRLEPDVGAKRVK
FT                   NYLKTLTMELSTLARACGKQDVHHLEPEDLVALTVEAAAMARVPLAGTNWIPGQNGF"
FT   gene            177216..177809
FT                   /locus_tag="Lcho_0170"
FT   CDS_pept        177216..177809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32445"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W7"
FT                   /protein_id="ACB32445.1"
FT                   /translation="MTPSPSEIKSRPVYEPLRPDLLAGRHWLVLEAGALTAPLLAELGG
FT                   VFAPVASQLQVWWAGPASAVGSAVGLGPLTVRADLPAVIEALGQAGPFEVGDRLYVQGT
FT                   EPFLWAVALAAGQVGLVPSQVRLAHAGSLQRKVWCTHCHGCTEGVTTHVVACAGCGRHL
FT                   LVRDHFSRRHGAFMGVMVDAEVPGERPLPQEVFP"
FT   gene            177806..178756
FT                   /locus_tag="Lcho_0171"
FT   CDS_pept        177806..178756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0171"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: xau:Xaut_3181 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32446"
FT                   /db_xref="GOA:B1Y6W8"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W8"
FT                   /protein_id="ACB32446.1"
FT                   /translation="MIGSSLTLRVVAVDDIAPTLRHVRLAAADGALLPPTGAGAHVQFS
FT                   LPGQGRLHRNAYSLVNAPGSRAHYDIIVRRVPASRGGSAAVHERLKPGDSLEAQWPGNL
FT                   FAPVRGARHHLMIAGGIGITPFLSYLQDPGVRQAGFALHVCCREAEKDVFAPWLPSADG
FT                   VAFHWDADGHRLDIAALLARQPVGTHLYVCGPADLNESVMKAAHDAGWPADHLHTEHFG
FT                   GASATGRAFEAVLHKSGLSVNVGEDESLLEAIERAGVAAPCLCRGGACGVCITGVLDGE
FT                   PEHRDHFLSPAEQVAGQLIAPCVSRARGARLVLDL"
FT   gene            178783..179862
FT                   /locus_tag="Lcho_0172"
FT   CDS_pept        178783..179862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0172"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: xau:Xaut_3180 conserved hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32447"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6W9"
FT                   /protein_id="ACB32447.1"
FT                   /translation="MSITFKPDETFRGDYTYRNSDAAILRFPFPFPEDRYMYSVNMEPH
FT                   AGKGPTEAFHHAFDVDEHYIAECRDRAITLARDPGRCQALPHMMMAQWDTLELLMDSLS
FT                   SDYPEHFSLHKSGEGFGAEWTWSNRPLGIEQRFVFGDAATLPCEPFEYITRQVQGDFAI
FT                   CDQRDNNLFLDAGMVTSQADWSLDFNVGMSFMEWHGPVPLAHQTGVFERALKYLLMIRQ
FT                   GQPVRRLNWTMTVNPRLDTAPETYPEWGPDRASITPENVGRKLHLRVELQTLWRLPRSN
FT                   ALLFPIRCYLASMDELVRVPKWGKRLSRVLSTLPKELVEYKGLTRFLPTALAYLAAFDD
FT                   GADLPKGTEADTERLAEAA"
FT   gene            179958..181088
FT                   /locus_tag="Lcho_0173"
FT   CDS_pept        179958..181088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0173"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   pmy:Pmen_3456 glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32448"
FT                   /db_xref="GOA:B1Y6X0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X0"
FT                   /protein_id="ACB32448.1"
FT                   /translation="MTSWRISALADRHRALGSTLADWNGMGTAWTYSSDLADEHEAIRT
FT                   HAGLMDVSGLKKVHVIGPHAEALINQAVTRNVSKLYPGKSVYACMLNEAGKFIDDCVIY
FT                   RNGPNAFMVVHGAGQGHEILTRGAVGRNVAVLFDDDLHDLSLQGPLAVEYLSRHVPGIR
FT                   QLPYFHHLQTTLFGRPVMISRTGYTGERGYELFCKAADAPTIWDTIVAEGKAMGIVPCA
FT                   FTALDWLRVESCLLFYPYDNSDMYPMDGEPIGDTLWELGLDFTVSPGKTEFRGAAEHFR
FT                   LQGRERFKIFGIELDSTEAAQAGDALYDGDTKVGFVTCGMYSRLSGRSMAIARMDTAYA
FT                   VPGRKLALRGAALNCAASTHSLPFDDPQKTKRMAKD"
FT   gene            181093..181956
FT                   /locus_tag="Lcho_0174"
FT   CDS_pept        181093..181956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0174"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: dar:Daro_0056 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32449"
FT                   /db_xref="GOA:B1Y6X1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X1"
FT                   /protein_id="ACB32449.1"
FT                   /translation="MTTSNRRYTLSLSCPDRVGIVAAVSNFLAQNNGWITEASHHAETE
FT                   SQTFFMRQEILADSLQLSIDEFRTEFAKVAAPFEMNWRISDSARKKRVVILVSKQEHCL
FT                   YDLLGRWQSGELDVDIPCVISNHETFRGLVEWHGIPFHHVPVTPATKVEAYAEVERLYR
FT                   ENEGDVMVLARYMQILAPDLCEKFPGQIINIHHSFLPSFVGAKPYHQAFKRGVKLIGAT
FT                   CHFVTSELDEGPIIEQDVIRIDHSDVPEELVRSGKDVEKAVLARGLRYHLEDRVLIHGN
FT                   KTVVFR"
FT   gene            181966..182871
FT                   /locus_tag="Lcho_0175"
FT   CDS_pept        181966..182871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0175"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: nmu:Nmul_A0357 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32450"
FT                   /db_xref="GOA:B1Y6X2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X2"
FT                   /protein_id="ACB32450.1"
FT                   /translation="MAARIIDGKALSKQLRVGFRERVARLVEQGVQPGLAVILVGDSAA
FT                   SKVYVGNKIKACEECGVRSLHIALPADASEAEVLATIERLNADATIHGILVQLPLPAHI
FT                   QVARVLEAISVHKDVDGFHLYNVGALVTGNSIFPPCTPYGVQLLLDTTGIDVAGQNVVV
FT                   VGASNIVGKPMGLMLLQREATVTICHARTRDLGQHTILADILIVAAGKPGLIVPEMVKR
FT                   GAIVIDVGINRLDDGRIVGDVCFDAVKEKASWITPVPGGVGPMTVTMLIENTLRSAERA
FT                   FKAVDSDEFQDWEAPTVRSP"
FT   gene            182985..185315
FT                   /locus_tag="Lcho_0176"
FT   CDS_pept        182985..185315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0176"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: rfr:Rfer_2918 penicillin-binding protein 1A;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32451"
FT                   /db_xref="GOA:B1Y6X3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X3"
FT                   /protein_id="ACB32451.1"
FT                   /translation="MTSTPSWLPATRRGWILSGLALGLAVLGLIVAVFYVQLPSLDKVI
FT                   DYQPRQPLQVYTHDGVSIARFGAERREFVPIEQIPARMQEAVLAVEDSRFREHGGIDLR
FT                   GLARAVLSNLSGGMRQGASTITQQVARTFFLSTRRTLERKVKEALLALKLEQLLGKDQI
FT                   LELYMNQIYLGQRSYGFAAASQTYFGKPLQALSIAETAMLAGLPQNPVYANPVSNPERA
FT                   RQRQAIVLQRMVAVGLISEAEAVAARAEKVQVRSPLDVDVHAEHVAEMARQIVVERHGE
FT                   QAYTQGYKVITSLRAAEQQAAWQALRRSVIEHDRRQSYRGPEDHEDLPDDAAEAEAAIT
FT                   RALKEHRDDEDLRLALVVQAGAKEVTAQLASGETVRLAGEALRWGQAALSPKAKPALAI
FT                   RRGSVIRVQATSRRKGAPAWTLAQWPEAEAAFVALDPQTGRVRALVGGFDFARRQFNHV
FT                   TQAWRQPGSSFKPFLYSAALEHGVMPDTRVNDAPLDQAGDLPSGWDPQNSDGQYDGPIT
FT                   LRQGLARSKNLVSIRVLQHVGVGPARDWAARFGFDPARQPDNLSLALGAGSTTPMQLAQ
FT                   AYAVLANGGWRIEPVLVERITDAQGQVLYEAPAPAALVEERRAVPARNVFVTSSLLQEV
FT                   TRSGTAARAQQQLQRPDLYGKTGTTNDAVDAWFAGFQPGVVGVAWMGYDTPRSLGQRES
FT                   GGGLALPIWIGYMREALKGVPVAEPGAPDGVTWTGDDWRYGEWADGGQVEGIGLPQGVI
FT                   EQVTEPIRDWFKELFARPRASGP"
FT   gene            complement(185343..185708)
FT                   /locus_tag="Lcho_0177"
FT   CDS_pept        complement(185343..185708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0177"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: bxe:Bxe_A2213 putative ferredoxin subunit of
FT                   nitrate/nitrite reductase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32452"
FT                   /db_xref="GOA:B1Y6X4"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X4"
FT                   /protein_id="ACB32452.1"
FT                   /translation="MNHDTQDLDKSTWSPVCSLDDIVPNTGVCALVGERQVAVFHLDRS
FT                   DSDDERLFAIDNFDPGSQAGVLSRGLVGCLGGRIVVASPIYKHHFDLRSGECLETPEHS
FT                   VNAYPVRVQDRQIWVAV"
FT   gene            complement(185723..188257)
FT                   /locus_tag="Lcho_0178"
FT   CDS_pept        complement(185723..188257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0178"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: rso:RSp1222 probable
FT                   nitrite reductase NADPH (large subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32453"
FT                   /db_xref="GOA:B1Y6X5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X5"
FT                   /protein_id="ACB32453.1"
FT                   /translation="MKILVIGHGMVGHKFLESLDASGLRDARVTVLCEEPRPAYDRVHL
FT                   SEFFSGKAAEDLSLVAPGFFERDNVLLRLNTRAVAIDRAGKTVTTAAGEVLAYDKLVIA
FT                   TGSYPFVPPLPGKDRTDCFVYRTIEDLEGMLECGSRSKSGVVIGGGLLGLECAKALRDM
FT                   KLQTHVVEFSPHLMALQVDEAGGRTLRAKIEKLGVGVHTQKNTVEIVDGETARHRMVFA
FT                   DGSQLETDMIVFSAGIRPRDEIARQCGLEVGPRGGIVIDNRCRTSDADIYAIGECALWN
FT                   GQIFGLVAPGYEMARVAARQLAGEAAAEFGGADMSTKLKLMGVDVASIGDAMGKTPGSR
FT                   AYQFNDERKQVYKKLVVSECGKHLLGAVLVGDAAEYGTLLQMALNRIELPEAPEFLILP
FT                   SSDGQARPALGVDALPDSAQICSCNNVSKGQLCAAVAGGASTIGELKACTQAGTACGGC
FT                   VPLVTQVMKAEMKKQGLAVNNHLCEHFAYSRQELFHIIKVEGIRSFDELLRRHGKGLGC
FT                   DVCKPVAASILASVWNDFILKKELAGLQDSNDYFLGNIQKDGTYSVVPRMAGGEVTPDG
FT                   LIAVGQVAKKYGLYTKITGGQRVDLFGARVDQLPSIWEELIAAGFESGHAYGKSLRTVK
FT                   SCVGSTWCRYGVADSVGLAIELENRYKGLRAPHKIKFGVSGCTRECAEAQGKDVGVIAT
FT                   EKGWNLYVCGNGGMKPRHAELLASDLSKQELIRYIDRFLMFYIRTADRLQRTSVWRDNL
FT                   EGGLDYLKQVVLHDKLGLAAELEADMQNVVDTYVCEWKNAVTHPETRKRFRQFVNSDRT
FT                   DPNVIFIQERGQIRPATPDEREARAADAELTA"
FT   gene            188903..189370
FT                   /locus_tag="Lcho_0179"
FT   CDS_pept        188903..189370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0179"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mpt:Mpe_A3813
FT                   cAMP-dependent protein kinase - catabolite gene activator
FT                   and regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32454"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X6"
FT                   /protein_id="ACB32454.1"
FT                   /translation="MGIEDLMQAVQSLNTDDAFHARLDVMQWRTLGSYLAAYQMRAGDL
FT                   LIKQGDADRTAYFLALGTLQVYRNTGSGATSRIALLRPGSLAGETGLFSDQPHSANVEA
FT                   MTATTVWAMHLPRFEELAARAPAIAIEFLRASGAVMAARLRANMNHQIAAA"
FT   gene            189530..189931
FT                   /locus_tag="Lcho_0180"
FT   CDS_pept        189530..189931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0180"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: bxe:Bxe_B2429 putative
FT                   pterin-4-alpha-carbinolamine dehydratase (PcbD)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32455"
FT                   /db_xref="GOA:B1Y6X7"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X7"
FT                   /protein_id="ACB32455.1"
FT                   /translation="MNPSPAVLSEEQLRSRLPLELPHWSIEHGRLFRRWRTSGWKSTLM
FT                   VVNAIGHLAEAAWHHPDLSVSYAAVDVKLSTHSAGGITEKDLALASKIEQVIGWQPALE
FT                   PDSVLEGTPNSDPRLRYIRYDTPAPGGTD"
FT   gene            complement(189947..191944)
FT                   /locus_tag="Lcho_0181"
FT   CDS_pept        complement(189947..191944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0181"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: mpt:Mpe_A3810
FT                   sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32456"
FT                   /db_xref="GOA:B1Y6X8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X8"
FT                   /protein_id="ACB32456.1"
FT                   /translation="MASTLELALLYLLAAVLGVVGCRLLKLPAMLGYLIVGVLIGPNAL
FT                   ALARDSVGVSYLAEFGVVFLMFVIGLEFNLPKLRSMWRLVFGLGMGQVTLTILGAVIGN
FT                   VLLTWLFSMAARPWELHWTGAVALGAALAMSSTAIVARMMAERLELESEHGRRVMGVLL
FT                   FQDLAVVPLLVLIPSLAQGGDDLWRTLGLALVKAVVLLGVLLWGGQRAMRWWLTRVAKR
FT                   KSEELFILNLLLITLGLAWLTEHAGLSLALGAFVAGMLIAETEYKHQVETDIRPFHDVL
FT                   LGLFFITVGMKLDWRPVLERWDLVLLLSTAPLLAKGVLVTLLARAFGATPGVAIRTGLY
FT                   LAQAGEFGFVLLSLGAEQHLIAARWMSPVLASMVLSMLAAPFLILHSNRIVMRLAASDW
FT                   LMQSVQLTTIAKKSIRTEAHVIICGYGRAGQNLARLLDQEHIPYMALDLDPDRVRQAAA
FT                   AGQSVVFGDAARLQSLMAAGLARASAVVVSYHDTSSALKVLHHVNEHAAHVPVVVRTID
FT                   DTDLEKLRAAGATEVVPEAIEGSLMLANHALALVGVPMRRVLRITQDARDARYSLLRGY
FT                   FHGIDDDTVQELEQERLLSVSLPAGAPTVGHELGDLALQALGVAVISLRRASGQVQDAT
FT                   DALQLRGGDVLVLRGLPEPLALAESRLLKG"
FT   gene            191995..192987
FT                   /locus_tag="Lcho_0182"
FT   CDS_pept        191995..192987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0182"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: mpt:Mpe_A3809 arabinose-5-phosphate isomerase;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32457"
FT                   /db_xref="GOA:B1Y6X9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6X9"
FT                   /protein_id="ACB32457.1"
FT                   /translation="MSASSSPFDAERAIRMARQTLQIEADALRDLQPQQGASFAETVQA
FT                   MLACQGRVVVMGMGKSGHVGRKIAATLASTGTPAMFVHPGEASHGDLGMVTRGDVVLAI
FT                   SNSGESDELAAILPALKRLGVTLVAMTGRAESTLASHADLVLSNRVTQEACPLNLAPTA
FT                   STTAQLALGDALAVALLDARGFRAEDFARSHPGGSLGRKLLTHVRDIMRSGDAVPRVRP
FT                   DTGFLDVMREMSAKGLGTTAVVDEDGRAIGIFTDGDLRRAIEAGIDLRERDARGVMHAG
FT                   ARTVREDALAVEAAGLMEEARVTTLLVSDAQGLLVGAINTNDLMRAKVI"
FT   gene            192990..193601
FT                   /locus_tag="Lcho_0183"
FT   CDS_pept        192990..193601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0183"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: mpt:Mpe_A3808
FT                   3-deoxy-manno-octulosonate-8-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32458"
FT                   /db_xref="GOA:B1Y6Y0"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y0"
FT                   /protein_id="ACB32458.1"
FT                   /translation="MTEPNAAASIPAGRPVQAQCRFDPALLLQAQGVQVAIFDVDGCLT
FT                   DGRIYIGADGEGVKAFNTLDGQGIKLLASGGITPVVITGRDSPAVRRRCADLGVGRALF
FT                   GVHDKLAAAAVLLADMGASWQSLAVLGDDWPDLPLMTRCAFACAPVNAHVEVRSVAHHV
FT                   TEARGGHGAAREFCDLLLMAAGRYAALLDGHLVTLDSAAT"
FT   gene            193625..194320
FT                   /locus_tag="Lcho_0184"
FT   CDS_pept        193625..194320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0184"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   mpt:Mpe_A3807 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32459"
FT                   /db_xref="GOA:B1Y6Y1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y1"
FT                   /protein_id="ACB32459.1"
FT                   /translation="MDNDTGPLPLPLPPLVSRSPDDAANRPLPWRARLRAGLLKYLSVL
FT                   LMAVVAVATGWLVRQTPVIEPDAGVAAPTAEPDYEMRGFSIQHYTAAGPAQGVIEGDVV
FT                   RHFPVTDQLVIDGVRVQWTDPGGQAIRASAARAVAEGDGSLVRLEGGARVVRDPAPGET
FT                   SPFEFISDVLVFDTRNGQVRSDRPVRLRQGDNIFDAASIIYDHPQRVVTLGGGVQGRIL
FT                   PTELSRSLP"
FT   gene            194353..195156
FT                   /locus_tag="Lcho_0185"
FT   CDS_pept        194353..195156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0185"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpt:Mpe_A3806 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32460"
FT                   /db_xref="GOA:B1Y6Y2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y2"
FT                   /protein_id="ACB32460.1"
FT                   /translation="MPETQLPMPTDAPLVVITGASSGIGQALASAYAQRGWRLALVARR
FT                   AEVMQAWVREQQLDPARVAVYGADVQDIDAIVDAGQRCLLECGLPDVVIANAGISVGID
FT                   TAERSDLDVLREIYATNNVGMAATFHPFIAAMRLARRGTLVGVASVGAIRGMPGHGGYC
FT                   ASKAAVASYCESLRLELRSDGVRVVTLLPGFVDTPLTRQNPYPMPFMMSAPAFAARAIR
FT                   AIDAADRWRVIPWQMGWVAKLLRCLPDAIYDRAMAGRARKKRRSE"
FT   gene            complement(195272..195745)
FT                   /locus_tag="Lcho_0186"
FT   CDS_pept        complement(195272..195745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0186"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   mpt:Mpe_A3805 RNA-binding region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32461"
FT                   /db_xref="GOA:B1Y6Y3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y3"
FT                   /protein_id="ACB32461.1"
FT                   /translation="MGNKLYVGNLAYSVRDEDLNEAFSQFGAVNSAKVMMDRETGRSKG
FT                   FGFVEMGSDPEAQAAINGLNGQAIGGRAIVVNEARPREDKPGGFRSPYGGGGAGGGGGR
FT                   SGGGGYGGGGGAGGGGGGGFRSPYGGGGGGGGGRSGGGGGRSGGGGGYGGGGY"
FT   gene            196034..196675
FT                   /locus_tag="Lcho_0187"
FT   CDS_pept        196034..196675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0187"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: mpt:Mpe_A3804 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32462"
FT                   /db_xref="GOA:B1Y6Y4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y4"
FT                   /protein_id="ACB32462.1"
FT                   /translation="MDLLKPLIALLAIVNPIGVVPFFIHFTRHLDDRQRRHTIRVSSFT
FT                   AFVVISVSALAGLQVIEFFGISLASFQVGGGTLLLISALQMLNAQPAETRKEDVSEGEQ
FT                   KADAGASIAVVPLTIPLLTGPATISTMVIYADHARHWWQLAALVGYGVVVGLATFIAFS
FT                   AAGRIARLLGQTGINVMTRLMGLILAALAVEIMAEGLTKLFPVLASHLAR"
FT   gene            196746..198404
FT                   /locus_tag="Lcho_0188"
FT   CDS_pept        196746..198404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0188"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: mpt:Mpe_A3803 putative choline
FT                   dehydrogenase lipoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32463"
FT                   /db_xref="GOA:B1Y6Y5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y5"
FT                   /protein_id="ACB32463.1"
FT                   /translation="MPTFDYIIIGAGTAGCLLANRLSADPHRRVLLLEAGGRDDYHWIH
FT                   VPVGYLHCIGNPRTDWLYQTEADPGLNGRSLRYPRGKVLGGSSSINGMIYMRGQSRDYD
FT                   RWAQETGDAGWGWQDCLPYFKRHEDHWRFDAKQAEPVSAEFAAAHGGGGEWRIERQRLR
FT                   WDILDAFSQAAQQAGIPATDDFNRGDNEGVGYFEVNQRKGLRWNTAKAFLRPTCYGRPN
FT                   FEMWTGVQVSRLLLEPMPDGRQRCAGVEVVTPHGIETVRASGEVLLSAGSIGSVQVLQL
FT                   SGIGPGELLQDKGVTVQHHLPGVGENLQDHLQIRSVYQVSGTRTLNTMVDSWWGKARIG
FT                   LEYLLHRSGPMSMAPSQLGAFTRSVAGLPHPNIEYHVQPLSLDAFGQPLHRFNAFTASV
FT                   CNLNPTSRGHVRIRSPRHEDAPAILANYLSTAADRQVAAESLRLTRHIVAQPALAKFKP
FT                   EEIKPGVQFQSDEDLARLAGDIATTIFHPIGTCRMGRDDDPMSVVDSRLRVRGVSGLRV
FT                   VDASVMPSITSGNTNSPTLMIAERAAEWIRASAVA"
FT   gene            198694..199455
FT                   /locus_tag="Lcho_0189"
FT   CDS_pept        198694..199455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0189"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mpt:Mpe_A3802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32464"
FT                   /db_xref="GOA:B1Y6Y6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y6"
FT                   /protein_id="ACB32464.1"
FT                   /translation="MVDLLLVTLASGLAGFVDAIVGGGGLVLVPALFTVFPGAPPATLF
FT                   GTNKAASVWGTAWAARLYARRVQMNWSTLGPAALAAFLGAAGGAWLVMQVPTTGLRRAL
FT                   PFILLAVLLYTLARKDLGRVHAPTLSRHAERWIGVAIGAVIGFYDGFFGPGTGSFFVFL
FT                   MVRWLGYDFLHASAGAKLLNVATNVAALCLFVGTGHVMWLVAACMAAANVLGSYFGTRM
FT                   ALRRGAGFVRGVFIVVVSVLIVRTGYDAWRL"
FT   sig_peptide     198694..198753
FT                   /locus_tag="Lcho_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.639 at
FT                   residue 20"
FT   gene            complement(199583..200359)
FT                   /locus_tag="Lcho_0190"
FT   CDS_pept        complement(199583..200359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0190"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mpt:Mpe_A0066 cAMP phosphodiesterases, class-II,
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32465"
FT                   /db_xref="GOA:B1Y6Y7"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y7"
FT                   /protein_id="ACB32465.1"
FT                   /translation="MNLRVLGCSGSIALDCRTTSFLLNDRVLIDAGTGVGDLALDELAQ
FT                   IDHILISHSHLDHVLGIPLLADSVMQRRLAREDYKPIQVHALPATIDALRRHIFNNVIW
FT                   PDFTRLPTPERPIIELVTLEVGQRLSLCNLPIEVLPASHTVPACGFGVATTSGWWIYTG
FT                   DTGPNPALWQTLRGRRIAQLVIETAFSDDERALAEISRHLSPSMLAAELAQLDADTSVA
FT                   ITHVKPGEMAAVTGQIAALGIGLTITALTRGDRFRF"
FT   gene            complement(200642..201328)
FT                   /locus_tag="Lcho_0191"
FT   CDS_pept        complement(200642..201328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0191"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mpt:Mpe_A0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32466"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y8"
FT                   /protein_id="ACB32466.1"
FT                   /translation="MPKLVVSLDGVVIKEVQLTKDKTTLGRRPYNDIVIDNLAVSGEHA
FT                   VLQMVGQDVYIEDQNSTNGTYINGRAVKKQLLQHNDTVEIGKYKIKYLVEDSADYEKTM
FT                   ILKPGQMPPGLSARPTPPTMPGHLPPPSNFGSLGISTVTQASIRVLSGAAAGREVALTK
FT                   VVTTVGKPGVQVASITKRPGGYVFAHVEGVNRPTVNGAAVHGDPVHLKDGDVIELAGTQ
FT                   MQFVQP"
FT   gene            complement(201377..202183)
FT                   /locus_tag="Lcho_0192"
FT   CDS_pept        complement(201377..202183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0192"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; Protein
FT                   phosphatase 2C-like; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: mpt:Mpe_A0068 serine/threonine specific
FT                   protein phosphatase (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32467"
FT                   /db_xref="GOA:B1Y6Y9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Y9"
FT                   /protein_id="ACB32467.1"
FT                   /translation="MDRSSTSPVSFEFYSVTDRGRARANNEDSVAIDDAAALAVLADGM
FT                   GGYNAGEVASGMATAFIRSELGRWLTEASEEVTDQDARRAMDVCVDNANRAIFNAANSN
FT                   PQYAGMGTTLVVAVFRGARLLLGHIGDSRAYRWREGRLVQLTRDHSLLQEQIDAGLISP
FT                   EQAAMSLNKNLVTRAVGVEDIVLLETHQHSVSPDDWILMCSDGLSDMLDDESIAEVLMS
FT                   HNQVADAAHALVEAANEAGGRDNIAVILVAVRAEASAGRTWWPFRR"
FT   gene            complement(202186..203130)
FT                   /locus_tag="Lcho_0193"
FT   CDS_pept        complement(202186..203130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0193"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mpt:Mpe_A0069 putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32468"
FT                   /db_xref="GOA:B1Y6Z0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z0"
FT                   /protein_id="ACB32468.1"
FT                   /translation="MGRVHLAHEIETGQEVAIKTLALAREFSGFALREAYARFQREIQA
FT                   AGRLRHPDIVRVIDSGETDGLAYIVMERLHGKDLSNHTQAQTLMPVSTVVAIGARVASA
FT                   LAHAHAHGVVHRDIKPANVMIDGPRNQVKVMDFGIARLHDASRTRTGLVLGSPSYMSPE
FT                   QLAGRNVDGRSDLYSLGVLLFQLLTSRLPIVGTSMASLIHAIAHTNAPDARQLRPGLPE
FT                   ELANLVSILLEKRPELRYRDGLDVAADLRLIASMLQRRTDASSDQPMLSDAAPATAAAV
FT                   DPAPQDAASVQEVAPAADPDVSHAAAMRAQSRP"
FT   gene            complement(203300..204043)
FT                   /locus_tag="Lcho_0194"
FT   CDS_pept        complement(203300..204043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0194"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   mpt:Mpe_A0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32469"
FT                   /db_xref="GOA:B1Y6Z1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z1"
FT                   /protein_id="ACB32469.1"
FT                   /translation="MEQFLTPDFWLAVGQIIMIDILLGGDNAVVIALACRKLPAAQRRA
FT                   GILWGTAGAIVLRVVLIFFALTLLQVPFLKIVGALLLLWIGIKLLVPDHDDAHGSIQAS
FT                   DKLWAAVKTVIVADFVMSLDNVIAIAGAAESAGGDHALPLVIFGLLVSIPIIVWGSQMV
FT                   IKLMDRFPMIITIGGMLLGWIAGTMAVTDPALATYLVPAAADGAAGTPEVSASVRYAAG
FT                   VAGALLVFAWGKWLASRSASVAHSS"
FT   gene            204396..204797
FT                   /locus_tag="Lcho_0195"
FT   CDS_pept        204396..204797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0195"
FT                   /product="SWIB/MDM2 domain protein"
FT                   /note="PFAM: SWIB/MDM2 domain protein; KEGG: mpt:Mpe_A0056
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32470"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z2"
FT                   /protein_id="ACB32470.1"
FT                   /translation="MATAKKAAAKPAPADKAAADKTTVVAQTPAKKVTAPKPALKKAAA
FT                   TDVAAKRTPNAAFMKAMTPSAALAAVIGNTPAPRTEVTKKVWEYIKKHQLQDAANKRMI
FT                   NADAKLKAIFKKDQVSMFEMTKLISDQLS"
FT   gene            complement(204878..205825)
FT                   /locus_tag="Lcho_0196"
FT   CDS_pept        complement(204878..205825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0196"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: csa:Csal_2714
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32471"
FT                   /db_xref="GOA:B1Y6Z3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z3"
FT                   /protein_id="ACB32471.1"
FT                   /translation="MSKKHTVFVDGQEGTTGLRIHEYLAQRADIEVLRIAPELRKDGAE
FT                   RARLLNAADVAFLCLPDAAAKEAVALITNPDTCLIDASTAHRIEPGWAFGLPELAPGQR
FT                   ERLRTGKRIANPGCHASAFILLLRPLVDAGLVAPELAVSATSITGYSGGGKKMIEQYQA
FT                   GDDARLQSPRPYALSLAHKHIPEMMAHTGLRTKPLFMPVVGDFYKGLAVTVPLHLNQLV
FT                   AGTSAQRIHDALSRHYEGEAFVRVMPLNDAATLEDGFFDIQACNDTNRVDLFVFAQGEQ
FT                   ALLMARLDNLGKGASGAAVQAMNLHLGVDEALGL"
FT   gene            205896..206510
FT                   /locus_tag="Lcho_0197"
FT   CDS_pept        205896..206510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0197"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   mpt:Mpe_A3781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32472"
FT                   /db_xref="GOA:B1Y6Z4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z4"
FT                   /protein_id="ACB32472.1"
FT                   /translation="MAISPSLSPGRDAAGASSDSPEAHRVLILPGWQDSDADHWQSRWV
FT                   ALHGYERVEQSDWLWPRRGDWMARLDEVVQSDDRPVVLVAHSLGCHLVAAWSAHSAHAA
FT                   RVQAALLVAPPDTERPDMPPQLHNWRPINRRRLPFACCAVISSDDPYGSHERSLGLCSE
FT                   WGAEVVEAGARGHLNSVSGLGDWPEGHAALQDLIRRARQTG"
FT   gene            206541..207449
FT                   /locus_tag="Lcho_0198"
FT   CDS_pept        206541..207449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0198"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: mpt:Mpe_A3780 putative
FT                   chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32473"
FT                   /db_xref="GOA:B1Y6Z5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z5"
FT                   /protein_id="ACB32473.1"
FT                   /translation="MVTKKPKGLGRGLEALLGPQVGVDTDSNGGQPQPSAVKLAQLQPG
FT                   RYQPRTRMDEGALFELAESIKAQGVMQPILVRPVDARDGLPMYEIIAGERRSRAARLAG
FT                   LDEVPVLVRDVPDQTAAAMALIENIQREDLNPLEEAQGVQRLISEFGLTHEEAAQAIGR
FT                   SRSATSNLLRLLNLADPVQQLLMAGDLDMGHARALLPLERVHQITGAHEIVARKLSVRE
FT                   AEKLVSRQESARQAPLLRMKADKSRDLIRIEEQLADALTAAVEIRVRKRTKRGEQGEIA
FT                   IAFGSLDELNGLLDKLGLSER"
FT   gene            207900..209822
FT                   /locus_tag="Lcho_0199"
FT   CDS_pept        207900..209822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0199"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
FT                   KEGG: mpt:Mpe_A3779 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32474"
FT                   /db_xref="GOA:B1Y6Z6"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z6"
FT                   /protein_id="ACB32474.1"
FT                   /translation="MDVISNFAARYERTKEEELTLEEYLAECKRNPLAYATAPERMLKA
FT                   IGEPQMVDTRNDPRLSRIFANKVIKIYPAFAEFYGMEEAIEQVVSYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSIAERLKLLMQEVPFYAVKGSPVNESPLGLFDNDEDGPVLEKEYGI
FT                   PRRYLTRIMSPWAVKRLEEYGGDIRRFKVVRRYPSILKQVGISKTEPGDENNQDISSLV
FT                   GKVDIRKLETYAQDDPDAYSYSGGLCLANQGLLEFVEMFKAPIKVLHPLLTATQESNFK
FT                   GTEGFGAIPFDGIVLAHSNESEWKAFRNNKNNEAFLDRIYIVKVPYCLRVSEEVKIYEK
FT                   LLKGSSLAGATCAPGTLKMMSQFAILTRLKEPENSSLYSKMMVYDGENLKDTDPRAKSY
FT                   QEYRDYAGVDEGMSGISTRFAYKIISKVFNFDSQEIAANPVHLMYVLEQQIEREQFPAE
FT                   LEQKYVAYIKELLAPRYAEFIGKEIQTAYLESYSEYGQNIFDRYVTYADYWIQDQEYRD
FT                   TDTGEVFDRGSLNGELEKIEKPAGIANPKDFRNEIVNFVLRARANNQGKNPVWTSYEKL
FT                   RVVIEKKMFSNTEELLPVISFNAKASADEAKKHEDFVNRMVNKGYTGKQVRLLCEWYLR
FT                   VRKSS"
FT   gene            209847..211133
FT                   /locus_tag="Lcho_0200"
FT   CDS_pept        209847..211133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0200"
FT                   /product="protein of unknown function DUF444"
FT                   /note="PFAM: protein of unknown function DUF444; KEGG:
FT                   mpt:Mpe_A3778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32475"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z7"
FT                   /protein_id="ACB32475.1"
FT                   /translation="MQQIIDRRLAGKNKSIGNRERFLRRYKGQIREAVRRSIDGRGIRD
FT                   LERGEEIRIPKKDVSEPVFHHGSGGKREMVHPGNQEYLAGDRIKRPPGGGGGGKGGGQA
FT                   SDSGEGDDDFVFSLSKEEFMQVFFEDLALPHLIRTQLAETPEWKSHRAGYVSAGNPSNL
FT                   HVVRSMRGALGRRIALGMESRRELRRLEALLVELKRDLKPGDAVALQLIADTEASISAL
FT                   RHRLGAIPFLDPLDLRFRNRVRVPVPTSKAVMFCLMDVSGSMDEGRKELSKRFFILLYL
FT                   FLTRHYEKIDIVFIRHHTQAQEVDEQGFFHSTETGGTVVSSALVLMEEIIRARYPSDQW
FT                   NIYGAQASDGDNWHHDSGRCRELLEQKILPLCRYYAYVQVAEPEQNLWEEYCRLAEASG
FT                   PHFAMRKVTEAGQIYPVFRDLFKKEGASA"
FT   gene            211171..212769
FT                   /locus_tag="Lcho_0201"
FT   CDS_pept        211171..212769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0201"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: mpt:Mpe_A3777
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32476"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z8"
FT                   /protein_id="ACB32476.1"
FT                   /translation="MNTETLIAAPEAPLRGAAMRTPLRQPLPLLQRPSEPLPAPSDWSF
FT                   ELIERYHTVIRQTAERFGLDTYPNQLEIITAEQMMDAYASVGMPVNYRHWSYGKEFIST
FT                   EKNYKRGAMGLAYEIVINSNPCISYLMEENTMAMQALVIAHAAYGHNSFFKGNYLFRMW
FT                   TDASSIIDYLVYAKNYVADCEERHGMDAVESFLDSCHALMNHGVDRYRRPSKKSLAQEL
FT                   ADRKDREAYAQQQVNDLWRTLPRRTDKAEEAQEARRFPSEPQENLLYFIEKNAPLLEPW
FT                   QREIVRIVRKVAQYFYPQRQSQVMNEGWATFWHHKILNTMYDDGYLTDGVMIEWLKSHT
FT                   NVVYQPRVGDKGYSGINPYALGFAMYTDIKRVCENPTAEDREWFPDIAGSDWLPTLDHA
FT                   MRNYKDESFIGQFLSPKLMRDLRLFAIVDDDKKSEIEVAAIHDDAGYRRVREALSHQYD
FT                   LGQREPNIQVWNVNLRGDRSLTLRHFQHNDRPLADGAQEVLKHVARLWGFAVHLESVNG
FT                   AGDIAKRWTVPAPAH"
FT   gene            complement(212833..214254)
FT                   /locus_tag="Lcho_0202"
FT   CDS_pept        complement(212833..214254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0202"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   mpt:Mpe_A3774 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32477"
FT                   /db_xref="GOA:B1Y6Z9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y6Z9"
FT                   /protein_id="ACB32477.1"
FT                   /translation="MNAPHSHDWQPAIRPRPMPAAMREQLQQRFGSRLSTAQAVRDQHG
FT                   RDESPYDTAAPEAVLFCESNEDVAAAVAIAHEHAVPVIPFGVGSSLEGHLLAVQGGLSL
FT                   DLSRMNRILSLNPEDLTVTVQAGVTRMQLNNEIRHSGLFFPIDPGADATLGGMSATRAS
FT                   GTNAVRYGTMRENVLALTVVTASGELVHTGTRARKSSAGYDLTRLFVGSEGTLGVMTEI
FT                   TLKLYPLPEAVLAAICHFPSIAAAVDTTIGLIQMGVPIARCELIDARTVGMVNRHNKLD
FT                   LREQDMLLMEFHGSPASVREQAETVQALAAENGGESFEWAETPEERTRLWTARHHAYFA
FT                   AVQSRPGCRAISTDTCVPISRLAECIVDTVADVDACGLPYFLVGHVGDGNFHIGFLIDP
FT                   DSPDEGRIAEQVNRTLVARALQMAGTCTGEHGIGLHKMGFLLDEAGPGAVALMRQIKHA
FT                   LDPKNIMNPGKIFAW"
FT   gene            214368..215111
FT                   /locus_tag="Lcho_0203"
FT   CDS_pept        214368..215111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0203"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: pna:Pnap_3266 putative transcriptional
FT                   regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32478"
FT                   /db_xref="GOA:B1Y700"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y700"
FT                   /protein_id="ACB32478.1"
FT                   /translation="MSNSQATPSGPGEAAAPGAACVDERAAHELAVLYPDLAAVAPPHW
FT                   REDVARLGPPVSVPAGAVLFDEGAPCRGFPLVIEGAVRVARGTPNGRALELYRVLPGEV
FT                   CIVSSACLFGQIALTAHGVSLQPSRLLLLPADLVLRWCAHEPFRRFIFGQFAGRMADLI
FT                   TLAEAVAFQRLDQRLAGALLGRGATLHVTHQQLADELGTVREIVTRLLKRFEQAGWVEL
FT                   GRERVRLLDPAALRQLAGGEPGRIA"
FT   gene            215211..215405
FT                   /locus_tag="Lcho_0204"
FT   CDS_pept        215211..215405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32479"
FT                   /db_xref="GOA:B1Y7N1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N1"
FT                   /protein_id="ACB32479.1"
FT                   /translation="MKINVGGIDRILRIIAGLALIALTLTGTIGVWGWIGVVPLATGLL
FT                   KFCPVYSILGFNSCPMSAK"
FT   gene            complement(215419..216225)
FT                   /locus_tag="Lcho_0205"
FT   CDS_pept        complement(215419..216225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0205"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: mpt:Mpe_A3371 putative GntR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32480"
FT                   /db_xref="GOA:B1Y7N2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N2"
FT                   /protein_id="ACB32480.1"
FT                   /translation="MTAPPRTRSPRTRSAPAALDGTAPTTATQRVYDGIYGAILEHRLS
FT                   PGMRLREEELAASFAVSRTVVRQALHRLAQDQVIELHHNRGAQVPQPSLAEAAHVFDAR
FT                   RVVECEIARRLAGQLSAEQLAQLREMVSAEAAADARGDRPASIRLSGQFHRALAQMCGN
FT                   PVFVRLLDELLPTTSILMALYQNPGQPACVAHRHTELIDALTGSGAAGAAEMRRHLQEL
FT                   ERLLTRAGSKAPALRDVFAAYRSASDASDTNDTDPPAGSGRQAPAR"
FT   gene            complement(216294..217178)
FT                   /locus_tag="Lcho_0206"
FT   CDS_pept        complement(216294..217178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0206"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_2470
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32481"
FT                   /db_xref="GOA:B1Y7N3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N3"
FT                   /protein_id="ACB32481.1"
FT                   /translation="MAKPPRPSRPASFWLLGAVFTAFVIFLYGPMLAIFVLSFQGPEGG
FT                   LTFPLRGVSLHWFAKLWEGIGVIDIGAAFRRSLALGAVVMALTVGFALLAGLAYRKRLP
FT                   GGTPLFYVVVASLIMPSIIVSLGIGLMFRLLDTGLKAGLEAWWPAAAETFNTTLGLFSS
FT                   GLGAQLTWTLPFGLLIMFAVFNRFNPAYEEAARDLGATPWQSFVHVVLPLIGPSLVGVG
FT                   MFGFTLSWDEIARSSQAMGDLNTLPLELQGLTTTVTTPVIYALGTVTTVVSFLVMGLTL
FT                   ATVWLWQRRQRAA"
FT   gene            complement(217178..218074)
FT                   /locus_tag="Lcho_0207"
FT   CDS_pept        complement(217178..218074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mpt:Mpe_A3373 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32482"
FT                   /db_xref="GOA:B1Y7N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N4"
FT                   /protein_id="ACB32482.1"
FT                   /translation="MKNSTRASRTALYAWLQAAPLTAVFVLFFVVPLLLILMVSFWQAT
FT                   EYELIPAFTVQSYADVFTGCPVTADGDLCVTFKTYLSTLRFGVLTWIVTALLGFSIAYF
FT                   LAFHVKTQLMQMVLFIVCTVPFWTSNVIRMISWVPLLGRNGLVNQGLQGAGLIDTPIEW
FT                   LLFSEFSVVLAFVHLYTMFMIVPIFNTLMRIDRSLIEAARDAGATPWQTVRHVVLPLSR
FT                   TGLIIGSIFVVALVMGDFVTVGVMGGQQIASVGKIIQVQASYLQFPLAAANAVILLAVV
FT                   LMMIATLMRLVNLRKEL"
FT   gene            complement(218095..219402)
FT                   /locus_tag="Lcho_0208"
FT   CDS_pept        complement(218095..219402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0208"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: pna:Pnap_3269 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32483"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N5"
FT                   /protein_id="ACB32483.1"
FT                   /translation="MSDDNQSQSRPDVDASAAEPQRRRFLKTAAGAGVAATGITGFPFV
FT                   HAQEKIVLRYLGTAVNQDKAIADKFEADTGIKIQYIPVTTDDVTKRAVTAPNSFDLIDT
FT                   EYFSLKKIVPTGNLLGIDVKRIKNADKITSLFTKGEVAGKKVGDQGTAPKKVMYLDGPT
FT                   GKKFAASPTGFMTLIPTVYNADTLGIRPDLIKRPISSWAELLNPEFKGKAAILNIPSIG
FT                   IMDAAMVVEAMGLYKYPDKGNMTKKEIDLTIKTLIEAKKAGQFRSLWKDFNESVNLMAS
FT                   GEVVIQSMWSPAVTAVRTKGIACTFQPLKEGYRAWAAGFGVPKSVTGRKADGVYEFINW
FT                   FLDGWAGAYLNRQGYYSAVLETAKAKMEAYEWAYWMEGKAASQDIKSPNGDVLAKTGSI
FT                   RDGGSYEARMGGIACWNAVMDENAYMVQKWNEFVAA"
FT   gene            complement(219487..220488)
FT                   /locus_tag="Lcho_0209"
FT   CDS_pept        complement(219487..220488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0209"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: mpt:Mpe_A3375
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32484"
FT                   /db_xref="GOA:B1Y7N6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N6"
FT                   /protein_id="ACB32484.1"
FT                   /translation="MSTRTDLELIDLVKDYGQSLAVAGINLKIAAGSYCCLLGPSGCGK
FT                   TSTLRMIAGHEEPTEGQIALGGREITHLSPAARGTAMMFQSYALFPHLTVLENVAFSAR
FT                   MKGVARAEREARAHELLQLVAMDPYAARLPAALSGGQQQRVALARALMMRPKVLLLDEP
FT                   LSALDPFLRVKMRAELKRWHQSLGMSFVHVTHSQEEAMALADLVVVMNHGRIEQAGSAR
FT                   EVFERPRTEFVARFIGAHNIIDTPAGKVAVRCDRLNLVEPDAGETVVTVAAVEYQGAQV
FT                   QVHLMAESAADAEDAERWTATLSDASFHAAPMAPGHRVAMRWWAADAHALAA"
FT   gene            220745..221488
FT                   /locus_tag="Lcho_0210"
FT   CDS_pept        220745..221488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0210"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   mpt:Mpe_A3376 hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32485"
FT                   /db_xref="GOA:B1Y7N7"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N7"
FT                   /protein_id="ACB32485.1"
FT                   /translation="MKLLIVNPNTSSAMTEGIGRAAQAVAAPGTRIVATQPSFGPLSIE
FT                   GHFDETIAAAGVAEQVRLHAGPDVVDAPSGIVIACFGDPGLDAAREAATAPVLGIAEAA
FT                   FHAASFLATGFSVVTTMTRTCVIAEHLVQKYGFEHRCRGVHGTDIPVLALEDGGAGCVD
FT                   AIEAAAREALARDRSGAIVLGCAGMAALCATLSARLGVPVIDGVAAAVKFAEALAALGL
FT                   QTGKQGDYARPLPKVYTGWAAPLGW"
FT   gene            221594..223609
FT                   /locus_tag="Lcho_0211"
FT   CDS_pept        221594..223609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0211"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: azo:azo1492 putative histidine protein kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32486"
FT                   /db_xref="GOA:B1Y7N8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N8"
FT                   /protein_id="ACB32486.1"
FT                   /translation="MTHRQAIGRASVVRRYGSATAAIAAVVGLRVLLAPSLGDQAQFAP
FT                   VLCAVVFAAWHGGFGPALFAVLFGALATRYFVLEPIGSLAIDGRDQQVGLAVYLLSGLG
FT                   IAALGGSMHKAERRANEVAEQLKLKGALIENALEPVLGWDWDGRITFWNRAAQRLYGYS
FT                   RDDALGCTSHELLRTRVHGQGGAFMDRLAADGAFEGELRQRTRDGREIVVETRMVRVMR
FT                   DDGSAYVIEANRDVTARTEAQAAMQQLNAELESRVRERTDALSRNNELLAASRARLASI
FT                   VDSAMDAIVTLDGRQQIVLFNAAAERMFGLSAAQALGQPLERLIPPRFRGGHPAHVDGF
FT                   DARGDSAAVRSMRATPSGGELLGLRADGTEFPVEASISRTDVNGDKLFTVILRDITERS
FT                   RAEEAAVRLRIAEEQAVIAQRDSRMKSEFLASMSHELRTPLNAILGFTDLLLMKGAGPL
FT                   TPDQEKKLRHIHAGGSRQLSLIGDLLDLARIEAGRFPVSIAQVVCTDVIQKVVRGLQPA
FT                   VASKGLQLTADVPGSIEAVRSDAVVLAKIVRLLADNAVKFTEAGRVTLSVHQHREGAGV
FT                   LVTGISVSDTGPGIRPEDQDKLFLAFIQGDGASTRQHGGLGLGLHLSNKLAGLIGAQIE
FT                   FRSEFGQGSVFTLRLAQDEAAPASSPLSRTPVPDRP"
FT   gene            complement(223578..224543)
FT                   /locus_tag="Lcho_0212"
FT   CDS_pept        complement(223578..224543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0212"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   mpt:Mpe_A3377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32487"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7N9"
FT                   /protein_id="ACB32487.1"
FT                   /translation="MKRRPAPDSPDLQLSLPLLYGDTSAGTRTEPAATPVSAGPAAPAP
FT                   VAAAALVPAAPAAPRPTGLLRHPRGNREISLGGQAIAYELKRARRRTIGFVIGTEGLAV
FT                   SAPRWVGQPEIDAALASKERWILRKLADQGERRQRVEAARLEWRDGTRLPFLGGTLVLV
FT                   LDPGVRGVLLHEPAATPPAHTDAIAEPPERRLHIGLPLQADAAQIREGVQRWLQRQALQ
FT                   LFEARCGHYAPQLGVQVRRLRLSSAQTRWGSASADGTVRLNWRLIHFGLASIDYVVVHE
FT                   LAHLREMNHSPAFWAVVHSVMPDYQSRRGTLKDGPVPVFD"
FT   gene            complement(224521..225285)
FT                   /locus_tag="Lcho_0213"
FT   CDS_pept        complement(224521..225285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0213"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mpt:Mpe_A3378 putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32488"
FT                   /db_xref="GOA:B1Y7P0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P0"
FT                   /protein_id="ACB32488.1"
FT                   /translation="MIYLRSFLYLLFLIVTVMPWAIVAVVASIGVRGTPLYWLCTGWLR
FT                   LAIWGARRICGVQYRVQGLENVPSAANGRAAVILVPKHQSTWETFAFPAIMPHPLAYVF
FT                   KRELLYIPFFGWAIARLDMVHINRARQSEAWRKVVEQGTQIMAGGTWMIMFPEGTRTPR
FT                   GSQGAYKTGASRLAVATGTPLVPIAVTSARCWPRKSFLLRPGVIDVSIGKPIEPAGRRP
FT                   DDLMREVEAWIEGEMRRLDPEAYPPHEAPASP"
FT   sig_peptide     complement(225202..225285)
FT                   /locus_tag="Lcho_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.468 at
FT                   residue 28"
FT   gene            complement(225285..225884)
FT                   /locus_tag="Lcho_0214"
FT   CDS_pept        complement(225285..225884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0214"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   mpt:Mpe_A3379 putative phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32489"
FT                   /db_xref="GOA:B1Y7P1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P1"
FT                   /protein_id="ACB32489.1"
FT                   /translation="MSERNPLKIVVVDRDGTLNELRDDHVKTPEEWQPIPGALEAIARL
FT                   HQAGWHVVVATNQSGLGRGLFDMSTLNAIHQKMNEELARLGGRIDAVFFCPHAPEDHCT
FT                   CRKPLPGLFEDIADRMGVETHEMHAVGDSLRDMQAARNAGCKTHLVLSGRSAGIDEAGL
FT                   ARLHELVGDVTVHADLAAFAETLIAADRRKSQDARR"
FT   gene            complement(225895..228036)
FT                   /locus_tag="Lcho_0215"
FT   CDS_pept        complement(225895..228036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0215"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: mpt:Mpe_A3380 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32490"
FT                   /db_xref="GOA:B1Y7P2"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y7P2"
FT                   /protein_id="ACB32490.1"
FT                   /translation="MSHPNLLVELFVEELPPKALKKLGESFAGTLAASLKAGGLAGADA
FT                   VVTPFASPRRLAVHVTGVAAKAADKSVLHKLMPVAVALDAAGNATPALLKKLAALGADA
FT                   SVVPSLKRQPDGKAEALFLDSQVAGATLAEGLQKALDDALAKLPIPKVMGYQLADGWTS
FT                   VNFVRPAHGLVALHGDDVVPVATLGLVAGRSTHGHRFEAAVPTVELRHADSYAEQLETE
FT                   GAVIAGFEARRAEIVRQLDAAAAAQGLKPIDDDALLDEVTALVERPNVLVCQFEPEFLA
FT                   VPQECLILTMKANQKYFPLLDAAGKLTHKFLIVSNIRPDDASAVIGGNERVVRPRLADA
FT                   KFFFDQDRKKTLESRVPGLARVVYHGKLGTQGERAERVRAIGHAIVNQLRMATIPYTVD
FT                   AQDEFAVLDSKVQQAALLAKTDLLTDMVGEFPELQGIMGGYYARHEGLRDGVAIAIEDH
FT                   YKPRFAGDALPRNHTGTVLALADKLETLVGLFGIGQLPTGDRDPFALRRHALGVIRILV
FT                   EKNLPLDLPALLNGAVPAFGELIEDPRLALFDFMRDRLAVNLRDQGYSAQEVDAVLALE
FT                   PARLGDVPKRLAAVRAFAALPEAAALAAANKRIGNILKKAEGTVEARIDAALLAEPAEQ
FT                   QLAAALAQVQPGADALFAQGEYAASLQALAALKAPVDAFFDDVMVNAEDPALRANRLGL
FT                   LATLHGAMNRVAELARLAA"
FT   gene            complement(228042..228995)
FT                   /locus_tag="Lcho_0216"
FT   CDS_pept        complement(228042..228995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0216"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: aav:Aave_4178 glycine--tRNA ligase; TIGRFAM:
FT                   glycyl-tRNA synthetase, alpha subunit; PFAM: glycyl-tRNA
FT                   synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32491"
FT                   /db_xref="GOA:B1Y7P3"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y7P3"
FT                   /protein_id="ACB32491.1"
FT                   /translation="MLTFQHIILRLQDYWDRQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPSRRPKDGRYGNNPNRLQHYYQYQVVLKPAPANILDLYLGSLEALGFDL
FT                   KKNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLE
FT                   RLAMYLQGVENVYDLQYAPGLTYGDVFHQNEVEQSTYNFEHSNVEFLLSAFGAHEGNAQ
FT                   ELMAQQLALPAYEQVLKAAHTFNLLDARGAISVTERAAYIGRIRNLARAVAAAYLDSRA
FT                   RLGFPMAPRAWADEIGAKLAAEAEKAALKNEAKKAA"
FT   gene            complement(229088..229903)
FT                   /locus_tag="Lcho_0217"
FT   CDS_pept        complement(229088..229903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32492"
FT                   /db_xref="GOA:B1Y7P4"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P4"
FT                   /protein_id="ACB32492.1"
FT                   /translation="MTLLLALSTWLTALAIAVALEQSLSGLARLYRLRREPMVSDRHTA
FT                   AFYQRSLLTWASADVRRLWLGLIAAATCGWLAWLAHPLWALAATAALLGSLAWDLATWE
FT                   CVAVSRWQVAWRRGWRRSVRRLPTAQVARVHVIARARSARHGWLARLHGRALGTCCLAL
FT                   ELHNGRAVKLPRTGGWAGRRSVEQASVFLRQRQLETAQERRENAREQRRAERRARRLIP
FT                   EASEMRLKREIVALRAARSHNERQRAMTRFHELPPPERNPSVSDTLMLT"
FT   gene            complement(229842..230666)
FT                   /locus_tag="Lcho_0218"
FT   CDS_pept        complement(229842..230666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0218"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mpt:Mpe_A0257
FT                   putative mannose-1-phosphate guanyltransferase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32493"
FT                   /db_xref="GOA:B1Y7P5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P5"
FT                   /protein_id="ACB32493.1"
FT                   /translation="MASPLPLRAIVLAAGRGERMRPLTDTTPKPLLPIFGRPMIEWHLL
FT                   ALARDGVQEVVINTAWLEDQFPAVLGDGSRFGLRLRYSTEGREHGGALETAGGIAKVRD
FT                   WLCADGRAAFWVVSGDIWAPDFRFDAELAQRFIASGLDAHLWMVPNPPFHPKGDFAFGA
FT                   ALPALDAQAALAAPIGGDAAGQNGATYANLALMRPSLCASVTPGSRSALGPHLHEGIAD
FT                   RRISISMYQGRWENVGTPAQWAALQDASKDPVHDSAARPLHLADRTGDRGRA"
FT   sig_peptide     complement(229844..229903)
FT                   /locus_tag="Lcho_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.600 at
FT                   residue 20"
FT   gene            complement(230688..231263)
FT                   /locus_tag="Lcho_0219"
FT   CDS_pept        complement(230688..231263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0219"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: rfr:Rfer_0227 hemerythrin HHE cation binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32494"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P6"
FT                   /protein_id="ACB32494.1"
FT                   /translation="MTQTALRVIRDEHSALSAMLSSIPLLLAESKRNGTQPSFDVLRAM
FT                   LFYIDEFPERLHHRKETELLFPLLRQRNADCTEALDKLDRDHAAGERAIRALEHALLAY
FT                   EMMGEARRGAFEDALSSYLEFYRAHMRLEEDVVLPAAQKVLTEADWQQLDAAFAQNRDP
FT                   LTGHTPDQAYEQLFRRIVNSAPAPVGLG"
FT   gene            231449..233494
FT                   /locus_tag="Lcho_0220"
FT   CDS_pept        231449..233494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0220"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: ajs:Ajs_3959
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32495"
FT                   /db_xref="GOA:B1Y7P7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P7"
FT                   /protein_id="ACB32495.1"
FT                   /translation="MVAITETSPTQLANAIRALAMDAVQQANSGHPGAPMGMADIAVAL
FT                   WKRHLKHNPSDPQWTDRDRFVLSNGHGSMLLYALLHLTGYALPIEQLRNFRQMHSQTPG
FT                   HPEVGVTPGVETTTGPLGQGISNAVGMALAEKLLAAEFNRPGHAIVDHHTYTFLGDGCL
FT                   MEGISHEACALAGAWKLNKLIALYDDNGISIDGKVAPWFVDDTALRFAAYGWNVVGPVD
FT                   GHDIDAVDAAITEARKSTDKPTLVICKTAIGKGSPNRAGTAKAHGEPLGAEEIALTRES
FT                   IGWDAEPFVIPEDICAAWDCRVAGAAAQAAWEDRYSAYVLEFPELAVAFERRMAGDLPD
FT                   NFAEIAVTAVADAHEKGETVASRKASQIALEHFTAALPELLGGSADLTGSNLTNTKSTP
FT                   ALRIAADGAVVKTEAGQIGRHINYGVREFGMAAIMNGVALHGGFIPYGGTFLTFSDYSR
FT                   NAIRMAALMKTRVIHVFTHDSIGLGEDGPTHQSVEHAASLRLIPNLDVWRPADTAETAV
FT                   AWTMALANRHRPSALLLSRQNLAYAPKSDADVITKGAYILSEPRDIGLNKKAKAVIIAT
FT                   GSEVQLALQAQKALAEAKIAVRVVSMPSTTVFDRQDVKYKKDVLPKDLPRIAVEAGVTD
FT                   FWWKYRCDAVIGLDTFGESAPAPVLFKHFGFTVENIVATVRKVLSK"
FT   gene            233567..234565
FT                   /locus_tag="Lcho_0221"
FT   CDS_pept        233567..234565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0221"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: reh:H16_A3146 glyceraldehyde 3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32496"
FT                   /db_xref="GOA:B1Y7P8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P8"
FT                   /protein_id="ACB32496.1"
FT                   /translation="MTIKIGINGFGRIGRMVFRAAVQNFEDIEVVGINDLLEPDYLAYM
FT                   LKYDSVHGRFKGDVAVDGNTLIVNGKKIRLTAVKDPSELKWAEVGADIVVEATGLFLTK
FT                   EAGEKHLAAGARKVVFSAPSKDDTPMFVYGVNDKTYAGQAIISNASCTTNCLAPVAKVL
FT                   NDKWGIKRGLMTTVHAATATQKTVDGPSNKDWRGGRGILENIIPSSTGAAKAVGVVIPE
FT                   LNKKLTGMAFRVPTSDVSVVDLTVELNSEATYAEICAEMKAQSEGALKGVLGYTDEKVV
FT                   STDFRGEAKTSVFDAEAGLALDKTFVKIVSWYDNEWGYSNKVLEMVRVIAK"
FT   gene            234731..236197
FT                   /locus_tag="Lcho_0222"
FT   CDS_pept        234731..236197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32497"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7P9"
FT                   /protein_id="ACB32497.1"
FT                   /translation="MDIDTLEALRRQHPAWRLLLADTAALVASFLHRVFVAPNRRVIGQ
FT                   ADLAEALEDTLYAVREQRGGNVYPKSALEYLNDWAANDRAWLRKFYPPGSDEPHFDLTP
FT                   ATERALAWLGSLSERSFVGTESRLLTLFDLLRQMNDGSETDPETRVRELQRKRDQIDAE
FT                   IERVRAGDLPLLGDTALKERFHQFAGLARELLADFREVEHNFRGLDRRVRERIALWDGS
FT                   KGALLQDILGERDLIAESDQGRSFRAFWDFLMSRARQDELTALLDRVLQLEPVAELAPD
FT                   PRLRRVHHDWLEAGEQTQRTVALLSQQLRRFLDDQAYLENRRIMDILRGIEAGALAVRA
FT                   RQPAGDFMSIDETAPDIELPMERPLYAPPLKLAITSARIDAGDEDDDEFDAAALYSQFI
FT                   VDKAALAQHVRQSLQQRTQITLAELLDTRPLQQGLAELVAYLSLAAEPPIGVNAGVNAV
FT                   IDDTLEERVSWLARDGRRKSARLPRVIFSK"
FT   gene            236209..236835
FT                   /locus_tag="Lcho_0223"
FT   CDS_pept        236209..236835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32498"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q0"
FT                   /protein_id="ACB32498.1"
FT                   /translation="MATTIESAPAPTAELSAVLIPLLKGVTYRADDAAHWSALLQLQGR
FT                   VRDHVAVLGLELMLDEAEGYAFLRSRPEPEDEALPKLPRLVARRPLSFPVSLLLALLRK
FT                   KLAEFDAAGADTRLILSREQVVELLRVFLPEGSNEARLIDQVDSHLNRVVDLGFVRRLR
FT                   GQDGLFEVQRILKAFVDAQWLAEFDARLATYRAQLEGKAGVADEE"
FT   gene            236825..240226
FT                   /locus_tag="Lcho_0224"
FT   CDS_pept        236825..240226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32499"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q1"
FT                   /protein_id="ACB32499.1"
FT                   /translation="MKNEALALDFGADEADGALAGFRLQRLEVFNWGTFDARVWTLRAD
FT                   GRNVLLTGDIGSGKSTLVDAVTTLLVPAHRVAYNKAAGAEARERTLRSYVLGHYKAARS
FT                   ELGGSGRPVALRGPDSYSVILGVFHNAGYDQTVTLAQVFWLKDPQGQPLRLYAVAEKAL
FT                   SIAADFADFGTDIVKLRKRLRAAKVVVEDSFPPYGALFRRHFGIHNEQALELFHQTVSM
FT                   KSVGNLTDFVRSHMLEPFDVAPRLVALIAHFDDLNRAHEAVLKAQRQVALLQPLVADCE
FT                   RHGELAAAVEAQRAAREALQAWFAGLKAELLDQRLQHLGDDLARHLSQIERLTALQREQ
FT                   LSQERELRRAIADSGGDRIERLALDIARKETEKRRRTDKAGRYDALRQTLGLLAMHSAE
FT                   DFLNQRALCAPLREAAAEHEARAQNALNELGVAFAQGRKEHDEMLAEIASLKARRSNID
FT                   AQQVVLRAALCEALKLREADLPYAGELIQVRDDERDWEGAAERLLRSFGLSLLVPDEHY
FT                   AAVSDWVDRTQLKGRLVYFRIRPKARGSSQDGRGDLPALQPDSLARKLAIKPDTPFYGW
FT                   LERELAHRFDLACCTGQEQFRREARAITRAGQIKSPGERHEKDDRHRIDDRSRYVLGWS
FT                   NQAKIAALESRARVLQARLIETGQRLAALQNEQAALRERLQALDKLEEYRDFTELDWRS
FT                   SVTELAALQDEKQRLEAASDVLKTLAVQLATLESVRDDTGRKLKDREAEQTRCALKHEQ
FT                   ARALREQAQQKLDAADFAARAAHFGLIEGWRALALGDQALSVENCDGREQEMRRWLQAR
FT                   IDADDKRLAHLGEKIVRAMAQYKEAFKLDTQEVDASVAAGAEYRAMLAQLKADDLPRFV
FT                   ARFKELLNENTIREVAHFQSQLHRERETIKERIARINESLTQIDYNPGRFIALEAQTAT
FT                   DADVRDFQTELRACTEGTLTGSDDAQYSEAKFLQVRQIIERFRGREGSAEADRRWAAKV
FT                   TDVRQWFVFAASERWREDGSEFEHFSDSGGKSGGQKEKLAYTILAASLAYQFGLEWGAL
FT                   RSRTFRFVVIDEAFGRGSDESAQYGLRLFQQLNLQLLIVTPLQKIHIIEPFVASVGFVH
FT                   NEDGSASKLRNLGIEDYRAQRDGSMP"
FT   gene            240223..241437
FT                   /locus_tag="Lcho_0225"
FT   CDS_pept        240223..241437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32500"
FT                   /db_xref="InterPro:IPR014544"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q2"
FT                   /protein_id="ACB32500.1"
FT                   /translation="MSDWSLPADLRAQVQRRWDKGELLAERVAPTQLFPLRLTLRVPSS
FT                   SDLSERFDAVRRWVADLQQGSRAGYRLVLREVRHRVIGQNSLPAEAWVDTLDDALQVIG
FT                   KAREARVFQSVLAATRERQPALLPWLQRQPLRALSLAEVWPQLLDLVAWLQAHPRPGVY
FT                   LRQVDLPGIHSKFIEAQRGVLAELFDLALPPDAIDATAGGAAQFARRYGFRDKPLRVRL
FT                   RFLDPRHAAWVSGTDADYTLTQQAFARLDPPAVRRVFVTENEINFLAFPPVADGLVVFG
FT                   AGYGFEAMSQAGWLHRRALHYWGDIDTHGFAILDQLRAHFPQARALLMDHDTLLAHEAQ
FT                   WVDEPQPTQRDLPHLDDAERWLYDDLRWRRLRDAPVRLEQERIGFGRVEQVLAALSCGG
FT                   VPSGA"
FT   gene            complement(241426..242085)
FT                   /locus_tag="Lcho_0226"
FT   CDS_pept        complement(241426..242085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0226"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: mpt:Mpe_A0262 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32501"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q3"
FT                   /protein_id="ACB32501.1"
FT                   /translation="MLRGLLAALLLANLMFFSWSRGWLDDVVGLSPQRDREPQRLAAQI
FT                   APEALQILPPATLTRRAPPPVCLEAGPFTPAELPQAESALRRALPEGGWALLTRERPGS
FT                   WMAYMGRYNSKVTMQRRAEELRRREVAFEEVRNLPDYEPGFIFGRYNREADARESVRRL
FT                   QEQKVRFARVVRLEPPSTSHVLRVPKADPATQERLTQIDDLPQGRKLQPCGRDSRP"
FT   sig_peptide     complement(242023..242085)
FT                   /locus_tag="Lcho_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.706 at
FT                   residue 21"
FT   gene            complement(242079..242867)
FT                   /locus_tag="Lcho_0227"
FT   CDS_pept        complement(242079..242867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0227"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; KEGG: mpt:Mpe_A0263 biotin
FT                   acetyl-CoA-carboxylase synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32502"
FT                   /db_xref="GOA:B1Y7Q4"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q4"
FT                   /protein_id="ACB32502.1"
FT                   /translation="MPSTILNWDAEDLWLALEPHAPGLSIEVLPETASTNTALLERARA
FT                   GDSAPCLLVAERQNAGRGRLGRSWSSAPGRSLTFSLACPLAPADWSGLSLAVGLALAEA
FT                   LHPRIGIKWPNDLWLRGDDRKLGGILIETLMAPGSADGARQVVVGVGLNIEPLGDAETA
FT                   PFGSGYACLQELDPAASAPLALHRVALPLWRALQDFERHGLAPLLPRFAARDVLAGRPV
FT                   QAGDRHGTACGIAPDGALLLRDAAGQIHAVHSGEVSARPC"
FT   gene            complement(242876..243415)
FT                   /locus_tag="Lcho_0228"
FT   CDS_pept        complement(242876..243415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0228"
FT                   /product="nuclear protein SET"
FT                   /note="PFAM: nuclear protein SET; KEGG: mpt:Mpe_A0264
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32503"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q5"
FT                   /protein_id="ACB32503.1"
FT                   /translation="MPTRRASPAPERPARAPKPAPVAAVEAPPRKDPRRIQVRRSGVHG
FT                   KGVFALQPLKKGELLIEYKGEMIGWDEALRRHPHDPAQPNHTFYFHVDEQRVIDGAVNG
FT                   NAARWINHACAPNCEAEIDGDRIFIKARRAIKAGEELFFDYQLVIDERYTARLKKDYAC
FT                   WCGHKTCRGTMLAPKR"
FT   gene            243539..246169
FT                   /locus_tag="Lcho_0229"
FT   CDS_pept        243539..246169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0229"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: mpt:Mpe_A0265 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32504"
FT                   /db_xref="GOA:B1Y7Q6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q6"
FT                   /protein_id="ACB32504.1"
FT                   /translation="MSKSLVIAEKPSVAQDIVRALTTTSGKFEKHAEHFENDHYVVSSA
FT                   VGHLVEIRAPEEYDVKRGKWSFNNLPVVPPHFDLEPIDKSKGRLSALVKLIKRKDVTHL
FT                   INACDAGREGELIFRLIEQYALGAKVGTKPVQRLWLQSMTPQAIRDGFEKLRSDAEMRG
FT                   LAEAARSRSEADWLVGINGTRAMTAFNSRDGGFFLTTVGRVQTPTLSIVVEREEKIRKH
FT                   VSRPYWEVRADFGAAAGLYEGKWFDPKFKKDDDLERRADRLWSEAEADAIAAAVRGRTG
FT                   TVREEAKPSTQASPLLYDLTTLQREANGRFGFSAKTTLSIAQALYEKHKVLTYPRTDAR
FT                   ALPEDYVPVAKETLAMIASEDLPGPLRELAQHARKALDAGYVKPVKRVFDNSKISDHFA
FT                   IIPTLQAPRSLSEIEAKLYDMVVKRFIAVFYPSAEFMVTTRITEVPVAQSASQSLPKGV
FT                   TSPLQFQTNGKVLVNPGWLAVYGKDAQDEDANLVPVKPGETVQAEELRISPLKTRPPAR
FT                   YNEATLLSAMEGAGKLIDDEELKAAMQEKGLGTPATRAQVIEGLILEKYMLREGRDLIA
FT                   TAKAFQLMTLLRGLAIEDLTKPELTGQWEYQLSQMEKGQLSRDAFMHGIADMAQRIVKK
FT                   AKEYDRDTIPGDYATLKAPCPNCGGVVKENYRRFACVGRDANGSSGAEGSGCGFSISKI
FT                   PGSRSFELHEAEAFLRDHKIGPLEGFRSKAGWPFTAELKLVRDDEINNWKLEFDFGEDA
FT                   KKDDESGEPVDFSAQTSLGSCPKCKGHVYEHGTSYVCEHAVGAPQTCDFKTGKIILQQP
FT                   VTHEQMNKLLIEGKTALLDGFVSNKTKRKFKAFLVFDKKEGKVVFEFEPRAARVPAKKA
FT                   AAKAS"
FT   gene            246166..247317
FT                   /locus_tag="Lcho_0230"
FT   CDS_pept        246166..247317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0230"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: GAF domain protein; metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; KEGG: saz:Sama_3396 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32505"
FT                   /db_xref="GOA:B1Y7Q7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q7"
FT                   /protein_id="ACB32505.1"
FT                   /translation="MTIPEALHLLEVGAHSHDSVTSRLAVLHAQIRRLVPAVDRISCAL
FT                   HEPEDGLLKTFVHSTTSAQPLQAYQFRLADSASLSALVRERGERVIDDMQTELHGHGHA
FT                   HTEWLLAQGYRSSYTLPLFDHENLIGLLFFDALTPSAFQPLVCERLRPYASLIAMLLSQ
FT                   ELSTMRMLVGSIQIAREFANLRDIETGSHLSRMAAFAQLIALRLAHARGYDDEFIEHVY
FT                   LFAPLHDIGKIGVPDHIMLKPGALDADEWRQMTEHVDKGEQIVERLIETFSLAHLAGVQ
FT                   VLRQIVAGHHERIDGSGYPRGLRGAELPDAARIITVADIYDALRSERPYKPAWRHDEVA
FT                   AELRRMAAAGRLDAEMVEALLAEPAALEAIRTRFHDADGVAAC"
FT   gene            247339..248295
FT                   /locus_tag="Lcho_0231"
FT   CDS_pept        247339..248295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0231"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mpt:Mpe_A0268
FT                   putative MdcF malonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32506"
FT                   /db_xref="GOA:B1Y7Q8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q8"
FT                   /protein_id="ACB32506.1"
FT                   /translation="MTWDLAYKLLALFAMIAIGYGATRLGVLGGADGQRALASAAFGLF
FT                   LPALLFRTTAGIDLSDLPGPLLLAFFGPLVLWALAIWYVYRRRGPAHPADPAVRAVSLS
FT                   FGNTVQVGLPFAAALFGEAGLQLHLAIVSLHALVLLSLLTVLAEVDIAHAAARRGSAAA
FT                   LGSLLLTIARQTLIHPVVLPVLAGLAWHLTGWQLHPVADNMLLTLGQAGVPLCLVLIGA
FT                   SLAQYGLGSSWQRLLGLVMLKLLLLPAIVAALGVWVFGLRGLPLAVLVMAAALPSGSNA
FT                   LLFAQRYRTLEGEASAAIVLSTLGFALTAPLWLSLLL"
FT   gene            complement(248341..248832)
FT                   /locus_tag="Lcho_0232"
FT   CDS_pept        complement(248341..248832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0232"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: neu:NE1377 protein of unknown function DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32507"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7Q9"
FT                   /protein_id="ACB32507.1"
FT                   /translation="MSHSSPIPTPPRPGRPPRVVLETSVVISALMFGGGAGAQLRRAWQ
FT                   EGYCRPLLCKATVLDLTRSLASPQLGLSRHEQEQLLGDYLPHALKVRVPEASGPAPADE
FT                   PAALAFVRLAMAGRAHVLVSGDVGLLAMQGRLSCRVMALEPFLNHIASAGIRPLALRPR
FT                   "
FT   gene            249060..250733
FT                   /locus_tag="Lcho_0233"
FT   CDS_pept        249060..250733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0233"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mpt:Mpe_A3350 putative
FT                   sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32508"
FT                   /db_xref="GOA:B1Y7R0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R0"
FT                   /protein_id="ACB32508.1"
FT                   /translation="MSSIPINATKKAVPPAMTPEERKVIFASSLGTVFEWYDFYLYGSL
FT                   AAIIAKQFFAGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTILIM
FT                   GLATFIVGILPNYESIGVAAPVILIALRMLQGLALGGEYGGAATYVAEHAPHGKRGAYT
FT                   AWIQTTATLGLFLSLMVILGTRTAIGEAAFADWGWRIPFIVSIALLAISVWIRLSMNES
FT                   PAFKKMKEEGKTSKAPLSESFGQWKNLKIVILALIGLTAGQAVVWYTGQFYALFFLTQA
FT                   LKVDGATANVLVAASLVIGTPFFIVFGALSDKIGRKPIIMAGCLIAALTFFPLFKALTQ
FT                   AANPDLATAQANAKVTITADPKECSFQFNPTGTKKFTSSCDIAKQVLAGASVSYDNIEA
FT                   TGPAKITVGTTVIEGYTSAGLAADEAKKKDAEFKKAVADALKAAGYPAKADPAKVDKLK
FT                   IIVILTILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTTAFAIV
FT                   AQTGNMYNGLWYPIIIAGATFVIGMLFIKETKDVDIYADD"
FT   gene            250841..251014
FT                   /locus_tag="Lcho_0234"
FT   CDS_pept        250841..251014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_3750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32509"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R1"
FT                   /protein_id="ACB32509.1"
FT                   /translation="MWKIAVGFAAFAGLGLYMLMQSGANVDMGGEQHGMPAHEAAPAAS
FT                   APAVAASAASGA"
FT   sig_peptide     250841..250912
FT                   /locus_tag="Lcho_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.573 at
FT                   residue 24"
FT   gene            251063..251251
FT                   /locus_tag="Lcho_0235"
FT   CDS_pept        251063..251251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32510"
FT                   /db_xref="GOA:B1Y7R2"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R2"
FT                   /protein_id="ACB32510.1"
FT                   /translation="MRAPLLSQRLVALFGAALLLFNFPLLALWDHEAMVFGLPLFPAAL
FT                   FAVWAVLIGLLAWLMES"
FT   sig_peptide     251063..251146
FT                   /locus_tag="Lcho_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            251255..254062
FT                   /locus_tag="Lcho_0236"
FT   CDS_pept        251255..254062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0236"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: Na+/solute symporter; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   KEGG: rfr:Rfer_3779 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32511"
FT                   /db_xref="GOA:B1Y7R3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R3"
FT                   /protein_id="ACB32511.1"
FT                   /translation="MLSPALVLGASFAYLTLLFAVAWWGDRRAAQGRSVIGNAWVYALS
FT                   MAVYCTAWTYFGSVGRAASGGVWFLPIYLGPMLAMVLAWSVVRKMIRIARTYRLTSIAD
FT                   FVASRYGKSPLLAGLVTLITVVGIVPYIALQLKAVAGGYALMTTPLGEPLLAAPALWRD
FT                   STLYVALALAGFTMVFGTRHLDSTERHEGMVLAIAFESVVKLVAFLAVGVFVTWGLFGG
FT                   PADLFERAAAVPELRQLLRLEQGRSFPYAQWFALTMLSMLSVIFLPRQFQVMVVENVDE
FT                   SHLKRAAWAFPAYLLLINLFVLPIALGGLLYFSAGGMNADSFVLSLPLAGGQSALALIA
FT                   FVGGLSAATGMVIVEAIAVSTMVCNDLVMPLLLRWPRWSRAGDLTGLLLAIRRAAIVAI
FT                   LLLGYLYYHLAGEAYALVSIGLISFAAVAQFAPAMLGGMYWQGGTRNGALAGLAAGFAV
FT                   WAYTLMLPSLAKSGWLPDTFLRDGIGGIALLRPEQLFGLGGLDNLTHSLFWSLLANVGA
FT                   YVVMSLAHRPTARELSQALLFVEVFGAAGQGSAATAPVFWRGRARVEDLRALAARFLGE
FT                   AKARELFERHARELGLADVSQLQPDGRLVHRVETQLAGAIGSASARVMVASTVEEDTLG
FT                   LDDVMRIVDEASQLRAYSRQLEEQQASLRRATDELRAANEKLQGLDRLKDDFMSSVTHE
FT                   LRTPLTSIRALAELMRDEADMPEAQRQQFMTIIVGETERLSRLVNQVLDMAKIESGHAT
FT                   WIDDDVDLVALAGHAAQTLAELMRERGITLQLDLPAEPLPTLRADPDRLLQVLLNLLSN
FT                   AAKFTPAGAGRIVLTVRGDAQGATVTVADNGPGVPAHEQALVFEKFRQGGDGLNRPQGT
FT                   GLGLPICRQIVEHYGGRIWLRSDPGQGATFGYTLPWTAAAAGGMVPTMNTMQETAHEPQ
FT                   DTDRR"
FT   sig_peptide     251255..251323
FT                   /locus_tag="Lcho_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.783 at
FT                   residue 23"
FT   gene            254034..254408
FT                   /locus_tag="Lcho_0237"
FT   CDS_pept        254034..254408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0237"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   rfr:Rfer_3778 response regulator receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32512"
FT                   /db_xref="GOA:B1Y7R4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R4"
FT                   /protein_id="ACB32512.1"
FT                   /translation="MSHKILIADDEPNILISLEYLMKRQGFDVRLARDGQEALDAVAAD
FT                   CPDLLLLDVMMPRKSGFDVCQALRADERYNALRILMLTAKGRDTDLAKGLALGADGYMT
FT                   KPFSTRELVERVKAMLEAPR"
FT   gene            254405..256600
FT                   /locus_tag="Lcho_0238"
FT   CDS_pept        254405..256600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0238"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rfr:Rfer_3777 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32513"
FT                   /db_xref="GOA:B1Y7R5"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R5"
FT                   /protein_id="ACB32513.1"
FT                   /translation="MKPGLRLAGLLGLVGVLLLLWLGLTGAMVWSSLAQAERAVVRAAL
FT                   EPHAGLVVMAFGLGMLGLAAALHAWLLPRLAAPAQLLDQVRVLRDTDVQREITPAGSAT
FT                   LRALAEAVNELVRQREALRQDMAAQVLAASRGVELERSRLAALMAELTQSVVVCNLDGR
FT                   VLLYNNRARMQFRALSSAPSLAGGSELLGLGRSIYAAFDPKLVTHALESIQQRLQRGAD
FT                   NPLAQFVTITRSGQLLRVQMAPVREVAPADGNAVADPAALSGFVLMLDNVTREFEQDTL
FT                   RDQLLHGLTEGSRGSLANLQAAVEMLDDDGLDDALRQRFHGVIRDEVRAMSARIQTLAD
FT                   SATEGIKTRWPMEDMLGADLVAAAQRRIESQLALRVSQAEVDTALWLKVDSYSLLLALH
FT                   YLAGRLQDEFETKLVQLRIAAAPGGQHAHLDLIWMGQSLSTETVMSWELDPMRIGAETS
FT                   PLSVRDVADRHGGEFWFERERVRHQAFFRFLLPLAAPQEQLDASRLMSAMHAEGRPEFY
FT                   DFDLFKRLEQHHVLDERRLVDLAYTVFDTETTGLNPSDGDEIIQIGATRISGGKLRRQE
FT                   SFEQLVDPQRPIPPAGIPIHGIKPDMVAGQPTIDHVLPAFHAFAQDTVLVAHNAAFDMR
FT                   FLQLKQDRTGLVFDQPVLDTLLLSAVVHPNQESHRLEAIAERFSITVVGRHTALGDAMV
FT                   TAEVFVRLIPLLHAMGIETLGQAREAAQKTYYARLKY"
FT   sig_peptide     254405..254515
FT                   /locus_tag="Lcho_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 37"
FT   gene            256769..257434
FT                   /locus_tag="Lcho_0239"
FT   CDS_pept        256769..257434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0239"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   protein of unknown function DUF1289; KEGG: rfr:Rfer_3823
FT                   YbaK/prolyl-tRNA synthetase associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32514"
FT                   /db_xref="GOA:B1Y7R6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R6"
FT                   /protein_id="ACB32514.1"
FT                   /translation="MSNPNPDPSAVLPERVREVAAWLAERAHADAPRWLDVSARTAQEA
FT                   ADALGVALGQIAKSVIFRRLADDVAVLVVTSGDRRVDEAKVVAQVGAIGRADAAFVRAR
FT                   TGFVIGGVAPVAHRNEPVVLLDRDLWRFESIWAAAGHPKAVFRLVPDDLRRLCAGAAAH
FT                   DVTESAAPRSPCIDVCKLDPVTRLCEGCLRTIDEIAGWSAMSDEARLEVLRQLPGRRA"
FT   gene            257542..259233
FT                   /locus_tag="Lcho_0240"
FT   CDS_pept        257542..259233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0240"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ajs:Ajs_3752 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32515"
FT                   /db_xref="GOA:B1Y7R7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R7"
FT                   /protein_id="ACB32515.1"
FT                   /translation="MSAHPTPDRAPRTPMAREDIQLVFASSFGTVYEWYDFYLYGALAP
FT                   IIAAQFFSGLDPSAGFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLITILLMGL
FT                   STCVVGVLPSYADIGLAAPVMLIALRLLQGLAMGGEYGGAATYVAEHAPPDRRGFYTSW
FT                   IQTTASLGLFMALVVILLLRQVLGDAAFADWGWRIPFLLSIVLLAVSVWVRLSMNESPA
FT                   FQRLRETGRTSKAPIRESFGNWRNLRVVLLALFGLVAGQAVVWYTGQFYALFFLTGVLR
FT                   VEPSTAQWLMVAALAIGTPFFVFFGALADRIGRKPIIMAGLALAAAGYFPMFEALTVAA
FT                   NPALAEAQANARIVVAADPATCSFQGSPIAREVDFASPCDLAKRFLTEQGASYDNRALP
FT                   RGAATVVRVGSTEITPPRGGLAAGGHGFDDRSVRAIAAFRAEVRQALLAAGYPERADPA
FT                   RMDKVGIVVILSAFMLLVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLMPS
FT                   IAFAIVAHSGNMYDGLWYPVLIAAGSCAIGLLLVRETRGRDIYAQD"
FT   gene            complement(259269..260456)
FT                   /locus_tag="Lcho_0241"
FT   CDS_pept        complement(259269..260456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32516"
FT                   /db_xref="GOA:B1Y7R8"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R8"
FT                   /protein_id="ACB32516.1"
FT                   /translation="MKLTALERQLAPFLAVQACLSTLVGFGAVLVYADAGMAATVHYTL
FT                   LMLTVTMAGTVLAYTSGRRWRIDARPLVRAAFGVPGLLLWWADGQPVVLAVAVGGFLGL
FT                   SWGARLWIELSVLDDTGRDGYAAHATVLSVVVSLLTTLVASLWLTFWGDERGAASLYGL
FT                   YAGVALLGLAVAPRHLPDTPPLRLHAPLAVLRQREFVACLPLFLLESGLLGIGMVMSAS
FT                   GAIEALGKASHYGWVATVATLAGAIALYALRHRRQAHNRDGWMGLACLGITAAHALLGA
FT                   SAWLPALYVLHLLLHAVTLPFWLASEQVLNQRTLDIHGALADRIVAREATLWFFRVTML
FT                   TGFWFAARQASPAWVLATGAGLMCAAALLEYAVGRAWLRHVPAGPAATAPSAADG"
FT   sig_peptide     complement(260355..260456)
FT                   /locus_tag="Lcho_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.811 at
FT                   residue 34"
FT   gene            complement(260453..261088)
FT                   /locus_tag="Lcho_0242"
FT   CDS_pept        complement(260453..261088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0242"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   KEGG: mpt:Mpe_A3043 DNA binding response regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32517"
FT                   /db_xref="GOA:B1Y7R9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7R9"
FT                   /protein_id="ACB32517.1"
FT                   /translation="MIRVMLVDDHTIVRMGFRMLLQSCADDIEVVAEAPGGEEALAQID
FT                   TVLPDVLVLDLSMPGMTGLELLRRLKARNSRTRVLVLSAHEDTAHPRRVLAAGALGYLS
FT                   KRGAPEALVEAVRRVAAGQRYIDPAIAQKLALAQLGDEPSPVDALSEREFEVFVQLARG
FT                   AGVADIAAQLKLSASTVGTHLYNVKQKLGASNQAELTLLALRWGLIEA"
FT   gene            complement(261085..262557)
FT                   /locus_tag="Lcho_0243"
FT   CDS_pept        complement(261085..262557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0243"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   mpt:Mpe_A3044 methanol utilization control sensor protein
FT                   MoxY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32518"
FT                   /db_xref="GOA:B1Y7S0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S0"
FT                   /protein_id="ACB32518.1"
FT                   /translation="MDSSSPASPLPIAPHGTATTADPPPVAIAGRSLRFRIHLLLVGLM
FT                   GLFIVALLAQQIEATRTSVREEIIAGNRVAGQLLERVGWVYRLSGPGALLEFLNQLGRV
FT                   RANEITLRSDAGQELYRSPPPVYKQGRAAPDWFAHWVAPPPQRQVIRLPGGQLVVEADP
FT                   SRAILDGWDDLMRMATLGGAALVLINVLVFWYVGRTLRPFKTILAGLVRLERGDYAARL
FT                   PALPGREAASIGNAVNRMAAAVDGQLQARLAAYEAQRTLAESREIARQIEHHTEHERRE
FT                   MARELHDELGQSVTAIRSVANSLVHRLGERDAAGREMAALISSEAARLYEVMHGLIPRL
FT                   TPLALDSLGLADALADLVGGARQRPGSPQIDLNTQALPAGLDAELALAAYRVVQEALNN
FT                   ALRHSGAARIDIAASADDTGLQITVEDDGAGLPPDWQRPGHYGLRGLRERLRGLGGELQ
FT                   IEGLAAPRSGVRVSASLPLVGPPATPAERPRT"
FT   gene            262651..262833
FT                   /locus_tag="Lcho_0244"
FT   CDS_pept        262651..262833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0244"
FT                   /product="coenzyme PQQ biosynthesis protein A"
FT                   /note="PFAM: coenzyme PQQ biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32519"
FT                   /db_xref="GOA:B1Y7S1"
FT                   /db_xref="InterPro:IPR011725"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S1"
FT                   /protein_id="ACB32519.1"
FT                   /translation="MVLAMTPRAPAPTLHPHQHTLLASLTRTANPIEGDLMTWTTPAAC
FT                   DFRFGFEITMYIAAR"
FT   gene            262948..263862
FT                   /locus_tag="Lcho_0245"
FT   CDS_pept        262948..263862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0245"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B; KEGG:
FT                   azo:azo1187 pyrroloquinoline quinone biosynthesis protein
FT                   PqqB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32520"
FT                   /db_xref="GOA:B1Y7S2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S2"
FT                   /protein_id="ACB32520.1"
FT                   /translation="MKLLVLGSAAGGGFPQWNCHCDNCRGVRAGAPGLRARTQSSVAVG
FT                   GPHDWVLVNASPDVLTQLQRAPALNPGRALRDSGIAGVVLVDGQVDHTTGLYMLREGQR
FT                   PLPLWCTDPVFEDLTQGNPILGVLAHFCGVGRHRIPLDGSSFEVAGVPGLKITALALQS
FT                   KAAPYSPHREQPVPGDNVGLLFENTASGGRLFYAPGLGAIDAPVWELMNSADVVMVDGT
FT                   FWTDDEMIRLGLSKKTARDIGHLAQSGEGGMIEQLGRLKPGTRRLLIHINNTNPILDEG
FT                   SPQRRELDAAGIEVCHDGIEIEF"
FT   gene            263895..264674
FT                   /locus_tag="Lcho_0246"
FT   CDS_pept        263895..264674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0246"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="KEGG: acr:Acry_0323 coenzyme PQQ biosynthesis
FT                   protein C; TIGRFAM: coenzyme PQQ biosynthesis protein C;
FT                   PFAM: TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32521"
FT                   /db_xref="GOA:B1Y7S3"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S3"
FT                   /protein_id="ACB32521.1"
FT                   /translation="MNTSVGNRFGTPFNAPATTRPRDPAAPAWDHVAFEAQLREQGKSY
FT                   HIHHPFNVMLNTGRATPEQIRGWVANRFYYQIAIPVKDAAVLSNCPDRAVRREWIQRIL
FT                   DHDGFEIGGVKDEGGIEAWIRLGIAVGLTREEITDLRHVIPAVRFAVDAYVNFARHAPW
FT                   QEAVCSSLTELFAPEIHKQRLATWPEHYGWIESEGLQYFRNRVSQARRDVEQGLAVTLG
FT                   HFQTRDQQERALEILRFKLDILWAMNDAMAQRYGADA"
FT   gene            264671..264967
FT                   /locus_tag="Lcho_0247"
FT   CDS_pept        264671..264967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0247"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D; KEGG: azo:azo1189
FT                   PqqD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32522"
FT                   /db_xref="GOA:B1Y7S4"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S4"
FT                   /protein_id="ACB32522.1"
FT                   /translation="MNAPTAERAALTDDSVPSVARGFRLQWEEAQGNHVLLYPEGMVKL
FT                   NRSAGEILTRCDGVATVAQIVSQLEAAFGASGLRADVEAFLMMAREQRWVTWA"
FT   gene            264964..266124
FT                   /locus_tag="Lcho_0248"
FT   CDS_pept        264964..266124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0248"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="KEGG: azo:azo1190 pyrroloquinoline quinone
FT                   biosynthesis protein PqqE; TIGRFAM: coenzyme PQQ
FT                   biosynthesis protein E; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32523"
FT                   /db_xref="GOA:B1Y7S5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S5"
FT                   /protein_id="ACB32523.1"
FT                   /translation="MTNMAASAVAVQPPGPPLWLLAEVTYRCPLHCVFCYNPLDFAAQG
FT                   KAQELPTADWLRVLREARALGAVQCGFSGGEPLERDDLEEMIAEAHRLGFYTNLLTSGV
FT                   GLTAQRAAALKAAGLDHIQLSFQDSTRELNDFLSHTKTFGLKQQVGELIKANGWPMVMN
FT                   VVIHRLNIDHIDRIIAMADALGAEYLELANSQYYSWAHLNRDHLLPTHDQLKRAEAITD
FT                   EWRVKLADRMKLFFVAPDYHEGTPKKCMNGWGNVFLTITPDGTALPCHTAKMLPGLAFP
FT                   NVQTSSVREIWQDSEGFNRFRGTGWMKEPCVSCPDKEKDLGGCRCQAFLLANDPAAADP
FT                   VCPKSPHHGVVKAAVEASEAGAVPVRPLVFRDPKNSKAFVSPVGQS"
FT   gene            266201..266644
FT                   /locus_tag="Lcho_0249"
FT   CDS_pept        266201..266644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0249"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mpt:Mpe_A3490
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32524"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S6"
FT                   /protein_id="ACB32524.1"
FT                   /translation="MYKHLFVPVDGSELSQRAMDGSIALALQLGARITGFVAEPDLPLS
FT                   AVSGNVSTFTSRVEAHDARTEAHAYALLGQFEERARTAGVEFSGKHLRTPAVDQAIADA
FT                   AEESGADMIVMVTHARGTLGELVFGSHTKTLISRTKLPLLVLH"
FT   gene            complement(266729..267115)
FT                   /locus_tag="Lcho_0250"
FT   CDS_pept        complement(266729..267115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32525"
FT                   /db_xref="GOA:B1Y7S7"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S7"
FT                   /protein_id="ACB32525.1"
FT                   /translation="MKTHRRSQAPGATRYPPAPPIRQAPVAHAGQQHPIGLYLRVWLLL
FT                   FVLSTLSYGVDYVQLQGLLRWSLIVTLMLAKAGLIVAVFMHLAWERLALIVAILLPPLA
FT                   VLVLVGLMWAEGLHTFVTRGLFFN"
FT   gene            complement(267120..267866)
FT                   /locus_tag="Lcho_0251"
FT   CDS_pept        complement(267120..267866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0251"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   pol:Bpro_0729 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32526"
FT                   /db_xref="GOA:B1Y7S8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S8"
FT                   /protein_id="ACB32526.1"
FT                   /translation="MRQHHQPLQRHPPPVRLAAISPHAATLTAGGAAPGWPGLRADWSG
FT                   DRRAFHGVSWGKAMMWFFLLSDTFVFSCFLVGYMTVRLSTTAAWPNPSEVFALQVGGTD
FT                   VPLLLIAIMTFVLITSSGTMAMAVNCAYRRARRPAALLMLATAALGLLFVSMQAFEWSK
FT                   LIHEGVRPWSNPMGAAQFGAAFFMITGFHGLHVSAGVIYLIVVALRVLRGHCERSGNYQ
FT                   IVEIAGLYWHFVDLVWVFIFAFFYLW"
FT   gene            complement(267893..268561)
FT                   /locus_tag="Lcho_0252"
FT   CDS_pept        complement(267893..268561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0252"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   pol:Bpro_0728 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32527"
FT                   /db_xref="GOA:B1Y7S9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7S9"
FT                   /protein_id="ACB32527.1"
FT                   /translation="MSRIVIPASATHPRASAPAPQRPHPTPLHADNVSVGLWLLMAVIG
FT                   VLFALFALAYVMRMAQGDASSIALPWLLWPSTALLLAASVAMQSARRAVRRAQHRPARQ
FT                   RLLAAAALACGFLVTQFGAWQALADAAVTPAGNPAASFFYLLTALHGLHVAGGLVAWEH
FT                   SWRAITQGRQDEPDGDLRASAWRVALCARYWHFLLLVWLGLLGLLGGVTPELARAICGV
FT                   "
FT   gene            complement(268558..270324)
FT                   /locus_tag="Lcho_0253"
FT   CDS_pept        complement(268558..270324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0253"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: pol:Bpro_0727 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32528"
FT                   /db_xref="GOA:B1Y7T0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T0"
FT                   /protein_id="ACB32528.1"
FT                   /translation="MDHLDADAAESHPAPHGFWTTYVWSQDHKVIAIQYAITAIAVGLV
FT                   GLVLSHLMRAQLGFPGKLDFITPERYYQFVTLHGMIMVVYLLTALFLGGFGNYLIPLMV
FT                   GARDMVFPYLNMLSFWVYLLSVIVLMASFFVPGGPTGAGWTLYPPQAILPGTPGSDAGI
FT                   VLMLVSLLIFIVAATMGGLNYVTTVLQARCEGMTLLRMPLTVWGIFVATILALLAFPAL
FT                   FVSGVMMLLDKTLGTSFFMPALISMGAPSATQGGSPLLFQHLFWFFGHPEVYIVALPAF
FT                   GIVSDLISVHARKAIFGYRTMVWAIVAIGGLSFVVWAHHMFVSGMNPYFGFFFATSTLI
FT                   IAVPTAIKVYNWVLTIWRGDIHLTVPMLFALAFVCTFTVGGLTGLFLGNVSVDIPLSGT
FT                   YFVVAHFHMVMGVAPILVVFGGIYHWYPKITGRLLDDRLGKLHFWITFLGTYAIYFPMH
FT                   YLGVLGMPRRYYNFDAYQFIPASAHALNVFISVLAFVVGAAQLLFLFNLAWSARRGRPA
FT                   GPNPWRAASLEWQTPQTPPGHGNWGAQLPVASRWAYAYSVPGAHDDYIAQNAVRGAGGI
FT                   EPDPPRTGGKSP"
FT   gene            complement(270367..271176)
FT                   /locus_tag="Lcho_0254"
FT   CDS_pept        complement(270367..271176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0254"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   har:HEAR1115 putative cytochrome c oxidase polypeptide II
FT                   precursor (cytochrome cbb3 subunit 2) (oxidase aa(3)
FT                   subunit 2) ith a fused monohemic cytochrome c at its C
FT                   terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32529"
FT                   /db_xref="GOA:B1Y7T1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T1"
FT                   /protein_id="ACB32529.1"
FT                   /translation="MALSIALIVIVVGSVLFHLLSPWWTQPLASNWQRMDDTLTITLLI
FT                   TGAFFVVIHAVVIYAILRWRHRAGRGQARAAYTPDDHRLERWLIGITTVGIVALLAPGL
FT                   VVYADYVRPPADALKVEVVGQQWRWRYRFAGEDGLLGRSDIRHVSADNPFGLDPADARG
FT                   HGDVLIDDNELHLPLARPVQLQLRSNDVLHDFFVPPFRARMNIVPGSVTTFWFTPTQTG
FT                   RFELMCAQLCGIGHHLMRGVVVVEDEAAFQAWLAAQPRYAAATGGKP"
FT   gene            complement(271228..271731)
FT                   /locus_tag="Lcho_0255"
FT   CDS_pept        complement(271228..271731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_1857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32530"
FT                   /db_xref="GOA:B1Y7T2"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T2"
FT                   /protein_id="ACB32530.1"
FT                   /translation="MELRLHPHEWSRPRPDWRAAVVAGLVAGAVLMVLDMAWSVFVTGD
FT                   SPWRSSYRVAAIVLGRDVLQATADFDSLIVGVALVTHYVLGVAFALLLATLLTGFHYDA
FT                   SPGMTELIGTLFGAVLYLVNFHGLAQFFPWLAEWRGWAAFIAHLVFGMTAATLYWQFAR
FT                   HEPS"
FT   gene            271937..272416
FT                   /locus_tag="Lcho_0256"
FT   CDS_pept        271937..272416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0256"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pol:Bpro_4739 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32531"
FT                   /db_xref="GOA:B1Y7T3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T3"
FT                   /protein_id="ACB32531.1"
FT                   /translation="MSIPARLSSYLEQRGLHYEVCTHPHSHNSAQTARNAHVMRQQLAK
FT                   SVLLEDDEGPLVAVVPADQMVLVGVVARMLGRKQLHLSDEAAMMRLFDGCERGALPPVG
FT                   MAWGVETVVDETLESMDAVYLEVGDHEHLLRMPHDDFHRLMSSARHGHIGKLPMH"
FT   gene            272459..273232
FT                   /locus_tag="Lcho_0257"
FT   CDS_pept        272459..273232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32532"
FT                   /db_xref="GOA:B1Y7T4"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T4"
FT                   /protein_id="ACB32532.1"
FT                   /translation="MEHIVDRSGRMQAAPQVRSIHAARPLVWLSRGWADMSVAWQASLG
FT                   HGALVAGFGLALLLAAAGATYLVPTLIGGFLLVAPFVAIVHYGLSRQIEAGETPDSTAA
FT                   WAAVRHNPGSIGLYGLMLALALISWERVAAIVFALFVGADVPDLRNLAADVLFSGRHLG
FT                   LLAAFLGAGAVMAAVVFALSVVTVPLLLERDVDLITAAVTSVQCCLRNPLPMLCWAVLI
FT                   GCLTAWGFAMAMVGLVVIFPLLGHASWHAYRDLIE"
FT   gene            273378..273941
FT                   /locus_tag="Lcho_0258"
FT   CDS_pept        273378..273941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0258"
FT                   /product="peroxiredoxin"
FT                   /note="TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: psa:PST_3162 alkyl
FT                   hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32533"
FT                   /db_xref="GOA:B1Y7T5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T5"
FT                   /protein_id="ACB32533.1"
FT                   /translation="MSLINTTVQPFKAQAFLNGKFIEVTEASLKGKWSTLIFMPAAFTF
FT                   NCPTEVEDAAANYAEFQKLETEVYIITTDTHFAHKVWHETSPAVGKAQFPLVGDPTHQL
FT                   TRAFGVHIEEEGLALRGTFIINPEGQIKTAEVHSNEIARDVSETLRKLKAAQYTAKNPG
FT                   QVCPAKWNDGAATITPSLDLVGKI"
FT   gene            274065..275648
FT                   /locus_tag="Lcho_0259"
FT   CDS_pept        274065..275648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0259"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glutaredoxin; KEGG: rso:RSp0246 probable
FT                   alkyl hydroperoxide reductase (subunit F) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32534"
FT                   /db_xref="GOA:B1Y7T6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T6"
FT                   /protein_id="ACB32534.1"
FT                   /translation="MLDQALKTQLKSYLERLQRPIELVASLDDSAKSAELRGLLQDIAG
FT                   LSPQVSLVERDDGQRTPSFTIGAAGADEAARIRFAGIPLGHEFTSLVLALLQTGGHPPK
FT                   VEAGVIEQIRGLDADLSFEVYMSLTCHNCPDVVQALNLMAVLNPGVKVTTIDGALFQDE
FT                   IAQRQIMAVPTVFLNGQEFGAGRMTVEDILAKVDTGAAARDAARLAKQAAYDMLIVGGG
FT                   PAGAAAAVYAARKGIRTGVVAERFGGQTLDTMAIENFISVKETDGPKFAVALEQHVKQY
FT                   DVDIMNAQRAVKLTPATEPGGLAELELANGAVLKARSVILSTGARWRNVNVPGEAEYKN
FT                   KGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVKHVTLIEFADALRADAVLVA
FT                   KLKSLPNVAIHTSAQTTEIHGDGQKVNGLSYTDRVSGAGHRIDLEGVFVQIGLVPNTEW
FT                   LKGTIELSRHGEIIIDARGQTNVPGIYAAGDVTTVPFKQIVIAVGEGAKAALGAFDHLM
FT                   RTPVVAAETA"
FT   gene            complement(275673..276581)
FT                   /locus_tag="Lcho_0260"
FT   CDS_pept        complement(275673..276581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0260"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pol:Bpro_4560 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32535"
FT                   /db_xref="GOA:B1Y7T7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T7"
FT                   /protein_id="ACB32535.1"
FT                   /translation="MDRITGVQLFIRIVETASFSKAAAEFGITQPTATKSVAAMEQRLG
FT                   ARLLHRSTRGVTPTEVGALYYDKCKLIAREIDAADNLATLLQSQVGGTLRISTSVAFGR
FT                   RVVVPLVLRYMRLHPEVTVDLAFDDRYVNLVEQGVDLAIRMGRLADSALGARYLGTNPW
FT                   LMAAAPAYLREHPAPATPADLAAHACLVYSSVQGDERWSLTTPAGEETSVPVRGPLRSN
FT                   NLSAVLAAARAGMGLAVLPWYVARESVADGAITPVLADHLLPAQAVHAVFPSPRLVPLK
FT                   VTNFIAFLQQALAGEWWRQAL"
FT   gene            276698..277339
FT                   /locus_tag="Lcho_0261"
FT   CDS_pept        276698..277339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0261"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: aav:Aave_3987 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32536"
FT                   /db_xref="GOA:B1Y7T8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T8"
FT                   /protein_id="ACB32536.1"
FT                   /translation="MKIDVVSDVVCPWCAVGVSSLLRALDTLGDELRPTLHFQPFELNP
FT                   TLGPGGQDIVEYLGRKYGSTPEQIERTHEQIAQRGAAVGFTFNMDLRTRTYNSFDAHRL
FT                   LHWAGLEGEDFQLLLKLALLRSYFTEGLDPGEPALLVSLAAEAGLDAARALDILASDEY
FT                   ADEVREREAFYQSQGIASVPSFIINDRHLIAGGQPPEFFVQALRQIAEEG"
FT   gene            277484..278080
FT                   /locus_tag="Lcho_0262"
FT   CDS_pept        277484..278080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0262"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bch:Bcen2424_3500 pyridoxamine
FT                   5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32537"
FT                   /db_xref="GOA:B1Y7T9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7T9"
FT                   /protein_id="ACB32537.1"
FT                   /translation="MTEDARLAELAQIESAVWAELERAVHSRFTGSVAPHEWRRAVLAT
FT                   QDADGPQARSVVLRDLLLDSRELVFYADARSPKVAQLRRDPRAVLLCWSSTLGWQLRLR
FT                   CHIEVETSGLDVTARWAHIRNRPAAHDYLSPLAPGTPMPDGHGGLVVTPLPPERLRETF
FT                   AVLSARVEAIDWLELHARGQRRAVFDAQGARWLTP"
FT   gene            278230..278706
FT                   /locus_tag="Lcho_0263"
FT   CDS_pept        278230..278706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32538"
FT                   /db_xref="GOA:B1Y7U0"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U0"
FT                   /protein_id="ACB32538.1"
FT                   /translation="MSTLPVPSAATPSARPAFAPDPQALRLGYAGLIPFVIGVLLAWLV
FT                   EHDEAHDFVLRAINVYAAVIVSFLGALHWGLAMRAQPGESTAFVWGIVPSLVGWVAALM
FT                   PAGAGLVIQSAVLIACYLVDRRAYPLHGVAGWLTLRFRLTVVATLSCLLAASFA"
FT   gene            278717..280453
FT                   /locus_tag="Lcho_0264"
FT   CDS_pept        278717..280453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0264"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein; KEGG: mpt:Mpe_A0594 family M61
FT                   unassigned peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32539"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U1"
FT                   /protein_id="ACB32539.1"
FT                   /translation="MISYHVEIADLHAHLFRVTLTVAKPAAEQTLSLPVWIPGSYLVRE
FT                   FSRHLSGLQARQGQTERALEQLDKRSWRVRCSGRAALVVSYLVYAFDASVRTAWLDSQR
FT                   GFFNATSLCLCAEGHEADEHRLSLGALPAGWQVATGLERTAKSGKNAWRADSYDALIDH
FT                   PFELGAFWRGEFTACGVPHEFVVAGAAPGFDGERLLADARRICEAQIRFWHADAKPPFE
FT                   RYVFMLAATDDGYGGLEHRNSTALICNRRDLPRRPAPGNGVGLSEGYVTLLGLISHEYF
FT                   HTWNVKRLKPAEFAPYDLTRENPTELLWFFEGFTSYYDDLFLLRAGLIDEGRYFKLLAK
FT                   TINQVLGTPGRQVQSVAQSSFDAWLKYYRPDENTANATVSYYTKGALVALALDLTLRRA
FT                   GRGTLDAVMRTLWQRSGGGPISEADIAAALQQVGRRDFADELAAWVHGTADLPLAELLA
FT                   LIGVELKRDPPTLAQRLGARVNESLKVQAVLRGGAAEQAGLAAGDELLALDGWRLAKLD
FT                   DLPLYGGFERPLPLLVSRDRRLLTLTLPAPKVEGAVSLTATPKAAAPALRRRRSWLAQS
FT                   LA"
FT   gene            280523..281725
FT                   /locus_tag="Lcho_0265"
FT   CDS_pept        280523..281725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32540"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U2"
FT                   /protein_id="ACB32540.1"
FT                   /translation="MRRPALAWAALAALLLHLLALDELHESMQSIDFQKPAMERLEAVY
FT                   TRVLAPVEPVEVSAPAARPTARRANRAAVVAAAASAPAEAASAAAASAAESVARAADEA
FT                   ASAALAGIAPGVDEAASAPTADLAAAAASASAAAGEAGPDGSTAGEPAASAVARAAPAS
FT                   APASPQAGASAPLPAFSWPASTRLSYKLDGWYNGEVLGQAQVEWLRHGERYQVHLDVSV
FT                   GPSFAPLVRRRMSSDGRITADGLAPQRYEQETTQIIGRDRRVQMAFSDTAIVLSNGERV
FT                   PAQADVQDTASQFIQIIYLLTTRPALRQVGQSIEFGLALPKRVDRWVYEVVERVVVETP
FT                   LGPIPTLHVKPRRRAAPGNLTAQMWYAPSLQMLPVRIRIEQDEGVWIDLRLERAPEQSG
FT                   P"
FT   sig_peptide     280523..280585
FT                   /locus_tag="Lcho_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.908 at
FT                   residue 21"
FT   gene            281825..282622
FT                   /locus_tag="Lcho_0266"
FT   CDS_pept        281825..282622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0266"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   aav:Aave_0882 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32541"
FT                   /db_xref="GOA:B1Y7U3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U3"
FT                   /protein_id="ACB32541.1"
FT                   /translation="MSTPYENILVETRTGAGSMNYGWIALNRPKALNALNDPLMDELGA
FT                   ALLAFEADDRIACIVLTGSEKAFAAGADIAMMAPFNFANAYRKGLISRNWDTLRQVRKP
FT                   VIAAVAGFALGGGCEVAMACDLIIAADNARFGQPEVKLGIIPGAGGTQRLPRAVGKSKA
FT                   MDLALTGRMMDAAEAERAGLVSRVVPAADLHAEADKIAQTLCGYSTLTLMAIKESVNRA
FT                   YEAPLSEGLLFERRLFHALFSSNDQKEGMGAFLEKRPPSFTHD"
FT   gene            complement(282692..283399)
FT                   /locus_tag="Lcho_0267"
FT   CDS_pept        complement(282692..283399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0267"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /note="KEGG: mpt:Mpe_A0592 putative thiol:disulfide
FT                   interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32542"
FT                   /db_xref="GOA:B1Y7U4"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U4"
FT                   /protein_id="ACB32542.1"
FT                   /translation="MLLRLIAIACSLWAGAALADEADIRKTLTERFQGLPKIDEIRPTP
FT                   IPGVFEVRIGTDLMYSDAKGTYLLQGSLIETATRRNLTEERVDKLTAIDFNSLPLKDAV
FT                   VWKNGKGTRKIAVFADPNCGYCKKLERDLLNVKDVTVYTFVIPILGGDSPEKSKSIWCA
FT                   KDSTATWRNWMVDGTLPPKAMGNCDASAIERNSALARKHRVTGTPAIVFEDGSRAPGAI
FT                   PAAEIERRMAAKS"
FT   sig_peptide     complement(283340..283399)
FT                   /locus_tag="Lcho_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(283501..284640)
FT                   /locus_tag="Lcho_0268"
FT   CDS_pept        complement(283501..284640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0268"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding; KEGG: mpt:Mpe_A0591 monooxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32543"
FT                   /db_xref="GOA:B1Y7U5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U5"
FT                   /protein_id="ACB32543.1"
FT                   /translation="MAAMNTSATRPLDVCIRGGGPVGASLALALSRLGWQVGLVTPPAP
FT                   TRSGPDVRTYALNAGSAQLLRELRVWDALPADAITAVDEMQIDGDAGGHLEFSAWQQTV
FT                   DALAWIVDAAALDAALAEALRYAPHVQRLEQNAPAALLAVCEGRDSATREALGAVFERW
FT                   PYGHHAVAARLVADAPHHGIARQWFRSPDILALLPFDRPQIGHSYGLVWSLPEARAAEL
FT                   MACTPADFEAALDEASGGAAGTLRLSGERAGWPLMLARAQRWIGPGWALLGDAAHAVHP
FT                   LSGQGLNLGLADVRCLVRVLHDARRTSPWRSAGDERTLRRYARERLAPTRMMGTLTDGL
FT                   LQLFAAPPGPLKDLRNHGLTLVDRLSPVKRWLAARALDT"
FT   gene            complement(284699..284935)
FT                   /locus_tag="Lcho_0269"
FT   CDS_pept        complement(284699..284935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0269"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   pna:Pnap_4767 phage tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32544"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U6"
FT                   /protein_id="ACB32544.1"
FT                   /translation="MDPILGMIALFSFPFQMEGWAPCDGRLLPIMQYQALYSLMGTTYG
FT                   GDGQSTFGIPKMAAPAQGMSYQIALNGVYPQRA"
FT   gene            285092..285964
FT                   /locus_tag="Lcho_0270"
FT   CDS_pept        285092..285964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0270"
FT                   /product="MOSC domain protein beta barrel domain protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: mpt:Mpe_A0589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32545"
FT                   /db_xref="GOA:B1Y7U7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U7"
FT                   /protein_id="ACB32545.1"
FT                   /translation="MSDFIPDDGSSPLRIASLHIYPVKSCTGITLDEALLADTGLDRDR
FT                   QWMVVDPQGLFVSQRETPRMALIQVSLKNGEAVLRAPGMLALHLPLDAAEDPIDVQVWD
FT                   DRLSACSMGRTADQWLSDFLGRPLRLARFDPEQQRYSSRRWTGDVAAANLFSDGYPILV
FT                   TATASLADLNRRLAERGQPAVTMARFRPNLVLDGIDAYAEDHLDELQFDTPDGPVTLRL
FT                   VKPCPRCPIPNTDPLTAERGDEPGLTLAGYRADARLDGAVTFGMNAVIVAGIDCRLKVG
FT                   QKGRGTVRY"
FT   gene            286128..287222
FT                   /locus_tag="Lcho_0271"
FT   CDS_pept        286128..287222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0271"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: mpt:Mpe_A3166 putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32546"
FT                   /db_xref="GOA:B1Y7U8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U8"
FT                   /protein_id="ACB32546.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGVVE
FT                   LPDPRLQGLAQIVQPERILPAIVEFVDIAGLVAGASQGEGLGNKFLSHIRETDAIVNVV
FT                   RCFEDDNVIHVAGKIDPISDIEVIQTELCLADLGTVEKTLHRSLKAARSGNDKEAAALV
FT                   KVLEKCQAALDQAQPVRSLDFSKEELVILKPLCLITAKPAMFVGNVDETGFENNPFLDR
FT                   LKEFAAKQNAPVVAICAKTEAELAEMEDDDRAMFLAEMGQDEPGLNRLIRAAFKLLGLQ
FT                   TYFTAGVKEVRAWTIHVGDTAPQAAGVIHTDFERGFIRAQTIAYDDFITFKGEQGAKDA
FT                   GKMRAEGKEYVVKDGDVLNFLFNV"
FT   gene            287248..287481
FT                   /locus_tag="Lcho_0272"
FT   CDS_pept        287248..287481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32547"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7U9"
FT                   /protein_id="ACB32547.1"
FT                   /translation="MAQPKITRIEVQRYKAARNLTGLVEIGFDGLFLQKPAPEDREPMH
FT                   VLSMSEADARSLMMLLKSQLAEFDKRKARSQR"
FT   gene            complement(287506..288492)
FT                   /locus_tag="Lcho_0273"
FT   CDS_pept        complement(287506..288492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0273"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: rru:Rru_A1847
FT                   transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32548"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V0"
FT                   /protein_id="ACB32548.1"
FT                   /translation="MARLKISHKTVYRYREPVQFSEHRFMCRPRDSHDLRLLHTGIRIV
FT                   PQPTVRWAHDVNANSILVATFAEPADELSFESTFVAEHFPVEPDVDMIEDYAERLPFSY
FT                   EAREIPDLARSIERHHADPGHRVDAWVRAVCAEAGTDKTLDVLIAITRAIKAQFSYESR
FT                   DEEGTRTPTETLALGSGSCRDFALFMMEAVRSLGLAARFVSGYLYDDTLTDAAGGVVGG
FT                   GATHAWVHVYLPGAGWLPFDPTNAIIGGRNLIRVAVARDPSLAVPLTGSYVGPKEAYLG
FT                   MTVEVTVTVEPEADAAAADGDEPAAAQAGPASVAAPAAAAVTAPDAA"
FT   gene            complement(288567..290096)
FT                   /locus_tag="Lcho_0274"
FT   CDS_pept        complement(288567..290096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0274"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: dac:Daci_1594 protease Do; TIGRFAM: protease
FT                   Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32549"
FT                   /db_xref="GOA:B1Y7V1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V1"
FT                   /protein_id="ACB32549.1"
FT                   /translation="MKTKNLTVALVAAGVLGAGAATAIGLPDWMKGRPAVNTEATQAAA
FT                   QTQLALGTVNPAPVPMLAGDGAVPDYRGIVRKFGPAVVGVVVKGERQASAEEQAQGGLP
FT                   PGIENDPYFRFFRGMPGQPGRGRGAQPNQPFRGQGSGFIISTDGLILTNAHVVRDAKEV
FT                   TVKLSDRREFVAKVLGVDPATDIAVLRIEAKDLPTVRLGDPRQLEVGDPVLAIGAPYGL
FT                   EQSATQGIVSAKGRSLPGDAVVPFIQTDAAVNPGNSGGPLFDGGGAVVGINAQIYSQSG
FT                   GYQGLSFAIPINVALQVKDQIVATGRASHARLGVTVQDVDQALAESFGLPRPDGALISS
FT                   VAPQSAAAAAGLQPGDVITAVNGEPVLRSGSLSSLIGLSTPGQKVQLKVWRDHAARDID
FT                   AKLGSADDGANPTAQAEDDAQRGGQIGLALRPLTPQERRDAQVEQGLLVEQVTGAARSA
FT                   GIEAGDVLLAINGQPVRSIEQLQSVLMKKPKRVALLVQRDGDKIFVPVSLG"
FT   sig_peptide     complement(290025..290096)
FT                   /locus_tag="Lcho_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.720 at
FT                   residue 24"
FT   gene            complement(290209..291537)
FT                   /locus_tag="Lcho_0275"
FT   CDS_pept        complement(290209..291537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0275"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: azo:azo3673 two-component
FT                   system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32550"
FT                   /db_xref="GOA:B1Y7V2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V2"
FT                   /protein_id="ACB32550.1"
FT                   /translation="MTSIRTRLLVGLLLLIALAAGAFAALTYRQVRAESEALFDYQLRQ
FT                   MALSLRDQGEIAPEQAGALAEEDFDFVVQIWSADGRSIYASRLHTDLPARALLGLAEIR
FT                   AGDQLWRTYSVATRTRVIQVAQPVRVRQRLAADAALRSVTPLLLLAPLLALALGVLATW
FT                   ALRPLQQLAAGLRQRDAASLAPLPADGLPDELAPLARALNELLQRVGGSLDTQRAFVAD
FT                   AAHELRSPLTALKLQLHLLQRAGNDGDRDEAIATLRAGIERAVRLVEQLLALARSEPGA
FT                   PPVEPSELDLCDIARQALAHNEALARSRGSRVESDLPAQAVTVSGDPAALLALARNLVD
FT                   NALRYSPEGAQVRISVHMQDGRPVLEVDDSGPGIPAAERERVFQRFVRGAASSSESGSG
FT                   LGLAIVRQVAQRHGATLTLDDSPLGGLRVTLRFPEPAVAPAST"
FT   sig_peptide     complement(291463..291537)
FT                   /locus_tag="Lcho_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(291534..291638)
FT                   /locus_tag="Lcho_0276"
FT   CDS_pept        complement(291534..291638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32551"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V3"
FT                   /protein_id="ACB32551.1"
FT                   /translation="MKLPDARDERRAAPKPARIPVGDRSTYPSDEGLN"
FT   gene            complement(291635..292342)
FT                   /locus_tag="Lcho_0277"
FT   CDS_pept        complement(291635..292342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0277"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bte:BTH_I0673 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32552"
FT                   /db_xref="GOA:B1Y7V4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V4"
FT                   /protein_id="ACB32552.1"
FT                   /translation="MRLLLVEDDPMIGSSLRAALRLEGMAVDWVRDVAAAQATLASERF
FT                   DLVLLDLGLPPGRAASNLTEPGTDGLSLLRSLRSREDSTPVIVLTARDGPGDRVRGLDA
FT                   GADDYLVKPFELDELAARIRAVMRRHSGRAQSVLSHRGVTLDPATRQVTRDGQPVLLSA
FT                   REIAVLEALMTRPGAMLTRAQLEDRLYGWGEEIESNAVSVYIYQLRRKLGPGFIRTMRG
FT                   LGYSLADDGGASP"
FT   gene            complement(292342..292767)
FT                   /locus_tag="Lcho_0278"
FT   CDS_pept        complement(292342..292767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0278"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family;
FT                   Helix-turn-helix type 11 domain protein; KEGG:
FT                   rfr:Rfer_3882 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32553"
FT                   /db_xref="GOA:B1Y7V5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V5"
FT                   /protein_id="ACB32553.1"
FT                   /translation="MDSVDLQLLALLRADARTSVATLAHKLGVSRGTVSNRITKLEDAG
FT                   VIVGYTVRLKPDSQPQHISAWMSIAIEGNQTRQVIATLLGEPGIAALHDTNGRWDLLAE
FT                   LRSADLAELAAVLERVRLIKGIGATETSIHLQTYRMG"
FT   gene            292901..293950
FT                   /locus_tag="Lcho_0279"
FT   CDS_pept        292901..293950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0279"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   rfr:Rfer_3883 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32554"
FT                   /db_xref="GOA:B1Y7V6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V6"
FT                   /protein_id="ACB32554.1"
FT                   /translation="MTTLLTPHDIARIVAAQGIAGALQRLAGYIEADYRRWAQFDKTAR
FT                   VASHSESGVIELMPAADGQLYSFKYVNGHPGNTRLGLSTVMAFGVLADVATGTPQLLSE
FT                   LTLTTALRTAAMSALAARVLARPGSRTMALIGNGAQSEFQALAFHHLLGIDEIRLFDID
FT                   RAATAKLMRHLGGVPGLALIACDSTAQAVRGAHIVTTVTADKTCATILTPEMIEPGMHL
FT                   NAVGGDCPGKTELHADILLGASVFVEYEPQSRIEGEIQHLPADFAVTEFWRVLLRVAPG
FT                   RRRDDEVTVFDSVGFALEDFAALRWLRDSARELGLGETIDLIPQMADPKDLFGELRLPP
FT                   AQHRPVRAA"
FT   gene            complement(293979..295118)
FT                   /locus_tag="Lcho_0280"
FT   CDS_pept        complement(293979..295118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0280"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: dar:Daro_1057 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32555"
FT                   /db_xref="InterPro:IPR008311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V7"
FT                   /protein_id="ACB32555.1"
FT                   /translation="MHRRFFLQSSSLALLASWRPALQAGPPAEPMPRQRLAAAWRGRGA
FT                   DGIERDQVGVLDCDWAAGTVRVVGAIDNPGRAHGLLAGADGGFIAVANRPGRWLLAADR
FT                   DGRLRQRLDLSQEPSARTLNGHVEADTSTGWLYTPETDPARGEGWISVRDPRSLRRVAQ
FT                   WPSHGVDPHQCLLDGDGGLIVANGGIWRTPQGHKVALERMAPSLVRLDARSGALLGQWR
FT                   LADARLSIRHLAWTDDDSRRLGVALQAEHDTPQQRAEAPLLALWDGRSLQTPGARAPAT
FT                   AGGYAGDIAAGPGGGLILSGQKAGLGLWWHPGAPQRLQTVAELGDACALASFADAAERG
FT                   VLIAAARGLARWHPRQAAQALPWPMPMAPDNHWVLLADA"
FT   sig_peptide     complement(295044..295118)
FT                   /locus_tag="Lcho_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.810 at
FT                   residue 25"
FT   gene            295377..297548
FT                   /locus_tag="Lcho_0281"
FT   CDS_pept        295377..297548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0281"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="TIGRFAM: catalase/peroxidase HPI; PFAM: Haem
FT                   peroxidase; KEGG: vch:VC1560 catalase/peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32556"
FT                   /db_xref="GOA:B1Y7V8"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1Y7V8"
FT                   /protein_id="ACB32556.1"
FT                   /translation="MDPKTSAGQCPVMHGANTTAAQSNTAWWPNALNLDILHQHDTKTN
FT                   PLGEGYRYREAVKQLDVAALKADLTALMTRSQPWWPADWGHYGGLMIRMAWHAAGSYRV
FT                   ADGRGGAGTGNQRFAPLNSWPDNANLDKARRLLWPIKKKYGAKISWADLIVLAGNVAYE
FT                   SMGLKTYGFAFGREDIWHPEKDIYWGSEKAWLAPTGGEGSRYSGQRDLENPLAAVMMGL
FT                   IYVNPEGVDGQPDPLKTAQDVRVTFARMAMDDEETVALTAGGHTVGKSHGNGSAANLGP
FT                   APEGADVHEQGLGWNNHSSRGIGRDTVTSGIEGAWTTHPTQWDNGYFKLLLGYDWELKK
FT                   SPAGAWQWEPVGIKEDDKPVDVEDPSIRLNPIMTDADMAMKMDPAYRRISERFAADQAY
FT                   FSEVFARAWFKLTHRDLGPKSRYIGPEIPAEDLLWQDPVPVGPTAYDVGAVKSRIATSG
FT                   LSVGELVATAWDSARTWRGSDYRGGANGARIRLAPQKDWAGNEPERLARVLAVLEPIAA
FT                   AAGASVADVIVLAGNVGVELAAKAAGFDVTVPFAPGRGDATQAQTDVESFEVLEPVADG
FT                   FRNWQQRSFAVQPEEMLLDRAQLMGLSAPEMTVLVGGLRVLGANHGGSKHGVFTDRVGA
FT                   LTNDFFVTLTDMAHAWVPTGRNSYEIRERASGVVKYTATRADLVFGSNSVLRAYAEVYA
FT                   QDDSREKFVRDFVAAWVKVMNADRYELQG"
FT   gene            complement(297560..298906)
FT                   /locus_tag="Lcho_0282"
FT   CDS_pept        complement(297560..298906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0282"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: pmy:Pmen_0570 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32557"
FT                   /db_xref="GOA:B1Y7V9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7V9"
FT                   /protein_id="ACB32557.1"
FT                   /translation="MTTPDSADSGSAPEHDKSIAQQREGEVAIDASQLQPGVHVRLPVN
FT                   WMDHPFIRSSFVVSDQNQVEKIAALNLPQLFSDPRRCTAAPLPRPKVVVPPSPEEERQR
FT                   AELAAQMAREMADKQARAEKVDALRTRLDAAQTHYLNAAKEVGAAIKGFESDPRKSVRQ
FT                   MMEVSAQSAAVLIRDADSALALIAEKGHTDAHNAHALSVMTLALLLGKQARLPEKVLTD
FT                   LGVAALLHDIGKVSLDLSLLRKPEHERSHFEETIYQGHCRKGHELAERAGCLSAQALGA
FT                   VLHHHERADGNGYPSGLTGAHIPMAARIIGIANRFDNLTNPADPRRALSPSESLATMWS
FT                   KEKAAFDVTLLQLFVRAMGIYPPGSLVQLSDGHSGVVVASAATESPLRPQVLIYEPSVP
FT                   RRHAEIIDLSRDDSLKIERSLHVQERSEAEIDYLLPRRKLSWLHIGSQP"
FT   gene            299046..302096
FT                   /locus_tag="Lcho_0283"
FT   CDS_pept        299046..302096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0283"
FT                   /product="protein of unknown function DUF748"
FT                   /note="PFAM: protein of unknown function DUF748; KEGG:
FT                   mpt:Mpe_A2234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32558"
FT                   /db_xref="GOA:B1Y7W0"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7W0"
FT                   /protein_id="ACB32558.1"
FT                   /translation="MSPVAAPDLPASPSPTPPRRLPRWARVSLWTAGTLAVLALAWTLL
FT                   IGSWLPGFIKPRIEAAGSDALGTPMVLDRITIAPWKLVVQLDGLRVGEAAAPLFTLGSA
FT                   QTQLSLQSIRQRAPVLASLTLQQPRVNVERLSAERFNFSAVLDHVKARQAAQPPAPPSP
FT                   EPARFALHNIRLEGGALHYRDAVLQTEHHVEALRIGLPFISSLPSDVETEVQPLLEARI
FT                   DGSALRLDGHARPFAAAKPAELALDLQGVKLADWASLLRAVLPAEFAPQVLQGQLDTKL
FT                   AISFEARPEPAPPSLRVRGELAISGFDLAVPTQGVTAAWQSFRLEQIDLAPLERQHALA
FT                   RVVIDGLKLQLVRQKPGAAKPVASASAASASTAAAAAPAPLQWQLGELRCNGCAVTLRD
FT                   TGMTPPVQLDLADLQLGLKNLAGPATAPIGFDLATQLSAVTGSAKPSPGTLKLAGEVSG
FT                   LLPGPAGAALPLALSADVGLDAIDLRALQPYLAPHLNLTLVGAKVGTAGQLKVNAPAGA
FT                   GFAPETLRVDYRGAASLAGLQTQDSVNGADFVGWRRLALDGLAVDWQGGPGGGATNADL
FT                   GRISLDGLQARVILHPDAHLNLADIVKREQGAAPQSITTPQTTPQTTARASAAPASAPV
FT                   PAAGGAAAPLKLRWQAITLRDGAVQFTDNFVKPNYTARLTQLKGEVSALSSAAPEPARV
FT                   SIAGALDDGAPLRIAGRLHPLGARLYTDIEASARGIALTRMSTYAERYAGYAIEKGSMS
FT                   VNVRYKIEQGKLEAENQLFLDQLTFGDAVDSPDALKLPVRLAVALLKNSRGEIDLRMPV
FT                   AGTLDDPQFSIGGVVWQVVLNLLERAVTAPFAMLFGSDSNEASHLPFEPGSAELDAAAR
FT                   ERLDAMARRLIDKPTLKLEATGRADPLTDGAALQSAFAEKARAQAAASAASAAAKGTAR
FT                   PDMRTFQVPAAASAPAAAASAPVPALDAAALDRALRQLADQRADRVMAYLATQLPAERV
FT                   LLTRSQLTSERPEGDQGPTSRVQFELR"
FT   gene            complement(302103..302588)
FT                   /locus_tag="Lcho_0284"
FT   CDS_pept        complement(302103..302588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB57 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32559"
FT                   /db_xref="GOA:B1Y7W1"
FT                   /db_xref="UniProtKB/TrEMBL:B1Y7W1"
FT                   /protein_id="ACB32559.1"
FT                   /translation="MPLEALAAALEASTLSQALRASLWLYPLVNTGHVVGIALLFGAIV
FT                   PLDLRLIGCWKPVPLEPLARVLIPVAVCGLVLALSTGALMFATRPPDYLDEPLFGIKLA
FT                   LLGAALCNALLLRRSPHWALLGVTPGAAPRPAWRWAGALSIGLWLGVITLGRLIGYR"
FT   gene            complement(302627..303022)
FT                   /locus_tag="Lcho_0285"
FT   CDS_pept        complement(302627..303022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB56 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32560"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW33"
FT                   /protein_id="ACB32560.1"
FT                   /translation="MSHTPADLPRRLWLRSLSGAALAAALALPAVAHHGWSWAEDGNSE
FT                   LRGEIVAAKLGNPHGELTLNVDGVRWIVEVGQPWRHERIGLKDEMLVKGVTLSVAGHRH
FT                   ADPKKKVFKAERVFIDGQKFDLYPDRD"
FT   sig_peptide     complement(302924..303022)
FT                   /locus_tag="Lcho_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 33"
FT   gene            complement(303088..304092)
FT                   /locus_tag="Lcho_0286"
FT   CDS_pept        complement(303088..304092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rfr:Rfer_3194 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32561"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW34"
FT                   /protein_id="ACB32561.1"
FT                   /translation="MTQPASPRTPRNPTRRQALALGLAAAAAPFTPARADTAKPIRLLV
FT                   GFPPGGGTDAIARLLAERLKDELGTQVLVENKPGAGGQLAAQTLKASPADGSTFFLSHD
FT                   HTITILPLVVKTPGFEPARDFVPVAGFATFVNALAVSGGTPARSLAEYVAWVKTQGGGK
FT                   GAVGVPAPASVPEFLVKVIGEKYQLDLISAPYRGSAPMITDMLGNQIAAGVGSIPDFIE
FT                   NHKAGKIRVVAVLGGARQPALPDVPTFAELGLAGFEDVPYYGVFAPAGTPKANLDAFSA
FT                   ALGRVIAQREVHDRLTAMGLSVGLTSGTQLGAREQAYAKVWQRIIAASGFKPQ"
FT   sig_peptide     complement(303985..304092)
FT                   /locus_tag="Lcho_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(304124..304612)
FT                   /locus_tag="Lcho_0287"
FT   CDS_pept        complement(304124..304612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0287"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: pol:Bpro_2665
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32562"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW35"
FT                   /protein_id="ACB32562.1"
FT                   /translation="MKHDPDTLFAQFAERIGYLIDPGIKVGGNYTAVVADGDQVFVSGQ
FT                   TPRVGDRMAYTGRVGAEVALADAQRAAQICALRALTLLQRELGTLSRVRKILRVNVFVQ
FT                   CSAEFTQISEVGDGASEVFATVLGPAGLHTRTSVGVFALPKNAAVEIDLIAAAQPFNA"
FT   gene            complement(304617..306161)
FT                   /locus_tag="Lcho_0288"
FT   CDS_pept        complement(304617..306161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0288"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: mpt:Mpe_A0600 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32563"
FT                   /db_xref="GOA:B1XW36"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW36"
FT                   /protein_id="ACB32563.1"
FT                   /translation="MSHPTPHHAAAPVAADENQLMAERREKLAVMRQQHREAGTAVFPN
FT                   DFKPTDHATDLHRLHEGKDNEALEAAPITACVAGRMMLKRVMGKACFATLQDGSADGNP
FT                   RIQLYITQDNVGAELLAAFKHWDLGDILGATGTLFRTKSGELSIKVTGLRLLTKSLRPM
FT                   PDKHHGMTDQEQKYRQRYVDLMTDDSARERFRARSKAVASIRGFMLEHQFLEVETPMLH
FT                   PIPGGANAKPFVTHHNALDQEMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRH
FT                   NPEFTMMEFYAAYWNHHDLMDFTEQLLRHAATQATGSARVSYAGKPVHLDEPFARLSVR
FT                   DSLVVHAGLTEAEADDAAVIHAKLTSLGEEPPKHWKLAALQFGLFEAVVEEKLWQPTFI
FT                   IDYPVEVSPLARASDANPSITERFELFITGREFGNGFSELNDAEDQAARFQSQVANKDA
FT                   GDEEAMFYDADFIRALEYGMPPTGGCGIGIDRLMMLLTDSVSIRDVVLFPALRREG"
FT   gene            306280..307338
FT                   /locus_tag="Lcho_0289"
FT   CDS_pept        306280..307338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0289"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   bbr:BB0155 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32564"
FT                   /db_xref="GOA:B1XW37"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW37"
FT                   /protein_id="ACB32564.1"
FT                   /translation="MPADLPITDRKIKFALVGCGRIAKNHFASLAQHGERAELVAVCDN
FT                   QPAALAAAVAATGAQGFASLDALLAGSDADIVVLTTPSGLHSRQAIRVAAAGRHVLSEK
FT                   PMATKWDEGMAMVQACRDAGVKLFVVKQNRLNATMQLLKKAIDAKRFGRIHMVTVNVFW
FT                   TRPQSYYDEAPWRGRWDMDGGAFMNQASHYVDMVDWLVGPVDNVHAYTATQARDIEAED
FT                   SGIMSLRLRAGGLASIAVTMLTYPKNLEGSITVLGERGTVRIGGVAINDIQHWEFDEPR
FT                   PEDAEVKAASYATTSVYGFGHPLYYDNVINTLRGEAHAEVDGYSGLRSLEVLIAGYRSA
FT                   RDGVRVGLPLVF"
FT   gene            307358..307942
FT                   /locus_tag="Lcho_0290"
FT   CDS_pept        307358..307942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0290"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: reh:H16_B0032 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32565"
FT                   /db_xref="GOA:B1XW38"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW38"
FT                   /protein_id="ACB32565.1"
FT                   /translation="MNHWQHESAIVDPGAQLGEGTKVWHFSHVCPGARIGDNCSLGQNV
FT                   FIANDVSIGHGVKIQNNVSVYDAVTLEDDVFVGPSVVFTNVYNPRAAVSRKSEYLQTRV
FT                   KRGATLGANCTIVCGTTIGEYAFVGAGAVITRDVPAYALMAGVPARRIGWMSRNGERLG
FT                   LPVHGEDEAVCPVTGERYRLRGDVVTRVSTS"
FT   gene            308023..309195
FT                   /locus_tag="Lcho_0291"
FT   CDS_pept        308023..309195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cau:Caur_3354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32566"
FT                   /db_xref="GOA:B1XW39"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW39"
FT                   /protein_id="ACB32566.1"
FT                   /translation="MGPIQHADVTFGDLTVIVGPQATGKSLFLQTLKLLIDRDQIHETF
FT                   RHHSMNFSGRADAFLDGYYGRGMAGAWNVEQSRLVWNGKRVQLPEYASPTKSPKSKVMH
FT                   ERLFYIPAQRVMSLPGGVSQNFGQFNYGDPYALRVFSDAVHDLIQNEFGAKGELFPAAN
FT                   RLNATLREPINAHLFGGNKLVIDDSDFTKRLALAVPGQSKPLGFLSWSAGQREFAPMLM
FT                   GLYWLCAVRHPQRMSGRTQAEIIEWVVIEEPEMGLHPQGISAVLLMVLELLRRGYRVVI
FT                   STHSPVVLELVWALQEFKKLGADESDVRRLFDLKASAPAKDLGRVALGKDYRVYHFDRQ
FT                   HAVRDISNLSPGAEAIAESEWGGITGFSSRVNEVIAAAVNRADARTRLPH"
FT   gene            309195..309716
FT                   /locus_tag="Lcho_0292"
FT   CDS_pept        309195..309716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32567"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW40"
FT                   /protein_id="ACB32567.1"
FT                   /translation="MATSRKRTSTLAQTSAFDAAARAAGITPCTGLGAVKAEYRSGVSL
FT                   KPEHRHTASIDIDSHFHATEPTASRWDYGLGLRTESGDELMVWLEPHPASSTGEVQKML
FT                   DKLVWLKNKLAQPTFDGLRVLELTSLRRQIVLYRWLALTGSIRILPNSKEARRLTRAGL
FT                   SQPQRHVQLP"
FT   sig_peptide     309195..309266
FT                   /locus_tag="Lcho_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.686 at
FT                   residue 24"
FT   gene            309732..310880
FT                   /locus_tag="Lcho_0293"
FT   CDS_pept        309732..310880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0293"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   aminotransferase class-III; KEGG: bpt:Bpet4818
FT                   lipopolysaccharides biosynthesis aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32568"
FT                   /db_xref="GOA:B1XW41"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW41"
FT                   /protein_id="ACB32568.1"
FT                   /translation="MQFTDLKAQYTALKPQIDAGIQAVLDHGQYIMGPEVKALETRLAA
FT                   RTGVKHCVTVASGTEALLIALMALGIKAGDEVITSPFTFAATGEVIALLGARPVFVDIE
FT                   PDTCNLDATLIEAAITPRTRAIMPVSLYGQVADMDAINTVAARHGLPVIEDAAQSYGAT
FT                   YQGKASGGLSTIGCTSFFPSKPLGCYGDGGALFTDDDALAQAAREIRVHGQSARYTHTR
FT                   IGVGGRMDTLQCAVVLAKLERFDWELARRREIGARYHRLLAPLTALPNERGLGLITVRP
FT                   DRDSVWGQYTVFVPQRDKVQAALQAAGVPTAVHYPKPLHHQAAYAEFCCPDCCPNSIAA
FT                   AARVMSLPMSADLSEEDQDAVVAALAAALDALARDGAAPAAP"
FT   gene            310877..312157
FT                   /locus_tag="Lcho_0294"
FT   CDS_pept        310877..312157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0294"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bpt:Bpet1527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32569"
FT                   /db_xref="GOA:B1XW42"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW42"
FT                   /protein_id="ACB32569.1"
FT                   /translation="MSDPAPPAPTRGLLRATLTLLAGGAFAQALPLLLGPWLTRLYTPE
FT                   AYGRYQLFATVAINLSVVACARYEFALPLARADAEVQALRRLCLRILMVVSGLALLGGV
FT                   GWAWTQGAAWPLWLGPAVAVGGALSLATMLAARRQAFQVLAFGRVLQYGGAAIGQVGAG
FT                   LMQWGVSGLVMAPVLAQLATTWLLGRGAVKAPAADDAAALRLRDVARRWREFPLLNTPH
FT                   AFAGALQDTLAVGLIAATLGPAAAGFWGLALRYLKAPATLVGAAVSQALYPKLAEAGPG
FT                   VTLAGRAAVRRVMAVLMLAAAPLVLGLWALGPWLFGWLFGADWAESGQLARALALYIGA
FT                   HFVASPLAVVTMAWGAQAWALRLAIWGQLGFVLALVGGLQVGGLAGAGWAVSLVMAGYF
FT                   GWYFWRLANWPLAAGQASSAAGQGGTS"
FT   sig_peptide     310877..310960
FT                   /locus_tag="Lcho_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.936 at
FT                   residue 28"
FT   gene            312195..312881
FT                   /locus_tag="Lcho_0295"
FT   CDS_pept        312195..312881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0295"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: bpt:Bpet1526 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32570"
FT                   /db_xref="GOA:B1XW43"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW43"
FT                   /protein_id="ACB32570.1"
FT                   /translation="MVMIRAHLNRWRRRLLHALQFRTVFGERSQGRWLPNTRISPSTCI
FT                   EFEDRLTLGDHVYIGHFNLIEASGGVVIEEGVQITNHVSIVTHSSHRSQRLLGQAFVTW
FT                   PKGVPPPMAPEAPPELDWISGKPIERQRAAPKQPPGWVAGPVHIGAYSFIGPHSLIEAN
FT                   SRLGRGCIVCAGSQVRGEFTEFSILEGAPARVIGDARRADQRLLRQHPELHDLYAAWAG
FT                   EPGRAR"
FT   gene            312893..313990
FT                   /locus_tag="Lcho_0296"
FT   CDS_pept        312893..313990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0296"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bpt:Bpet1525 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32571"
FT                   /db_xref="GOA:B1XW44"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW44"
FT                   /protein_id="ACB32571.1"
FT                   /translation="MIAPVAARPGGWRHVLIGDAQSPHLLKWARALAPRVELYVASSRG
FT                   FDAGFDGLVSAERRLALDADVRHGGGNVATLRRLPELARWLRRIDADWLHPHYLTSHGT
FT                   LAVAARFGWRLRGRIVGSAWGSDILVTPQQGAAWRWLTRRVLRGCALSTSDSMHMAEQM
FT                   RRLGAGEVMVFPFGLEALPPPPPAKQPWLFFANRGLEPIYAPERVLDVFAAIAQQQPAA
FT                   RLVVANDGSLRAALQARAAAIGLGDRVRFVGRLDAVAQAREYARAAGYLSLPVSDSVSV
FT                   SVLEAMAHGCVPLLSDLPANRELVESGRNGLILTGMPQPAELAALMARADPIARDNRAW
FT                   VQQHGLFEPAVQRLLARLAQLMPER"
FT   gene            313987..315237
FT                   /locus_tag="Lcho_0297"
FT   CDS_pept        313987..315237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0297"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   plu:plu4805 WblI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32572"
FT                   /db_xref="GOA:B1XW45"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW45"
FT                   /protein_id="ACB32572.1"
FT                   /translation="MNILYLNHYAGAPSLGMEYRPYYLAREWARMGHRVHMVAAGFSHV
FT                   RSRQPLHDGAPLRAPLQQAIDGITYHWFPAPAYRGNGVGRVRNIGAFLGRVWRATDALI
FT                   TQIRPQVVIASSTYPLDIWVARRIARKAGAKLVFEVHDLWPLSPIELAGMSPNHPFIRL
FT                   CQWAEDTAYRDADVVVSMLPKVHDHMASHGLDLAKLHIVPNGIDPDEWAGTTASLRQDV
FT                   ATAIVRARAAGHSVVCYAGSMGLPNALDTLLDAAALLRDAPITLLLVGDGHERERLTAR
FT                   VQAEHLNRVQVFAPVPKAQIPALLDAIDIAYIGWQRVPIYRFGIAPNKLMDYMMAGCAV
FT                   LHSVEAGNDPVADAGCGLTVPPESPQAVAEGLRALAALSREDRHRMGERGRGYVQAHHT
FT                   YPVLARRFLAACGAQEG"
FT   gene            315240..316031
FT                   /locus_tag="Lcho_0298"
FT   CDS_pept        315240..316031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0298"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mpt:Mpe_A0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32573"
FT                   /db_xref="GOA:B1XW46"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW46"
FT                   /protein_id="ACB32573.1"
FT                   /translation="MSQRTPSPRPAPGSAARPLTAGGDLREIDAVAQRYERREAVAQAL
FT                   AASETLDRYSLLRPDVWQTVQERQRVMLQMLAARGWFDLASRRLVEVGCGAGGNLLEFL
FT                   RMGFVPQHLTGLELLRPRYAQARQVLPQQLRLHLGDAQRAPIAEESIDLVFQATVFSSL
FT                   LDDAYQQQLADTMWRWVKPGGAVLWYDFTVDNPRNPDVRGVPLARVRALFPGARVEARR
FT                   VTLAPPIARGICRLHPSLYRLFNSLPLLRTHMLVWLGKPAN"
FT   gene            316103..317281
FT                   /locus_tag="Lcho_0299"
FT   CDS_pept        316103..317281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0299"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: mpt:Mpe_A0607
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32574"
FT                   /db_xref="GOA:B1XW47"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW47"
FT                   /protein_id="ACB32574.1"
FT                   /translation="MSQPFLPFALPEIGDEEIAEVVDTLKSGWVTTGPKARRFEQDFAA
FT                   FLTEGAEPGAAPIECIAVNSATAGLHLALEALGIGAGDEVITTTHTFTASAEVARYLGA
FT                   DVKLVDIDPATLNIHPAAIEAAITPRTKAIVPVHYAGLAADMPAILDIARRHGLKVVED
FT                   AAHALPSTLGGRLIGTLGSDVTVFSFYANKTITTGEGGMIATRDPAIAARCKVMRLHGI
FT                   NRDAFDRFTAKVPSWYYEIVAPGFKYNLTDIAAALGIHQLRRAHAFQEKRDELASLYNE
FT                   LLAELPLILPPMPALGELHSWHLYVVRLTDHARIGRDALIEQLYAAGIGCSVHYIPLHL
FT                   HPYWRERYALRAEDFPHSQHAYERMLSLPLYTRMTADDVHRVVQALRTALLG"
FT   gene            317338..317943
FT                   /locus_tag="Lcho_0300"
FT   CDS_pept        317338..317943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0300"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: mpt:Mpe_A0608
FT                   putative sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32575"
FT                   /db_xref="GOA:B1XW48"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW48"
FT                   /protein_id="ACB32575.1"
FT                   /translation="MVKRLFDLAVASLALLLLAPLLAGVAIAVKLDTPGPVFYRQVRVG
FT                   RGGREFRIHKFRTMTHDPADRGPQLTVGADARITRVGAFLRHSKWDELAQLIDVWRGDM
FT                   SIVGPRPEVPRYVALYPADLREQVLSVRPGITDDCSLDFRDEGTLLAQSADPERTYVDQ
FT                   ILPIKLRLQARYVAQAGVRTDLRILARTFAVLAGRVTR"
FT   sig_peptide     317338..317424
FT                   /locus_tag="Lcho_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.772 at
FT                   residue 29"
FT   gene            317981..319852
FT                   /locus_tag="Lcho_0301"
FT   CDS_pept        317981..319852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0301"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   mpt:Mpe_A0609 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32576"
FT                   /db_xref="GOA:B1XW49"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW49"
FT                   /protein_id="ACB32576.1"
FT                   /translation="MIWQSLDSILTRIRPRREVLALAIDALVVAACWHITYLFRLGFER
FT                   WHSARPDYDVWVMLALVALYLGVFVALRVPKGMWRFSGFGEVQRLTLACAIAGLVGAVA
FT                   VLMAQLSQVPRAVLALHPVVSLMGLAMVRIGYRMLYEHMRGRISGSATETRRALVMGAG
FT                   DAARLLIAGIQHHGWVVVGLLDDDRRRLGTRVSNVPVLGPLDSAPRWAELHGISHIIVA
FT                   LPSATPAERRRALDLAAATHLPVVTVPSAAELREGTTVTRVREIEAEDLLGREPVQLDE
FT                   GGISEALGGKVVLITGAGGSIGSELCRQVARYGPLKLVLYELSEFALYRIEQELSEHFP
FT                   HIPLVRLVGDVRDPEHLRATFTRVRPQVVFHAAAYKHVPLMEEDNAFAALRNNTLGTWR
FT                   AASAAAEAGAERFVLISTDKAVNPTNVMGASKRAAEMVIAKLAAEVLARGGRTRFMAVR
FT                   FGNVLGSSGSVIPKFKEQIARGGPVTVTHPDITRFFMTIPEAARLVVQAAAIGEGGQVF
FT                   VLDMGEPVRIVDLARDLIRMSGHSADEIPITFSGLRPGEKLYEELLADADATLATRFER
FT                   LRIARLDDRGHDVQALLDWAAERSSAPDDEVRERLARLVSEYRRAGH"
FT   gene            319917..320825
FT                   /locus_tag="Lcho_0302"
FT   CDS_pept        319917..320825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0302"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: aav:Aave_2086 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32577"
FT                   /db_xref="GOA:B1XW50"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW50"
FT                   /protein_id="ACB32577.1"
FT                   /translation="MHRRSLLSLAAVALLLTACASAPPVAVKPPPLPRIGLALGGGAAK
FT                   GFAHVGVIKVLEAAGLTPTVVAGTSAGSVVGALYASGLSGFALQEQSFALDEERIKDLT
FT                   LFGVGGVIKGDKLQAYVNELIKNKPLEQMSKPFAAVATDLDSGERVIFTRGNTGQAVRA
FT                   SCSVPGVFQPALIGGKRYVDGGLVSPVPVDAARQLGADIVIAVDISSKARDGKAAGMLS
FT                   NLNQTITIMGQKLGEQEMTRAEVVIRPRVGQIGATDLDQKHVAVLEGEKAAQAALPQIR
FT                   AAIERWQQAQLARDAATAVRR"
FT   sig_peptide     319917..319997
FT                   /locus_tag="Lcho_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.489 at
FT                   residue 27"
FT   gene            complement(320880..323849)
FT                   /locus_tag="Lcho_0303"
FT   CDS_pept        complement(320880..323849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0303"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: reh:H16_A0400 excinuclease ABC,
FT                   ATPase subunit (A)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32578"
FT                   /db_xref="GOA:B1XW51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW51"
FT                   /protein_id="ACB32578.1"
FT                   /translation="MCTSDDVNPVVMIVRLASTDCILMSTGVSTVHPHPKISVRGARTH
FT                   NLKNIDLDLPKHALVVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLQLMDKP
FT                   DVDVIEGLSPAISIEQKATSHNPRSTVGTITEIHDYLRLLYARAGTPHCPDHGQPLEAQ
FT                   SVSQMVDAVLAMPAETRLMVLAPVVRDRKGEFVELFESMQAQGYVRFRVDGQVVEAADL
FT                   PKLKKAEKHDIDVVIDRLKSRADVTQRLAESFEAALRIAEGRAIALEMDTGREHLYSSK
FT                   FACPVCSYSLSELEPRLFSFNSPVGACPSCDGLGMVTVFDPERVVAFPSLSLASGAVKG
FT                   WDRRNSYTFSLLESVAAHYDFDLDTAFEELAPEHRQVLLRGSGEEEIAFTYEAEGAGGK
FT                   KRSVKRKHPFEGILPSLERRFRETDSPAVREDLTRYQSVKHCPDCDGARLRREARHVLL
FT                   VDDQDDALGRKPLAIYQVEHATLADCLAYFETLHLKGAKAEIADKVVREIRARLRFLND
FT                   VGLNYLSLDRSADTLSGGEAQRIRLASQIGSGLSGVMYVLDEPSIGLHQRDNDRLIGTL
FT                   KHLRDLGNSVLVVEHDEDMIRAADHVIDMGPGAGVHGGQVMSQGTPEHVAADPNSLTGR
FT                   YLGQVLKIAIPQRRNKLSDQKDPRVLRIVNAHGNNLRGVTAEIPVGLFTCVTGVSGSGK
FT                   STLVNDTLYAAVARKLYQSHLEPAPHDEIEGLDAFDKVINVDQSPIGRTPRSNPATYTG
FT                   LFTPIREMFAEVPMARERGYGPGRFSFNVAGGRCESCQGDGVLKVEMHFLPDVYVACDV
FT                   CHGKRYNRETLEVLYKGKNITQVLELTVEDAHAYFNAVPSIARKLQTLLDVGLGYIKLG
FT                   QAATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFHDIGLLLKVLHQLRDAGN
FT                   TIVVIEHNLDVIKTADWLLDMGPEGGSGGGRLLIAGTPEEIAECAESHTGRFLKPLLAR
FT                   "
FT   gene            324492..326011
FT                   /locus_tag="Lcho_R0001"
FT   rRNA            324492..326011
FT                   /locus_tag="Lcho_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            326084..326160
FT                   /locus_tag="Lcho_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            326084..326160
FT                   /locus_tag="Lcho_R0002"
FT                   /product="tRNA-Ile"
FT   gene            326173..326248
FT                   /locus_tag="Lcho_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            326173..326248
FT                   /locus_tag="Lcho_R0003"
FT                   /product="tRNA-Ala"
FT   gene            326579..329462
FT                   /locus_tag="Lcho_R0004"
FT   rRNA            326579..329462
FT                   /locus_tag="Lcho_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            329610..329722
FT                   /locus_tag="Lcho_R0005"
FT   rRNA            329610..329722
FT                   /locus_tag="Lcho_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            330640..330918
FT                   /locus_tag="Lcho_0304"
FT   CDS_pept        330640..330918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32579"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW52"
FT                   /protein_id="ACB32579.1"
FT                   /translation="MNQRPVVPVFSSAMRHLPMRLLVEPMEVDAALARLMPPVVVAGVV
FT                   GSNPARETDIDWMWTETGPGAVEVTEHLLPDGIDFLQFHALLSGVER"
FT   gene            complement(330958..331857)
FT                   /locus_tag="Lcho_0305"
FT   CDS_pept        complement(330958..331857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0305"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: azo:azo3369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32580"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW53"
FT                   /protein_id="ACB32580.1"
FT                   /translation="MNLSSQPRSDASQAALQQPRQVERLIVGQPTSDGAGVKLTRVLTQ
FT                   NLQRRLDPFLMLDAFGSDEAADYIGGFPDHPHRGFETVTYMIAGRMRHRDSAGNEGLLS
FT                   NGGVQWMTAGRGVIHSELPEQEEGRMEGFQLWLNLAARDKMRPAWYRDIGSQQIPELEL
FT                   PGVRVRVIAGRSHGVEGAMQRETTEPLYLDLHLEPGASFEQPLAAQHNAFVYVYRGQLS
FT                   IGAPGSTTEVPMQRMAILGNAADSDGVRLQAGQEPTRALLIAGRPLGEPIAQYGPFVMN
FT                   TQQEIFQAVEDFRNGRLA"
FT   gene            complement(331951..332580)
FT                   /locus_tag="Lcho_0306"
FT   CDS_pept        complement(331951..332580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0306"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: eba:ebA3879 acyl
FT                   carrier protein phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32581"
FT                   /db_xref="GOA:B1XW54"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XW54"
FT                   /protein_id="ACB32581.1"
FT                   /translation="MKILQVNSSARNFANGVGSVSSQLAGELVARLRDGEPTASVVVRD
FT                   LARTPHPVLDEAALQALFTPADQRTPAQAERVALDDALIAEIQAADVVVIAAPMFNFGI
FT                   TAQLKNWIDAIARAKVTFQYTANGPEGLLKGKRVHVVLTRGGVYRDQASDNQVPYLRQV
FT                   LGFLGMTDVEFIYAERQGMGPEASAQGVAEAREQIAALLQLGTATA"
FT   gene            332719..333687
FT                   /locus_tag="Lcho_0307"
FT   CDS_pept        332719..333687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0307"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: azo:azo3371 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32582"
FT                   /db_xref="GOA:B1XW55"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW55"
FT                   /protein_id="ACB32582.1"
FT                   /translation="MLFSRVIDAGSLSAAAKRLEWPKSTVSRRLAALERHFGERLVQRS
FT                   TRKLTLTEFGQGVLEHARQVAAEVDDAQALAAHRQQRPSGRLRVSMPGDVATQVLGDIL
FT                   SEFMAAHPAIALEMDLSPRRVDLIAENFDLAVRMGELQDEALLSARRLAAFTAGLYVAP
FT                   SYLARHGPIVHPTDLARADGLLLLGRGGDARPWQLHESAGDGHWTGLPVTRATANSPEL
FT                   LIQLARAGRGVTAVSDLYAAPAVRTGALVRVLPDWCLPSVTAWAVFPERRLMPARTRVF
FT                   IDALLVGLAKRCAGHRGETDPPAVVPADASGAGSPGEPAAP"
FT   gene            333698..334546
FT                   /locus_tag="Lcho_0308"
FT   CDS_pept        333698..334546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_1706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32583"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW56"
FT                   /protein_id="ACB32583.1"
FT                   /translation="MTSNPATESPGLAISAAPMPSITTTHRRRLRAIWRSAGWPSHDIV
FT                   DAELLAAGLLERREDVNGRTTLRVTDAGVHELVRTAEGHRSARSAHDALVSRVAATLAR
FT                   DGRIAWCGLSLRAWVTTPQADQPADAVPDGRWQMAMPDVYSVRQTSVAAYLLPVVHEIK
FT                   VNRADLLADLRQVAKRTAYRQMAGALFYVLGEGVGDVDDIPPECGVIRAHGAIGSHARH
FT                   AGEPVQLEVLRNAPTRAMDEPAGLPFAIWMALARLTPQGLPDDPQLPLIDDAPSVPPVD
FT                   A"
FT   gene            complement(334561..335532)
FT                   /locus_tag="Lcho_0309"
FT   CDS_pept        complement(334561..335532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0663 proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32584"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW57"
FT                   /protein_id="ACB32584.1"
FT                   /translation="MHADARPQFPAAPETLSALESTECAAAEPAFSARPGDLSAPFALS
FT                   DRRQSTALSQALCHAQRLARWRIGVTLAFTPPGGASHREVADAYRKALDESARLTPRAQ
FT                   LLVQPAALGHDRGLLHEVLRHADALAMPVLFEHGGLETADEAMACLMDLQEVHHARLGL
FT                   SLLASRDRSLDDARRALDWGLRVRLEHDWPAFDCSGAAFTAGRISRQTVGARFLALARL
FT                   LAAGSTAKRRSAQVSLISHDPLLADQALGMLLSGGVRCAIELRQEQPKQGLLYVARQRG
FT                   VAVRSHIGWGGGAREVAGRARDPRSRWWSALQGGLDTLLPAT"
FT   gene            complement(335661..336269)
FT                   /locus_tag="Lcho_0310"
FT   CDS_pept        complement(335661..336269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0310"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   aav:Aave_0048 glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32585"
FT                   /db_xref="GOA:B1XW58"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW58"
FT                   /protein_id="ACB32585.1"
FT                   /translation="MKLYYSPGACSLSPHIALRETGLPFELVLASTKTKKLADGSDYLA
FT                   INPKGQVPMLALDDGTQITEGPAIVQYIADQAPASGLAPAAGTIERYKLMEWLNFITSE
FT                   LHKGFSPLFAPDTPDDYKPIARNRLLARLAYVDEQLADRSYLLGEQYSVADIYLFVVSG
FT                   WGQYVGVDISGLPRLMAFRARIAARPAVIAAMKAEGLIK"
FT   gene            336435..336815
FT                   /locus_tag="Lcho_0311"
FT   CDS_pept        336435..336815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0311"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: rfr:Rfer_0010
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32586"
FT                   /db_xref="GOA:B1XW59"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW59"
FT                   /protein_id="ACB32586.1"
FT                   /translation="MTRPILPSQQIHPAVRERVARLHADIIAQVQAAIEAHPVVVIGMS
FT                   GNPFPRKARRLLDAAGIAHHDLDFGSYLSQWRRRNALKMWTGWPTFPMVFVHGQLVGGA
FT                   SDLQRLLASGELALMLRQPDRA"
FT   gene            336959..337771
FT                   /locus_tag="Lcho_0312"
FT   CDS_pept        336959..337771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0312"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   mpt:Mpe_A3688 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32587"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW60"
FT                   /protein_id="ACB32587.1"
FT                   /translation="MTLPSELRNLDVDLPASPRVLVELLALLQDGEVPLAAVAQLIESD
FT                   MALASAVVRTVNSAMFGLLRRVQTVGEAVRYLGTDEVVAITYESALRAAFPPTPALDAV
FT                   WSHASRAGLLMGRSAQALGLDALQAHTAGLFARCGQAVLLVKVAQPYAALLAAARGDRQ
FT                   ALVQAEQKTFGINHAALGSALCAAWGLAPDVVKYVREHVRPPGQWAELQTPVRRLLGLG
FT                   AVVEALLADASVSVADVAAAVSPGSGCGPADLVAAVQPSWRRLQAVDA"
FT   gene            337875..339152
FT                   /locus_tag="Lcho_0313"
FT   CDS_pept        337875..339152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0313"
FT                   /product="GTP cyclohydrolase II"
FT                   /note="KEGG: mgi:Mflv_3257 GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32588"
FT                   /db_xref="GOA:B1XW61"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW61"
FT                   /protein_id="ACB32588.1"
FT                   /translation="MARDVPSTPNHIRLTSHPGQGTTGAPAIQWGAADPLLRGPIVGST
FT                   VNRSQRNVIGTHSGSYGVYRALAVAAGSLERGHRTDLTNTSPTDVIGPHPQWADPHKIV
FT                   SIDPWGAMVARVYADYIEQGYDIRPTLAVTRAHIDLPEIRQAMAFGRLKADGEVLLENG
FT                   SAVVTKVAVEPVWWLPGVAERFKVSEGELRRTLFEETGGMYPELVTRSDIEVFLPPIGG
FT                   QTIYIFGNPQDLANPAVTLTARVHDECNGSDVFGSDICTCRPYLTHAIEECIAGAQSVA
FT                   HGGRGGVGLIAYSRKEGRALGEVTKFLVYNARKRQVGGDSADKYFLRTECVAGVQDMRF
FT                   QELMPDVLHWLGIRKIHRLVSMSNDKYDAITGSGIEVGERVKIPDSLVPADARVEIEAK
FT                   IAAGYFTDGSVPDEAQLAAVKGRGLS"
FT   gene            339163..340491
FT                   /locus_tag="Lcho_0314"
FT   CDS_pept        339163..340491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0314"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   rha:RHA1_ro00257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32589"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW62"
FT                   /protein_id="ACB32589.1"
FT                   /translation="MSAHLHAAGDATATPPASLADALRTLRQPATIRQRCTAITLAASQ
FT                   GESAHFTIDRSRLAAVAMRIATLTRARFPSLTIPYHSRWRHFEAGGVDRKDQLDARLAG
FT                   RSHVAVARSRIDLALISVLLDAGAGPDWRYLEAATGLHFTRSEGLAVASFDAFMAGRFS
FT                   SDPGDPYRVDAVALLKLQADDLRAVFQVRDDNPLVGLDGRAALLRSLGAALRAQPQVFT
FT                   TVGQPGHLFDALTHHRHAPALNHHHPQPGGHHHQVGAARILGALLDAFSAIWPSGQWLV
FT                   SGDQRVPLGDAWPHPAAGGSGPSAGWVPFHKLSQWLTYSLLEPFEWAGVQVTGLDELTG
FT                   LPEYRNGGLLLDAGVIVPRDPAFAASPRTPADPWVIEWRALTVALLDELAPLVRAELSV
FT                   TAEQLPLACILEGGSWAAGRQIAAERRLGGPPPLAIVSDGTVF"
FT   gene            340534..341169
FT                   /locus_tag="Lcho_0315"
FT   CDS_pept        340534..341169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0315"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: rfr:Rfer_2073 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32590"
FT                   /db_xref="GOA:B1XW63"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW63"
FT                   /protein_id="ACB32590.1"
FT                   /translation="MTSPQVHVVGHPLVQHKLTLMRQKDLSTSSFRRLLEEISLLMAYE
FT                   VTRDMPTRLIEIETPLETMRSPVIEGRKTVFVVIMRAGSGFLDGMLQVVPGARVGHIGL
FT                   YRDPKSLIAVEYYFKMPHDMPERDAIVLDPMLATGNSAVAAVERLKETRPRSIRFVSLL
FT                   SAPEGLAHFHAHHPDVPVYTAAVDRQLNEHGYIVPGLGDAGDRMFGTK"
FT   gene            complement(341023..342525)
FT                   /locus_tag="Lcho_0316"
FT   CDS_pept        complement(341023..342525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0316"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   mpt:Mpe_A3620 putative glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32591"
FT                   /db_xref="GOA:B1XW64"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW64"
FT                   /protein_id="ACB32591.1"
FT                   /translation="MHTGIPDALIAAEVDMPGWLLALDRHLDRHFPVLLEWLRPERHRL
FT                   IDSAPCSLGSPHDAPACGHEWMRRATTPSTLAGHDFRVLIGSAASCRQPYRASVFNLHA
FT                   SSADTLSADAILALGGAARRGGFAHGTSEGPISAQHRVHGGDLIWQIGPGHVGCRDELG
FT                   RFDPVRFAEQATAPQVRMIEITLGPDRWPDPGGGAFGHPVELMLFIERLRRLSGGKPVG
FT                   IRWCTGHPLAWFSLVKAMRHTHMTPDFIVVDGLQDDNGTTPLDRAGPAGLRLVHDTLVG
FT                   TGLRERIRIGCITPVASAFDIARVMALGADWCSSARGFMFALGCIQVQDCHAGACPTGV
FT                   ARRAGHEPRARVMPDKIERVERFHRYTLEALKELLQAAGLSHPDEIRPAHIQRHVGRHA
FT                   VGSLADRLIDVPPGAVLAAERGEGPWPDAVFARDWPRARADSFSPALPPSCQASLGAEH
FT                   PVAGVAQARHDVPVLVELPVDGRGVDRHVGMVGVEVREPLGC"
FT   gene            342759..344360
FT                   /locus_tag="Lcho_0317"
FT   CDS_pept        342759..344360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0317"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: kra:Krad_2011 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32592"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW65"
FT                   /protein_id="ACB32592.1"
FT                   /translation="MNRLLSLDELDTACVAQWREGALDACRDTARQMRERAIESGDLGQ
FT                   EARAELHLALCDQREARFAPALAAARRAAALSRVAGDTEFEVEALALVCAAGSVLGQPD
FT                   GALEAGCLALQLATQCPGTLAAVQATDVLGLAQAWLGQTDAARNCFASGAGQARAAGRI
FT                   DWEAHLLIHAAFAETLMLAMQWDAAAGLPTPAQRRSVEQALDAALARCEVTPGVMAGNT
FT                   QRGGRFLLGWVQLMLACWRGDVAQADGQLGALQPRPQHERAWLDLLVAWAGVAIAASRR
FT                   DWPQVETQAARMLDESRQMGHQPLAEQARRLLLVALARPGRMRQGSAALQALQGRPAAA
FT                   DVDAQALRQDMASFELRLRDLNKRPIGLPAWRREDSLTGLASREHFQAQADELLQRADP
FT                   ARAQVSVLVLALDPGQVLAAHHSPLVRDRVLCTLAALLRQVLRAGDLPARWSHDELGAL
FT                   LQRASGDDAARAGERVLATVRAYDWSGISPGLEVRVCLGHASARVGDTLDAMMRRCESA
FT                   RFASLRREYRRLPDAA"
FT   gene            344428..345717
FT                   /locus_tag="Lcho_0318"
FT   CDS_pept        344428..345717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0318"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.4.42"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   rso:RSc1594 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32593"
FT                   /db_xref="GOA:B1XW66"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW66"
FT                   /protein_id="ACB32593.1"
FT                   /translation="MPANPTLITNASLPDGRSAQDVLIDAGRIVAVGPQLPSPDGAERI
FT                   DAQGWLLSPPFVDAHFHMDATLSHGLPRVNRSGTLLEGIALWGELKPLLTQEALIERAL
FT                   QYCDWAVARGLLAIRSHVDICDDRLLAVEALTEVRRRVAPYLDLQLVAFPQDGVLRAPT
FT                   ALANLKRALDLGVDVVGGIPHFERTMADGAESVRLLCELAAERGLRVDMHCDESDDPLS
FT                   RHIETLAFQTQRLGLQGRVTGSHLTSMHSMDNYYVSKLIPLIAEAQVHAVANPLINITL
FT                   QGRHDTYPKRRGMTRVPELMAAGVNVGFGHDCVMDPWYSLGSADMLEVAQMGLHVAQMT
FT                   SQAQMQACFDAVTVNSARILGLQDYGLAPGCHADLVLLQARSPIEAIRLRANRLWVMRR
FT                   GQVIARNAPVETRLSLPGRPARTDCTLMRG"
FT   gene            345806..346426
FT                   /locus_tag="Lcho_0319"
FT   CDS_pept        345806..346426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0319"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   aav:Aave_4668 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32594"
FT                   /db_xref="GOA:B1XW67"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW67"
FT                   /protein_id="ACB32594.1"
FT                   /translation="MRLIASLTSPYARKVRIVLAEKKLEYKLELDDPWSAQPQVASHNP
FT                   LGKVPCLLLDGGDALFDSRVIVEYVDTLSPLGRLIPERGRERAEVRTWEALADGVVDAA
FT                   VAARLEAVWPGRTDAERCQAWIDRHIDKVQAGVAAMARDLGEQAWCCGLHLSLADIAVG
FT                   CALSYLDFRFPDLAWRTQYPNLVRLVDKLGQRPSFVQTQPPTA"
FT   gene            complement(346433..346960)
FT                   /locus_tag="Lcho_0320"
FT   CDS_pept        complement(346433..346960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32595"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW68"
FT                   /protein_id="ACB32595.1"
FT                   /translation="MHALLRAAAGLLLNRRVWRAPVDPLTPSRLDAHQARFVDAFAPWH
FT                   QQAARSLVAVGLTLRWARGTGVDTLRLTADTTRGLLAIAQDALDEVLRHASEPGQVRLE
FT                   LDLLHGETGSHLRMAVIDTGRTSTGPARQPASHGHELAMAQRHATQLGAQLEIGIDANG
FT                   WCAELVLQLAPA"
FT   gene            347393..348526
FT                   /locus_tag="Lcho_0321"
FT   CDS_pept        347393..348526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0321"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: mpt:Mpe_A3584 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32596"
FT                   /db_xref="GOA:B1XW69"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XW69"
FT                   /protein_id="ACB32596.1"
FT                   /translation="MVTLGHVTAQQMSFSDALPLRSGAALRDYTLVYETYGTLNADRSN
FT                   AVLVCHALNASHHVAGTYADSDRSEGWWDNLIGPGKPLDTNRFFVIGVNNPGSCFGSTG
FT                   PTHPNPATGRPYGADFPVVTVEDWVDAQARLLDGLGIERLAAVIGGSLGGMQALSWTLR
FT                   HPARVGHALIIASAPNLSAQNIAFNEVARRAIITDPDFHAGHFYAHGVVPKRGLRVARM
FT                   IGHITYLSDDSMEAKFGRALRSAELAYSTQEIEFQIESYLRYQGDKFSEYFDANTYLLI
FT                   TRALDYFDPAREFGGNLSAALAVARAKFLVVSFTTDWRFSPLRSREIVKALLDNRRDVS
FT                   YAEIAAPHGHDAFLLDDPRYHGVLRAYFERVAQELPR"
FT   gene            348523..349107
FT                   /locus_tag="Lcho_0322"
FT   CDS_pept        348523..349107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0322"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mpt:Mpe_A3583
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32597"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW70"
FT                   /protein_id="ACB32597.1"
FT                   /translation="MIRRQTVETIAQLVPHGSRVLDLGCGGGGLLEMLCRERGCSGYGV
FT                   ELDDAKLLDCVKRGVNVIQRNLEEGLSIFEDNSFDVVLQLNTLQNLRNTEAMLRETARV
FT                   GRIGIVSFPNFAHWPNRLSVLKGRMPVTKALPYQWFDTPNIRVGTFADFEVLAGQCGLR
FT                   VLEAFGLHDGQVVRRWPNLMASTAVFKFERG"
FT   gene            349450..349977
FT                   /locus_tag="Lcho_0323"
FT   CDS_pept        349450..349977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32598"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW71"
FT                   /protein_id="ACB32598.1"
FT                   /translation="MVLSSPLHSRPESTSIPREPAARRSREEVAGISMPWRCWLTGCMA
FT                   VVMLAAGDARAEDFGQDRRQTHYSTTETMARVVASAQARGLSVVARIPMPGQHVEWLVL
FT                   GPSPDETAVIQHAGDATIDLPLTLQISQTEDGGAEVRFHDASMPGAHSLSDDLRERMDA
FT                   LPGLLDDALAVH"
FT   gene            350044..351537
FT                   /locus_tag="Lcho_0324"
FT   CDS_pept        350044..351537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0324"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: mpt:Mpe_A3578 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32599"
FT                   /db_xref="GOA:B1XW72"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW72"
FT                   /protein_id="ACB32599.1"
FT                   /translation="MNAPERHPVLDPSALGASLAQTWDADILPELRDYIAVPAKSPMFD
FT                   PQWLENGHIEAVVRRAAQWVEARRVAGLTLEVIRLTDAAGQPRTPVVFFEVPATRPEPD
FT                   AGAAPTVLMYGHLDKQPEFNGWRSDLGPWTPVVENDKLYGRGGADDGYAIYASVAAIEA
FT                   LQAQGVAHPRIVGLIETCEESGSYDLPAYVDALRERLGNVSLVVCLDSGAGNYEQLWLT
FT                   TSLRGNVTGTLKVEVLTEGIHSGDASGVVPSSFRVLRQLLDRLEDSRTGRLLPASLHCE
FT                   VPPHRLAQARATAALLGDEVWRRLPWSCGADGGPTLPTTTDPTEVLLNRTWRPTLSVTG
FT                   AEGFPAVAHAGNVLRPYSAFKLSLRLPPLVDGPSAALELKRLLEAEPPYNARVTFVPDG
FT                   RAGAEGATGWDAPHLSPWLERSLDAASIAQFGAPLGYIGQGGTIPLMNMLERGFPQAQM
FT                   MVCGVLGPKSNAHGPNEFLHLPYARRLTAAVAQVIADHP"
FT   gene            complement(351562..352647)
FT                   /locus_tag="Lcho_0325"
FT   CDS_pept        complement(351562..352647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0325"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: mpt:Mpe_A0129
FT                   malonate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32600"
FT                   /db_xref="GOA:B1XW73"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW73"
FT                   /protein_id="ACB32600.1"
FT                   /translation="MQAIFSVTVPFFALILAGYLAARRRILPLDAVPGLNAFVLYFALP
FT                   CLLFRFGSTLPVRELFDPVVLGVYLLCALVIVGFTIAVTLKSPVGLKDAAFGALVAAFP
FT                   NSGFMGVPLLVALVGQAAAGPVITAVMADMIITSSLCIAIAQAHQERHTQPPSQIDDVT
FT                   STLPPGVELVRTPGATAETRAAVLRSLRAAFGNPLPWSIGLGALASATGLSLPGPLASV
FT                   VGMLANAASPVALFTIGAVLWRAGQPHAPVAVNGMAVVRPPLATPLARYLPVALIKLLL
FT                   HPLLVLLVGLAARGLGAPLSSFQLMVLVLTAALPSASNVSLLAERYGADNGRIARIILA
FT                   STVLAFGSFSALAWLFGVQPV"
FT   gene            complement(352711..353715)
FT                   /locus_tag="Lcho_0326"
FT   CDS_pept        complement(352711..353715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0326"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: aav:Aave_0755 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32601"
FT                   /db_xref="GOA:B1XW74"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW74"
FT                   /protein_id="ACB32601.1"
FT                   /translation="MAFKTRTLLLAAALMTALAGPAAAQKVLKVGIGLSDDHPQGLAVK
FT                   KFGELLAQKSGGKLNAKLYASGSLGNDVTMTSALRGGTLEMTVPDSSTLVSLAKDFGVI
FT                   NLPLTINTEQEADALLDGPFGQKLLDKLPEKGLVGLAFWENGFRHLTNSRRPITKADDI
FT                   AGLKVRVIQNPLFIESFAALGANATPMPFTELYSAMEQKAVDGQENPGATILASKFFEV
FT                   QKHMVTSRHIYSAWVLLLSKKTWDGFSADEKKAVQDAAREATLFERKTIRDFSDKALAE
FT                   LKKEGLQITELPAAEQARMRTKLAPVVAKFSKEFGEATSKEMFAELERIRARK"
FT   sig_peptide     complement(353641..353715)
FT                   /locus_tag="Lcho_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            complement(353826..354329)
FT                   /locus_tag="Lcho_0327"
FT   CDS_pept        complement(353826..354329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0327"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /note="TIGRFAM: carbohydrate kinase, thermoresistant
FT                   glucokinase family; PFAM: shikimate kinase; KEGG:
FT                   pna:Pnap_0046 carbohydrate kinase, thermoresistant
FT                   glucokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32602"
FT                   /db_xref="GOA:B1XW75"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW75"
FT                   /protein_id="ACB32602.1"
FT                   /translation="MQVSTVFMGVAGCGKSSLAAAVAAAEAAPLVEGDDFHGPANRDKM
FT                   SRGIALTDADRDDWLAALAAQLRDAPQGIVLTCSALKRSYRERLRSAAPGLRFVFLDID
FT                   RDAALARVAGRNAHFFSASLVDSQFATLESPIGEPGVLRVDATEAPAQLQAEVSAWLHD
FT                   SGAA"
FT   sig_peptide     complement(354255..354329)
FT                   /locus_tag="Lcho_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.337 at
FT                   residue 25"
FT   gene            354499..355524
FT                   /locus_tag="Lcho_0328"
FT   CDS_pept        354499..355524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0328"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pna:Pnap_0047
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32603"
FT                   /db_xref="GOA:B1XW76"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW76"
FT                   /protein_id="ACB32603.1"
FT                   /translation="MNPAPKRARATGRVTLSDVAQAAGVSPITVSRALRGERAVDPELV
FT                   ARALAAARKLGYVPDPAARALASQRSAHVAVLIPMLSNALFVDLLEAVQRTLRRAGYLA
FT                   LIGITHYDASEEEQLLREQLVHRPAGLLVTGLDRNEATRTLIEQGGMPCVHLMETSREP
FT                   GVHCVGLSQADAAAAMTRHLLDRGRRRIAFAAAQLDPRTLQRLEGWRRELSAAGLHDAR
FT                   LEWLNPAPSSMALGGRMFEQIMAHTPAVDAIFFCNDDLAQGALLAAARARIAVPERVAI
FT                   AGFNDLMGSDLVIPPLTTVRTPRAEIGEAAATMLLKLMRGEPVPQPSIDLGYTVVVRES
FT                   T"
FT   gene            complement(355539..356930)
FT                   /locus_tag="Lcho_0329"
FT   CDS_pept        complement(355539..356930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0329"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: mpt:Mpe_A1429 L-serine ammonia-lyase; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32604"
FT                   /db_xref="GOA:B1XW77"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW77"
FT                   /protein_id="ACB32604.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAARLFVQRLDQQRQLEQVAR
FT                   VEARLYGSLGATGKGHGSDKAVLLGLLGEEPESVDIEAVPATLALIRSSGQLRLAGRHA
FT                   VGFVEKEHLTFYRRETLPFHANGMKLEAFDAAGARIESRIYYSVGGGFVVSDEVAADGT
FT                   RHQAIAPDSTVLPLPFHSGAELLALTQTHGCSIAEVMRRNERHWRTDAEIDAGLLRIWQ
FT                   VMQDCVRRGCATEGTLPGGFKVKRRAAELYRHLTSHPEAALRDPLQVLDWVNLYALAVN
FT                   EENAAGGRVVTAPTNGAAGIVPAVLHYYSRFQHGANDAGVIEFLLTAAAIGLLYKENAS
FT                   ISGAEVGCQGEVGVACSMAAGALCAVLGGTPAQVENAAEIGMEHHLGLTCDPVGGLVQI
FT                   PCIERNAVASVQALNAARMALRGDGTHFVSLDKVIKTMRETGADMQSKYKETARGGLAV
FT                   NIVEC"
FT   gene            complement(356999..359038)
FT                   /locus_tag="Lcho_0330"
FT   CDS_pept        complement(356999..359038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0330"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: cvi:CV_3427
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32605"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW78"
FT                   /protein_id="ACB32605.1"
FT                   /translation="MSHTLPPAEAGAVELARRSARYGALDLVLQPVWIYDFDRRRVHWA
FT                   NAAALKMWKAESLRELCRRDMGADMSATVARRLAQYQADFITHAAVFNERWTLYPGGTP
FT                   VVLNLTYSGHRLDDGRMAMLSQGKPALDELPESTRSVEALLHTAVMITLYDLSGAPLYR
FT                   NPAARASVRSPGETLRERIVDPASGERFMAALAHEQAANFTLAVHTAQGERWHEMSARH
FT                   CHDAVTGHDAVLVSEADVSALKHTEAQASFQALHDALTGLPNRAHVMERFAQALADIRD
FT                   AGMAAALIFIDLDHFKDVNDTLGHAAGDELLVHVARRLRNAIRSSDQVARLGGDEFLIL
FT                   VASKDIVGEVERVRQRISQAIAQPLSLSGTEVRVTPTLGVSLYPRDGLDVETLLRNADL
FT                   AMYCAKERGRNDMAYYEEGLAVAMRQRTSLEADLRHALERDEFEVFYQPRVCVHTRRVV
FT                   GAEALLRWRSPERGLVMPDDFIPVCESSGLIMPIGLRVFEQVARQQAEWAARGLDLQIS
FT                   VNLSPRQFSHPGLLDGIRAALRVAAGRPARLEIEITESMLLARDERPREVLDAFEAMGM
FT                   SIALDDFGTGYSNLAALQRYPIHTVKIDKTFIQGLDTDRPLADMIVSMCRLMRLTVVAE
FT                   GVETCDQLDWIAGRAIDQYQGFLCARALPAAAFEARFIDEPLAA"
FT   gene            359370..359687
FT                   /locus_tag="Lcho_0331"
FT   CDS_pept        359370..359687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0331"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32606"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW79"
FT                   /protein_id="ACB32606.1"
FT                   /translation="MSHVFDLPGELTIFSAAETRTALLAWLGGLPAEPEQPIELDAGQV
FT                   LDIDGAGVQLLCAFSALMSRQDRAWRLVSPGDTLIQRCRTAGLSAWIDRHAGPAGTEAL
FT                   S"
FT   gene            359684..361954
FT                   /locus_tag="Lcho_0332"
FT   CDS_pept        359684..361954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0332"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; KEGG: asa:ASA_3266
FT                   chemotaxis protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32607"
FT                   /db_xref="GOA:B1XW80"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW80"
FT                   /protein_id="ACB32607.1"
FT                   /translation="MKKKSSKYDGSFLADALPTFINEANEQTESLEQLLLQLEEQPGDR
FT                   DLLDALFRCAHTVKGSAGMFGLDKVVDFTHHVETLLSRIRDGLIDLDLGVSTLLLQCND
FT                   QIRHLIGSAADAGADTPEQVERRADLVMQLHALLGASDRRAAAAGPADASVDPPADAPD
FT                   DDAPMLRWHVSVQFGPETFRNGMDPLAVIAYLETLGSVEAIGCDQAAIPALDVIDAEQC
FT                   HLAFEVCIDTRATREELEGAFSFVRDDCVLHLIDLPEGPGRLARLIEALPDRPRLGDIL
FT                   MSIGAVTHAQLQACLNQQAQNRLATPDEVPLLGELLQTKAGVHGEVVAAALDKQRKQRD
FT                   PAPGDENRYIRVHADRLDAVINLLGELVIAGAGAAMLARQTRQRNLHEANQNVVRLIEE
FT                   IRNGTLQLRMVPIGETFSRFRRVVRDTASQLGKEVTLEIVGGETELDKSMVERIADPLM
FT                   HLVRNGLDHGLETPAERQAAGKPAVGRLVLSARHESGSVLIRIDDDGRGIHRERVLQRA
FT                   WDRGLLERGTRPPDAEILKLIFEPGFSTAEQVTSLSGRGVGMDVVRRNIEALRGSVQLH
FT                   STEGLGTRIDIRLPLTLAIIDGFLVSVGASKFIFPLDTVVEVIENRPTTTGFDRRGRGT
FT                   VELRGQVLPVVSLRVFYDLESPPPERDNIIVVNAGEAPFGIVVDALLGQHQTVIKPLGR
FT                   IFKMLRGLSGSSILGNGEVALIADVMSLSHLAAQPPRVHVPASRRTSDNGPTAQTQSEG
FT                   QAS"
FT   gene            361951..364113
FT                   /locus_tag="Lcho_0333"
FT   CDS_pept        361951..364113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0333"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: rpe:RPE_1195 methyl-accepting chemotaxis
FT                   sensory transducer with PAS/Pac sensor; TIGRFAM: PAS sensor
FT                   protein; PFAM: chemotaxis sensory transducer; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32608"
FT                   /db_xref="GOA:B1XW81"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW81"
FT                   /protein_id="ACB32608.1"
FT                   /translation="MNQHQPSWIARLLIGAELRQAAAEAQKNEQARADAESALAQVKAR
FT                   LAEVESELKVRTDIMNVTSIVSESDKKGDILSINAKFCEVSKYSRDELIGRPHNTTRHP
FT                   DMPKETFKQLWQTIGRGDTFRGIIKNRAKDGTPYYVDAVVAPILGENGKPMKYLGVRYD
FT                   ITEAEIERQNARGILGAIDVSYAYIEFDLRGQVLQANANFLQLMGYRLDEVVGHHHRMF
FT                   VDPAHAATPAYDNFWRDLNAGKPQSEVFKRITKAGREVWIQAIYAPVNDEMGRVVKIVK
FT                   IATDVTREVSANNMLRQAVEQAQAVTAAARDGDLTQRIPLEGKSGPIEALCSGVNSLME
FT                   TTSVISADVGRVLAALAAGDLSQRITRDYAGTFGRLKADANATSEALSGIIEDVGRVFS
FT                   GLAGGDLSQRIDRDAQGIFDQVKQDANSTGDKLASIIDEVRGAADQLTSAASQVSATAQ
FT                   SLSQAASEQAASVEETTASIEQMSASISQNSDNAKVTDGMATKASKEAGEGGEAVTQTV
FT                   RAMKQIAAKISIVNDIAYQTNLLALNAAIEAARAGEHGKGFAVVAAEVRKLAERSQEAA
FT                   AEIGELAANSVSTAERAGKLLDEIVPSIRKTSDLVQEISAASEEQSSSVTQIGSAMGQL
FT                   SKATQQNASASEELASTSEELSGQAEQLQQVIGFFNAGEPQPPAARPERRAANQPDRAV
FT                   RPRAVATQKAPSVAAPRAREVNFRPY"
FT   gene            364124..364633
FT                   /locus_tag="Lcho_0334"
FT   CDS_pept        364124..364633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0334"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: psb:Psyr_0784
FT                   CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32609"
FT                   /db_xref="GOA:B1XW82"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW82"
FT                   /protein_id="ACB32609.1"
FT                   /translation="MTDHTQADAAVPAQYLTFTLGDSVFAVGIEAVREIIQYGPMATVP
FT                   LTPRFVRGVINLRGAVVPVIDLQARLGRAAATIGEKSCIVIFDARCEGERVDLGLLVDA
FT                   VSEVVEIAPAQIEPPPQFGAVVRRDHIRGMVRIKGRFVVILEPGSALDIEEMALLCEQE
FT                   QDRLAA"
FT   gene            364639..365481
FT                   /locus_tag="Lcho_0335"
FT   CDS_pept        364639..365481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0335"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   rfr:Rfer_0904 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32610"
FT                   /db_xref="GOA:B1XW83"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW83"
FT                   /protein_id="ACB32610.1"
FT                   /translation="MVAFPIDKQVLSDRTFEAITALIYEAIGLSLNASKKSLVASRLGP
FT                   RIQRLGLGGFDDYLALLRDEAEAAEFQMAVDLLTTNETYFFREPAHYQVLEQELASRSN
FT                   KNAPLAVWSAASSFGDEAYSTAMLLADLQQAGRIGADWHILGTDISHRVLLAAKEAVYP
FT                   EDRLRNVSPERLRRYCLRGEGPAQGQAMIQARLRERVRFGQLNLCKPFSGIGPFDVVFL
FT                   RNVLIYFDAETKRQVVDRVVATLRPGGLFFLGTAEGRVPAEVPLTVIVPGAFRKPSKV"
FT   gene            365484..366041
FT                   /locus_tag="Lcho_0336"
FT   CDS_pept        365484..366041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0336"
FT                   /product="CheD"
FT                   /note="stimulates methylation of MCP proteins; KEGG:
FT                   rfr:Rfer_0905 CheD, stimulates methylation of MCP proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32611"
FT                   /db_xref="GOA:B1XW84"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW84"
FT                   /protein_id="ACB32611.1"
FT                   /translation="MPAPTPIPPTHRPVPPCAPASRPVDLPPPRSVQLAPGDVVVGTRG
FT                   DRFETLLGSCVAVVLSDPRRTVGAMCHIVHAGEPGRDTPGDTTFARPALQAMADGLGRI
FT                   GLSARLCQARVYGGGNMFPQLVKASHIGDTNGQRVLALLAAAGIEVVAQSLGGSCYRKL
FT                   AWVVGPAEPECIRVDVPVLSNN"
FT   gene            366058..367128
FT                   /locus_tag="Lcho_0337"
FT   CDS_pept        366058..367128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0337"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: dar:Daro_1148 chemotaxis-specific
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32612"
FT                   /db_xref="GOA:B1XW85"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW85"
FT                   /protein_id="ACB32612.1"
FT                   /translation="MPAIKVYVVDDSAVVRQTLAHMLSGLADVELIGSAPNPLIAIEAM
FT                   RKMRPDVLLLDIEMPGMDGLTFLRQVMSSDPIPTVICSTLGAEGGRVALDALAAGAVAV
FT                   LAKPKFGLKQHLEESRQEMIQTLKAAARSRPRARAAGAAPAAAARPAGSPRPASIGSVH
FT                   ALAVNKPVVIGSSTGGTQALEQVLTALPADAPGIAITQHMPEKFTAMYATRLDGLCAMR
FT                   VREARDGDRLERGLVLIAPGGRHMQLRRAAGQYYMTVADGPPVNRHKPSVDVLFRSAAD
FT                   CAGANVLGIILTGMGDDGARGMKTLHDGGARTIAQNEETCVVFGMPKEAIKLQAVDDIL
FT                   PLESIARAILQFDARA"
FT   gene            367212..367790
FT                   /locus_tag="Lcho_0338"
FT   CDS_pept        367212..367790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0338"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: mpt:Mpe_A0055
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32613"
FT                   /db_xref="GOA:B1XW86"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW86"
FT                   /protein_id="ACB32613.1"
FT                   /translation="MSMLILGLVLFLGVHSVRIVADDWRTRQIAQRGEGVWKGVYALLS
FT                   LIGFVLIVQGYGQARLAPVVLWTPWVGGRHLASLLTLIAFVLLAAAYVPGNAIKAKLKH
FT                   PMVLGVKVWALAHLLANHTLADALLFGAFLVWAVLDFRSARRRAAPAVAPVSAARTGLT
FT                   VVAGLVAWAAFAFWAHGAWIGVRPFGGAG"
FT   sig_peptide     367212..367277
FT                   /locus_tag="Lcho_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.835 at
FT                   residue 22"
FT   gene            367875..369938
FT                   /locus_tag="Lcho_0339"
FT   CDS_pept        367875..369938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0339"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: mpt:Mpe_A0128
FT                   putative ATP-dependent DNA helicase rep protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32614"
FT                   /db_xref="GOA:B1XW87"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW87"
FT                   /protein_id="ACB32614.1"
FT                   /translation="MAEAPSTLNPAQLEAVNHLHSPCLVLAGAGSGKTRVITHKIARLL
FT                   QAGLKPDQIAAITFTNKAAQEMRERARSLIGARAAKHLVIATFHSLGVRMLREDGECMG
FT                   LKPKFSILDADDVLGVLRDAGGTTDPKVARRWQWTISLWKNQGLNWEQAEAAAADADEQ
FT                   VAARVMKLYHERLAAYQAVDFDDLIGLPLKLLQTNEAARLKWRRQLRHVLVDEYQDTNA
FT                   TQYDVLKEIVGPDGVFTAVGDDDQSIYGWRGATIENLKRLPQDYPTLKVIPLEQNYRST
FT                   AAILNAANNVIALNPKIFQKKLWSDLGEGEPVRLVECDQEEHEAERAVARIQGIRANAT
FT                   GAYTGTTDWKDFAILYRANHLSRKLEEALRKAQIPYKVSGGQSYFDRAEIKDLCAWLRL
FT                   LVNQDDDPAFLRAVTTPKRGIGHTTLGALGEFAGKWKVSLFEALFKESLAAALSAKAIG
FT                   SLHEFGRYVNDLEHRARHTVGAEEAKPMLMEWLKDIGYEQFLYDGEENEKVAAARWNNV
FT                   VDFVDWIAKRCGGQVEADGSAQVEIERKSVLDVAQTISVILSLAERGDEQDMVTLSTLH
FT                   ASKGLEWPHVVLVSINEGTLPFQRDEEEMTAERLEEERRLMYVGITRARNTLLVSTLLR
FT                   QKRGREVRKALPSRFIAEMKLDERTVKEDPREKLKALRAEFAARAAAAKPAV"
FT   gene            370205..372079
FT                   /locus_tag="Lcho_0340"
FT   CDS_pept        370205..372079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0340"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: pha:PSHAa2649 serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32615"
FT                   /db_xref="GOA:B1XW88"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW88"
FT                   /protein_id="ACB32615.1"
FT                   /translation="MSQPSTPLRVRARAIWRRAPVTGLLVSSLLAVAGGAGAFERDDAP
FT                   RQPSARASAAMPDDEGDTDRVIVKYRRATSADALDERALNALRVAGNRNGLEISRLRGN
FT                   ARGGHVLRASRRMSMAEARRLADELRNGDADIEYAEPDRLMQAQYLPNDPQYASQWHYS
FT                   EAAAGIRLPLAWDKSSGAGVVVAVLDTGVRRHADLAGNLLAGYDFIVDTTVAADGNGRD
FT                   TDPTDPGDWAAAGECGTGSAARNSSWHGTHVAGTIAAVSNNGVGVAGVARGAKVLPLRV
FT                   LGKCGGYTSDIADAIVWAAGGAVAGVPVNPTPARVINLSLGGVGACDITTQNAINSARS
FT                   RGAVVVVAAGNATADAARYSPASCAGVITVASVGRTGAIASYSNFGANVDVAAPGGDGT
FT                   ATILSTLNSGTSKARSDSYAGYRGTSMATPHVAGVAALMLARNAALTPDEVEARIKSSA
FT                   AARGFPVSCAQCGVGIVDANAAVDAALGTGTAPAPAPAPAPAPTLGTLAEVESNNTIAT
FT                   AQALSGSLLQVNGSMASATDVDHFRINIAPGKTLLVTLAPNASSDYDLIAYNSAGILVA
FT                   QSTLGVGVADSVSLLNSGSAAISVTLRVGYFSGGTGSPAGSYTLKLSQ"
FT   sig_peptide     370205..370321
FT                   /locus_tag="Lcho_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.777 at
FT                   residue 39"
FT   gene            372330..374213
FT                   /locus_tag="Lcho_0341"
FT   CDS_pept        372330..374213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0341"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: pha:PSHAa2649
FT                   serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32616"
FT                   /db_xref="GOA:B1XW89"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW89"
FT                   /protein_id="ACB32616.1"
FT                   /translation="MNHKRESLRTNPWASTAADWAWGIAIGALLLAAGSSWSMARGDRR
FT                   DVRAPTQATADEEGTDRVIVKYRNADRSQIDPTTQGSVRVAGNRAGVRLSRLRGMAHGG
FT                   HVLRADRRLSLAAAQRLADDIRSGDAEVEYAEPDRIMTIQLVPNDPSYASQWNLFEATA
FT                   GLNLPAAWDKSTGAGVVVAVLDTGVRPHVDLAGNLLAGYDFINDTTVANDGNGRDADAF
FT                   DPGDWAAAGACGSGSAADSSSWHGTHVAGTIAALTHNARGVAGVAFGARVLPVRVLGRC
FT                   GGYTSDIADGMVWAAGGSITGVPANPTPARVINLSLGGSGACGTTTQNAINSARSRGAV
FT                   VVVAAGNSAANAAGFSPAGCAGVVTVAAVGRSGARASYSNYGTVVDVAAPGGDGSSGIQ
FT                   STLNAGSSTPGADSYASYMGTSMATPHVAGVVALMLARNPALTPDEVEARLKSSAAARG
FT                   FPVACSQCGSGLLDANRAIDAAIGSGTTTPAPTPAPAPTPTPAPTPSLTQVAEVESNHA
FT                   RSSAQAISANPAQVNATIGSTSDTDYFRVTLAAGRTLVATLAPNAGSDYDLYAYNAAGT
FT                   RVASSVLGTGAVDTVSVRNAGTGATTVYVRVLRYSGGTGATGGRYTLKLAQ"
FT   sig_peptide     372330..372446
FT                   /locus_tag="Lcho_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.519 at
FT                   residue 39"
FT   gene            complement(374197..376251)
FT                   /locus_tag="Lcho_0342"
FT   CDS_pept        complement(374197..376251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0342"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: aav:Aave_0649 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32617"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW90"
FT                   /protein_id="ACB32617.1"
FT                   /translation="MPAKTDTPLPRHTAEPTVPMLGARTPRTSPARVLLQVGARLRGPL
FT                   ASALFARGMQPVLGHAGQRGLALEIREFGPPVSGEPPTRPGATPVAPALLALLPGAARS
FT                   DGIDWRHEALRAGALSLLVLDDTAADIETMARLAARLTRLTRQPVQLPPGAAAQRPAPA
FT                   THGHTTPGHASPERAPTSSRSLHGGSAARPAPELIAAIDEAVGQARQLGAMGALLLVGL
FT                   NRLAEIDTALGTAIRRDMVDAIETRLTDVLRQEADRHRLRPAAELYRWDGGFAIVWPQI
FT                   SHGEQALQLARQLLKQAGEPLTVAGEEASLSANAGIGLLPHDGVEATALLEAAERALHH
FT                   ARSRGPGQCQFHEQDLAPRQRERLRLEARLRRAIADGSFELHYQPQVDLQTGALTGAEA
FT                   LLRWPDGAGGSVPPSLFIPMAEANGLIVALGDWVLQRVCRQIRRWLDRGLEVPRIAINV
FT                   TPQELQQPDFVARVLRSLADAGLAGRHLCIELTEAALMTDTAAARAATATLSTRLLMLR
FT                   EAGVQLAIDDFGTGCSSLAMLRRLPMDGLKIDRSFVADVDGDGAAICAAIIGLAHTLGL
FT                   RVIAEGIETDAQLAFLREQGCDEFQGHVLSPALGATIMGEVLAGAAIQYRVPPAPALPT
FT                   APADPAAPSMPELAQLHRSLARRPRQESGAALQWPAPLQAGEPTFTAPT"
FT   gene            376351..376734
FT                   /locus_tag="Lcho_0343"
FT   CDS_pept        376351..376734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0343"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: mpt:Mpe_A0276 preprotein
FT                   translocase YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32618"
FT                   /db_xref="GOA:B1XW91"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW91"
FT                   /protein_id="ACB32618.1"
FT                   /translation="MVGLRPTIQSFVFRSRSLTVFISNAFAQAPAATAADGGSSLMSML
FT                   PLVLMFVVLYFIMIRPQQKRAKEHKAMIDAIGKGDEIVTSGGLLGKVTKIGDNYLSIEI
FT                   ANGVEAQCQRGSVIQVLPKGTIK"
FT   sig_peptide     376351..376455
FT                   /locus_tag="Lcho_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.900 at
FT                   residue 35"
FT   gene            376828..378729
FT                   /locus_tag="Lcho_0344"
FT   CDS_pept        376828..378729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0344"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   mpt:Mpe_A0277 preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32619"
FT                   /db_xref="GOA:B1XW92"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW92"
FT                   /protein_id="ACB32619.1"
FT                   /translation="MNRYPWWKYLILAIAVLVGSLYTLPNFFGEAPAVQVSSGKATVKV
FT                   DASLVPRVQQALAGAGLSPDFVQLEGLSVRARFGDTDTQLKARDAVVKALNPDPSDPSY
FT                   IVALNLISRSPQWLTAMRALPMYLGLDLRGGVHFLMQVDMKAALTKKAESLTGDLRALL
FT                   RDKSIRHAGIVRNGDGVEVRLRDAPTQARALALLREQQPDLLWVESTDGTEFKLAGTLK
FT                   PEAARKVQEQAVTQNINTLHNRINELGVAEPVIQQQGLDRVVVQLPGVQDVAKAKDIIG
FT                   RTATLEVRLVDDSTEAQAALSGGGPVPFGTERYTERGARAIIVKRQVILTGENLTDAQA
FT                   GFDENQQPAVHLTLDARGARIFRDVTRENINKRMAILLFEKGKGEVVTAPVIRSEIGGG
FT                   RVQISGSMSPVESADTALLLRAGSLAAPMEIIEERLIGPSLGAENIAKGFDSVLYGFVA
FT                   IAIFMCCYYLLFGVFSTLSLGVNLLLLVAVLSMMQATLTLPGIAAIALVLGMAIDANVL
FT                   INERVREELRAGASPQMAIHTGYERAFATILDSNVTTLIAGLALLAFGSGPVRGFAVVH
FT                   CLGILTSMFSAVMFSRGLVNLWYGRKKKLQKVSIGQVWRPAGAVAEPGSGVSVGKQA"
FT   gene            378754..379788
FT                   /locus_tag="Lcho_0345"
FT   CDS_pept        378754..379788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0345"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   mpt:Mpe_A0278 preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32620"
FT                   /db_xref="GOA:B1XW93"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW93"
FT                   /protein_id="ACB32620.1"
FT                   /translation="MEFFRFRRDIPFMRHALVFNVISFLTFAAAVFFLITRGLHLSIEF
FT                   TGGTVIETEYAQSADIARVRGTIETMGLGEVQVQKFGTSRDVLIRLPLREGVKQNELVG
FT                   RVFTQLCTAEQGTVSQQQTTTDKGETISRQVCQTAAGAEPLKLSRSEFVGPQVGKELAE
FT                   DGAKALAFVIVGIMIYLALRFEWKFAVAAIIANLHDVIIILGFFAYFQWEFSLSVLAAV
FT                   LAVLGYSVNESVVIFDRIREAFRRYRKMTTVEVIDHAITSTMSRTIITHGSTQMMVLSM
FT                   LLFGGPTLHYFALALTIGILFGIYSSVFVAAAIAMWLGVKREDLVSTPRKDHDPNDPNT
FT                   GAVV"
FT   gene            379848..382400
FT                   /locus_tag="Lcho_0346"
FT   CDS_pept        379848..382400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32621"
FT                   /db_xref="InterPro:IPR012434"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW94"
FT                   /protein_id="ACB32621.1"
FT                   /translation="MASAVHSPALAAQARRFYFELLLRELPRVIKAVNQGARELMSQSG
FT                   SPELVTRRRDLVLDLPRQAPRWHQCMVQALRAAVTPPPPGTQRPAHTLMATKASELALV
FT                   DDDTIELEIVASRMALAIMDKASWEFSDLRYRMSALERREEMDAHDVLRPHVLARATVD
FT                   GWRAGGLTLDHWRTAQQVMHEEFASLIQEAYHETNRWLIGQGVCTDVNLRPFIRRSRDL
FT                   GVATGSGALGAPSGASAHGPHTGPGTAPAPMSPPAAPAAGAGGSPAARYPTPTGYAKDK
FT                   MQPTPETAHQFAPTVVAGLSPAARHPGPTSRGSGSAEGSGGGGGDRRDVEEETRLMTHS
FT                   PSLVRSLEQAEAVLGRLNRLVSRQVPEFNGSTIAQPHPASPGLRAAINDAQTAVRQRFD
FT                   ARGAPAATGGPPVLGAAQMVSTPALLQELQTRKQALKQAASTPVERATIEIVALMFQSL
FT                   LTEERIPTAVRVWFARLQMPVLRVAIVEPDFFATVDHPARQLIDRMGACVMGFEAGSAG
FT                   VSEALEKEIKRVVQVVEAYPDTGRRVFQTVLTEFERFLENYFKTTHAAASKGVSLAQQI
FT                   EQRETLAIQYTIELRKMLNEVPVHDGVREFLFHVWADVLATAAVKSGQGSEATKLMQRA
FT                   AADLIWLASAKVSREERSEAIRRLPPLLKKLREGMGSAGVPQVKQDEYIQALNNSLAAA
FT                   FSARTATIPTERLEELMMQLETIEELLPDAENFEIDESMVRDLSGHEDGDMEVVAEGGS
FT                   MPTPAMLAWTGNLQVGSWFKLDYRGRVDPVQMAWQGMRKQFCLFVTPTGRGIMFQKHRL
FT                   ASFLQAGLLVPVEEESLTVRATRDALAKLDADPDRLLH"
FT   gene            complement(382434..382886)
FT                   /locus_tag="Lcho_0347"
FT   CDS_pept        complement(382434..382886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0347"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   mpt:Mpe_A0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32622"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XW95"
FT                   /protein_id="ACB32622.1"
FT                   /translation="MFDVLVYLYENYWRPDACPDHDQLSKKLSAVGFESEEIADALTWL
FT                   DGLAGAAESHIGTQSELSLRVYSPSEQDHLGLASIAFISFLESAGVLPPAMREIAVDRA
FT                   MALGGGPVALEDLKIIVLMVFWSLGEEPDALILDELFVDAEDRLIH"
FT   gene            complement(382955..384094)
FT                   /locus_tag="Lcho_0348"
FT   CDS_pept        complement(382955..384094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0348"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: mpt:Mpe_A0281 putative smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32623"
FT                   /db_xref="GOA:B1XW96"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW96"
FT                   /protein_id="ACB32623.1"
FT                   /translation="MDRDELAAWLQLLETPGVGRQSARRLLAAFGSPQAVLSASVSARA
FT                   GVIDKATAAKLEQAPEGLALLVERTAAWLTGEPGRRILTLADPAYPSIWLNLPDPPLLL
FT                   YAQGKLDLLQRPALAIVGSRHPTPEGTDNARAFAASLSRTGLTIVSGLAAGIDGAAHEG
FT                   ALGGTGSTIALVGTGLDRVYPRAHLKLAREIADRGLLLSEFSIGTPPLAAHFPLRNRLI
FT                   AGLGMGTLVVEAALKSGSLITARLASEFGREVFAIPGSIHNPQSRGCHALIRQGAKLVE
FT                   STQDVLEELHLAVPAAAVSTGPAHAEPAAEQPDDANPPPDDVDDPILLALGWSAATLDV
FT                   LQARTGWATAELNVHLLDLELSGQVVRLPGQLFQRRAQA"
FT   gene            complement(384107..385291)
FT                   /locus_tag="Lcho_0349"
FT   CDS_pept        complement(384107..385291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0349"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   mpt:Mpe_A0282 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32624"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW97"
FT                   /protein_id="ACB32624.1"
FT                   /translation="MILRHPPIVRSQPLSALLGGLLGLALCSVALDSQAQAFPDYPITA
FT                   GQRSTARQVAQAGVPLSELAPDAPDSYTVKRGDTLWDISQIFLRSPWRWPELWGMNLEQ
FT                   IRNPHLIYPGQLLVLVKSNGRARLEMGRAVEGGTQKLSPRARAAGIDRGPIGPIAMHLI
FT                   QPFLNDAVVLDSNELESAPRIVAGREGRVLLGRGDIAYVRGDLPPRRDWQVFRQAKPLH
FT                   DPASGEVLGYEAAFVGSAEYIQPGRTQPGAENTTELVPATFNLVSLRQEAGVGDRLAAA
FT                   PPRDDSLYVPHSPAAPLEALVVSIYGDGLHAGQNQIVSVNRGKSTGMEPGHVLAIWRTG
FT                   SLVRDAEDPQRQALRLPDERNGNLFIFRVFNRVSYGLILSSETPVRAGDRITQP"
FT   sig_peptide     complement(385184..385291)
FT                   /locus_tag="Lcho_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.721 at
FT                   residue 36"
FT   gene            385464..385979
FT                   /locus_tag="Lcho_0350"
FT   CDS_pept        385464..385979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0350"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: mpt:Mpe_A0283 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32625"
FT                   /db_xref="GOA:B1XW98"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B1XW98"
FT                   /protein_id="ACB32625.1"
FT                   /translation="MSLLPILRYPDPRLNKIARPVIQVDERIRQLVSDMFETMYEARGI
FT                   GLAATQVDVHERVIVIDVSEERNDPLVLINPRIVAASEEMMVGDEGCLSVPTIYDRVER
FT                   HAQVQVEALDRNGQRYEFEADGLLSVCVQHEMDHLLGKVFVEYLSPLKRNRIRSKMIKR
FT                   GRDDGESA"
FT   gene            385976..386944
FT                   /locus_tag="Lcho_0351"
FT   CDS_pept        385976..386944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0351"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: ajs:Ajs_4053
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32626"
FT                   /db_xref="GOA:B1XW99"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XW99"
FT                   /protein_id="ACB32626.1"
FT                   /translation="MTSLRVAFAGTPEFARAALARIHAAGHDVPLVLTQPDRPAGRGMK
FT                   LQASPVKQLALDLGVPVAQPMSLRLDGKYPAEAAAAQAALLAAQIDVMVVAAYGLILPA
FT                   WVLELPRLGCLNIHASLLPRWRGAAPIHRAIEAGDTQTGITLMQMDQGLDTGAMLLTAV
FT                   EPIGPADTTASLHDRLAVLGAELVLQALDAAAAGTLQPVVQPLEGVTYAHKIDKREAPI
FT                   DWSLPAAVIERRVRAFDPFPGATFSLGGDTLKLWSAQVVDLPAGHGHAAGEVISTEGGT
FT                   PLVACGEGALALTQLQRAGGKRLSGRDYLQARPVVVGVRAG"
FT   gene            387029..387490
FT                   /locus_tag="Lcho_0352"
FT   CDS_pept        387029..387490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32627"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA0"
FT                   /protein_id="ACB32627.1"
FT                   /translation="MRILTVLALLLASVLVAGCDALGIESTTATAARKEADGMAIGSAC
FT                   RHALRAIEDCYTLNPKAAKASVYAGWREMDEYMRENKIEGVVPVIPRKSAKPAAPASAP
FT                   DGAETSDAAGATGDERHGTARSEAEAPPAEPAARSKAHNKVAARELTTH"
FT   sig_peptide     387029..387085
FT                   /locus_tag="Lcho_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.479 at
FT                   residue 19"
FT   gene            387589..388368
FT                   /locus_tag="Lcho_0353"
FT   CDS_pept        387589..388368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0353"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: mpt:Mpe_A0287
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32628"
FT                   /db_xref="GOA:B1XWA1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA1"
FT                   /protein_id="ACB32628.1"
FT                   /translation="MPRLAALRRASRELLADPHLRRGAADMLPMLPGVAAWGLVTGVAM
FT                   VKSGLSVPLALLMTLTVYAGTSQLAALPLMAVGAPMWVVLMTGFVVNLRFLIYSVHWRW
FT                   YFGGLPRSTRLWLGYLAADLNYALFLKAWPEPRPEPGQVPYFIGGVAVVWLGWQLPSFV
FT                   GIVAADVIPPQWGLGFAGTLALIGLTCTLLIDRATWVCAAVAASAAVAAYALPYKLHIV
FT                   VAVAAAVAAGLMMDGLGGKGRALDALRAWRDQRGRAG"
FT   gene            388419..388748
FT                   /locus_tag="Lcho_0354"
FT   CDS_pept        388419..388748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0354"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   ajs:Ajs_4055 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32629"
FT                   /db_xref="GOA:B1XWA2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA2"
FT                   /protein_id="ACB32629.1"
FT                   /translation="MDTWEAALTIVGLAFITLLTRGLFLYPHKEWPLPHWAKRALKYAP
FT                   LAALVAIVVPEVLLTQGRLLGTLADARLLGAVAGVLYFSWRRGILGTIVTGMLVYLPLR
FT                   IGLGW"
FT   gene            388819..390012
FT                   /locus_tag="Lcho_0355"
FT   CDS_pept        388819..390012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0355"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: rfr:Rfer_3690
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32630"
FT                   /db_xref="GOA:B1XWA3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XWA3"
FT                   /protein_id="ACB32630.1"
FT                   /translation="MKILRLQDLIAAGQVAGQRVFIRADLNVPQDDAGHITEDTRIRAS
FT                   IPCIEMALKAGAAVMVTSHLGRPTEGEFKPEDSLAPVAARMGELMGREIPVIANWTDGV
FT                   EVAPGQLVMLENCRLNKGEKKNNEALAQKMAALCDIFVHDAFGTAHRAEASTYGIAQFA
FT                   KIACAGPLLAAEIDAISLALANPKRPLVAIVAGSKVSTKLTILKALSANVDGLIVGGGI
FT                   ANTFLLAAGLSIGKSLAEPDLVGEARAVIDAMKARGAAVPIPVDVVCAKTFSPTAEATV
FT                   KAATDVADDDLILDIGPQTAAILAAQLKAAGTIVWNGPVGVFEFDAFAHGTETLARAIA
FT                   ESDAFSIAGGGDTLAAIAKYGIEKDVGYISTGGGAFLEVLEGKTLPAFEILTKRAAG"
FT   gene            390155..390637
FT                   /locus_tag="Lcho_0356"
FT   CDS_pept        390155..390637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4909 protein of unknown function
FT                   DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32631"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA4"
FT                   /protein_id="ACB32631.1"
FT                   /translation="MAFVAVLVDCDNTAPDVLEHALRVVAQFGQVVLRRGYSSHTTLAN
FT                   KWQEALVRLAFTPCLQFQYAAGKNTSDIALALDALEAMFDRRSDTFCLVTSDSDFAYLG
FT                   GLGQYLKRTDPAFSPKTDGHCGLLDMLRTYDLLVVQQEPGGHWTVRLEPRAEGEEG"
FT   gene            390738..391043
FT                   /locus_tag="Lcho_0357"
FT   CDS_pept        390738..391043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0357"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: rrs:RoseRS_2453 DNA polymerase, beta domain protein
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32632"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA5"
FT                   /protein_id="ACB32632.1"
FT                   /translation="MTVPALISLSAGDLAPICRRHGIHRLAVFGSRLKGTARADSDLDL
FT                   LVEFEPGRVPGLLGLSAIEIELTEALGVKVDLRTAQDLSPYFRDEVLRQAQVAYAG"
FT   gene            391033..391371
FT                   /locus_tag="Lcho_0358"
FT   CDS_pept        391033..391371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0358"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   afw:Anae109_0233 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32633"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA6"
FT                   /protein_id="ACB32633.1"
FT                   /translation="MQADDRIRIRHMVDAANAARGFLSGRQRADLDTDQMLLFAVVRAI
FT                   EIIGEAAARVSPECRAAVPGVPWPAIIGMRNRMVHAYFDIDHDVVWQTVQVELAPLMSV
FT                   LQAALNRP"
FT   gene            391574..393883
FT                   /locus_tag="Lcho_0359"
FT   CDS_pept        391574..393883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0359"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   aav:Aave_1095 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32634"
FT                   /db_xref="GOA:B1XWA7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA7"
FT                   /protein_id="ACB32634.1"
FT                   /translation="MPALTPAEQALRDAALEYHRSPVRGKIAVTPLKPLMNQRDLSLAY
FT                   SPGVAYACLAIQDDPSLAAEYTSRANLVGVVTNGTAVLGLGDIGPLAGKPVMEGKGCLF
FT                   KKFAGIDVFDIELAERDPDKLVDIIAALEPTLGGVNLEDIKAPECFYIEKKLRERMKIP
FT                   VFHDDQHGTAIISGAALLNGLELVGKPIGDVKLVVSGAGAAAIACLDLMVGLGVRLENI
FT                   YVCDSKGVIREGRADVQAGKLDESKQRYCQRTNAATLADVIRGADVFLGCSAPGVLTQD
FT                   MVATMGDKPIILALANPEPEIRPELARAAKPDCIMATGRSDYPNQVNNVLCFPYIFRGA
FT                   LDCGATTINEAMKLACVREIAALAKEETSDEVAAAYAGQELQFGPEYIIPKPFDVRLIL
FT                   RIAPAVAKAAADSGVAARPIADLEAYRESLTRYVYQTGMFMRPVFAAAKRAPARVVYAE
FT                   GEDERVLRAVQVVLAEGLAKPILVGRPNVIQMRIERAGLRLKAGVDFEVVDPEDDPRFR
FT                   ACWEEYHRVMGREGVSVEAAKAAVRRSTTLISALLLKRGDADAMLCGLHGRYDSHFEHV
FT                   KAVIGARPCTRVMGTMNALMLEEHNLFITDTFINEEPSAEELAEIARMAAEEVRRFGVP
FT                   PKVAFLSHSVFGSSNRASARRMRLARDLFVARCPEIECDGEMHGDAALSEKIRRQVLPE
FT                   TTLTGSANVLVLPNIDAANILFNVLKVTSGHGVTIGPILLGAAAPVHVLTPSATMRRVV
FT                   NMTALAVADAAALRRS"
FT   gene            393987..395417
FT                   /locus_tag="Lcho_0360"
FT   CDS_pept        393987..395417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0360"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: mpt:Mpe_A0290 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32635"
FT                   /db_xref="GOA:B1XWA8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA8"
FT                   /protein_id="ACB32635.1"
FT                   /translation="MPRHTKIVATLGPASSDPAVLERMIRAGVDVVRLNFSHGKAQDHI
FT                   DRANLVRDVARRVGKPVAIMADLQGPKIRVGKFAEGKVMLENGMPFVLDAARTELGDLG
FT                   GVGLDYKELPRDVRPGDTLLLNDGLIVLTVDAVRGEEVRTTVKVGGELSNNKGINKQGG
FT                   GLTAPALTAKDMDDIKTAMSFQCEYLAVSFPKNATDMEMARQLANVAGEPWRHKPGMIA
FT                   KIERSEAIPLLDSILRASDGIMVARGDLAVEVGNAAVPALQKRMIRMARALDKITITAT
FT                   QMMESMILAPIPTRAEVSDVANAVLDGTDAVMLSAETAAGKYPVETIEQMAAIALAAEA
FT                   AEETKLDADFRNKTFGRIDQSIAMGALFTAHHLGCKAILALTESGSTALWMSRYQIDVP
FT                   IYGLTTTPLSERRMALYRNVRPILMAKFDDRDTALAAAERLLVERGVLMPGDTYAITCG
FT                   EPMGYPGGTNMLKVCRVA"
FT   gene            395625..396689
FT                   /locus_tag="Lcho_0361"
FT   CDS_pept        395625..396689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0361"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: rso:RSc0573 fructose-1,6-bisphosphate
FT                   aldolase; TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II, Calvin cycle
FT                   subtype; PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32636"
FT                   /db_xref="GOA:B1XWA9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWA9"
FT                   /protein_id="ACB32636.1"
FT                   /translation="MSLVSMRQLLDHAAENGYGIPAFNVNNLEQVQAVMAAAAEVGAPV
FT                   ILQASAGARKYAGEAFIKHLIQAAVEAYPHIPLVMHQDHGQTPAICQGAINLGFGSVMM
FT                   DGSLREDGKTPADFAYNVDVTRKVVDMAHAVGVTVEGELGCLGSLETGEAGEEDGIGAV
FT                   GKLDHSQMLTDPEEAAQFVKATQLDALAIAIGTSHGAYKFTRPPTGDVLAISRVKEIHA
FT                   RIPNTHLVMHGSSSVPQDLLALINQYGGKMKETYGVPVSEIQEAIKFGVRKINIDTDIR
FT                   LAMTAAVRKFMAENPEKFDAREWLKPAREAATKICKQRYIEFGCEGQAGKIKAVGLDEI
FT                   ARRYASGALAQQVL"
FT   gene            396807..397715
FT                   /locus_tag="Lcho_0362"
FT   CDS_pept        396807..397715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0362"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: mpt:Mpe_A0292
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32637"
FT                   /db_xref="GOA:B1XWZ1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XWZ1"
FT                   /protein_id="ACB32637.1"
FT                   /translation="MTAALLESQLHSLPLLARGKVRDNYAVGTDRILMVASDRLSAFDV
FT                   IMGEGIPGKGELLTRVALYWFDRLGHIVPNHLTGADPVSVVAPDEVDQVRGRSMLVKRL
FT                   KPLPVEAVVRGYLAGSGWKEYQETRSVCGVALPSGLTNAARLPAPIFTPATKAEMGDHD
FT                   INISFERMSEIIGADLAERVRAISIQLYSSAAEIALSKGIIIADTKFEFGLDEDGTLTL
FT                   MDEVLTPDSSRYWPIEHYQSAYAQGRNPPSFDKQFVRDWLESVRIDGQPWNKQAPAPAL
FT                   PDDVIVHTAATYREALERLTA"
FT   gene            397741..398859
FT                   /locus_tag="Lcho_0363"
FT   CDS_pept        397741..398859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32638"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ2"
FT                   /protein_id="ACB32638.1"
FT                   /translation="MYRLLTSLEEAIALGRIPGEVPFLRAERAVVHARLGELELARREV
FT                   AILRGLSETQTSPALNAWLWLAEGLADYYENLSLRARDRVHRAMALAASLKSARVHALA
FT                   AAWLAHMSFRVHDYTATVQHLGTALRMAAAEHHAARSRACIVVAGVYHYAGREDLAQPW
FT                   YLQARTHAATEGDGAALSSIMYNMAALRVMGVRLAERFGAADELKAKRARLGTESSLFL
FT                   DQSVRTKALSNHPPIQRALILTAHGEFAEALGLYEHHLTEALAEGLTGSECLFQADRAW
FT                   CLLELGRSDEALSAARLADSAFLYATEPEEEAIAHALLSMVFERLGLPDVALVHADAAQ
FT                   RMHGVYQAHCRTLLQAMDAAQLETLRLGPIAA"
FT   gene            complement(398884..399822)
FT                   /locus_tag="Lcho_0364"
FT   CDS_pept        complement(398884..399822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0364"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: mpt:Mpe_A0294
FT                   putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32639"
FT                   /db_xref="GOA:B1XWZ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ3"
FT                   /protein_id="ACB32639.1"
FT                   /translation="MIDITLQNFESELIHGSQQQPVLLDIWAPWCGPCKQLGPVLEKLE
FT                   AAYEGRFVLAKLNSDEVPEISSQLSQMFGVRSIPFCVMFSQGQPVDGFVGAIPEDKIRE
FT                   FLDKHVPSLESLEAEADLEEAAELAEDNPDAALAKLQEAVAIDPANDAARYDYIKLLLQ
FT                   MNRLAEARRAYQPVASKALHDTRLAALGAWLDAGEAAQQARPAAELDAAIAANKRDFAA
FT                   RFERAQVLFAQQDLTAAMDELLEILMRDKAWSEGLARKTYVAILELMTKPAPKPAAAEA
FT                   KGALELTGKTAVAPADPLLDQYRRKLSMVLF"
FT   gene            399871..400365
FT                   /locus_tag="Lcho_0365"
FT   CDS_pept        399871..400365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0365"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pna:Pnap_3863 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32640"
FT                   /db_xref="GOA:B1XWZ4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ4"
FT                   /protein_id="ACB32640.1"
FT                   /translation="MNSASPVVGIVMGSNSDWDTMQHAAQILADFGVPFEARVVSAHRM
FT                   PDDMFAYAESARGRGLQAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASKHLQGVDSLHS
FT                   IVQMPKGIPVATFAIGVAGAANAALFAVAQLANHDAALLEKLEAFRVRQTEVARAMKLG
FT                   D"
FT   gene            400365..401585
FT                   /locus_tag="Lcho_0366"
FT   CDS_pept        400365..401585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0366"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: mpt:Mpe_A0296 phosphoribosylaminoimidazole
FT                   carboxylase; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, ATPase subunit; PFAM: ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32641"
FT                   /db_xref="GOA:B1XWZ5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ5"
FT                   /protein_id="ACB32641.1"
FT                   /translation="MTSTSHVIPTLLPGQASPAAPQRLATLGVMGGGQLGRMFVHAAQQ
FT                   LGFRTAVLEPDATSPAGLVAHAHVVSDYLDAAGLDRLADEADAITTEFENVPAQALRQL
FT                   ALRRPVAPAGDVVAVCQDRAAEKAHFAASGVPCARNHLIETEADLAAVDAALLPGILKT
FT                   ARLGYDGKGQRRVSDRAELAAAWRELQGVPCLLEQMLPLAQELSVIVARSATGELVHLP
FT                   VQQNLHRDGILAVTVVPAPDIDAATQAEAVAAAGRIAHELAYVGVLCIEFFVLADGRLV
FT                   ANEMAPRPHNSGHHSVDSCDISQFELQVRTLAGLPLAEPRLHSSAVMLNLLGDLWFDAA
FT                   AGADAAERTPDWRPILALPGAHLHLYGKQSARRGRKMGHLTFTAASPQAARDVALQAAA
FT                   LLGIEPF"
FT   gene            401600..402640
FT                   /locus_tag="Lcho_0367"
FT   CDS_pept        401600..402640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0367"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   mpt:Mpe_A0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32642"
FT                   /db_xref="GOA:B1XWZ6"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ6"
FT                   /protein_id="ACB32642.1"
FT                   /translation="MPQRLQTRTEAETAAAVALAAQRLAAGELVAFPTETVYGLGARAD
FT                   DADAVVKIFAAKGRPSDHPLIVHVADAASALAFAAELPPVARRLMDAFWPGPLSLVVPR
FT                   RADVAAAAAGGQSSVGLRCPAHPVAQALLRAAAAAGVPGVAAPSANRFGRVSPTRAAHV
FT                   IDEFADLADLPVLDGGDCELGIESAIVDCTRGYPVLLRPGCLGAAQIEAAAGEPLRSRD
FT                   EQAPRASGTLEAHYAPRAKVRLMDRQQIQTALQVLHGSLPAGKAARAAAPGLTLAVYSR
FT                   GPRPASQPGVLWRTMPADAGAAAHELFGVLRELDDALVQLIWVEQPPSEPAWDGVRDRL
FT                   QRASAA"
FT   gene            402690..403679
FT                   /locus_tag="Lcho_0368"
FT   CDS_pept        402690..403679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32643"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ7"
FT                   /protein_id="ACB32643.1"
FT                   /translation="MSPLPLFARALRCAAAVFAFTVLLSGCDSSSRIEDYVPTRVISFG
FT                   DELSLIKGDGSKYTINGFTSGTTTRDCTVNPVWNQSLASNFGLAFPACKPATLAIANGS
FT                   MNAVQGVSVAGVETQVNAVASSEFVPSTLVTIQGGMWDVISAYNTYKTNANRDAAFVLV
FT                   RAAGAQLAGLVNRIANNGAGARVLYATVPDLGYSPLAITEQAAAGTCVVDCRQFLIDLS
FT                   AAFNESLRVNVLNDGRYAGLVAFDDMLRSMANPTIRTTVYGLINTDAATSVAACTNPDT
FT                   SLCDTTTLVPELAGSATGYLWASDRLPGPNWHSRVAGVAITRARNNPF"
FT   sig_peptide     402690..402749
FT                   /locus_tag="Lcho_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.786) with cleavage site probability 0.425 at
FT                   residue 20"
FT   gene            complement(403715..405139)
FT                   /locus_tag="Lcho_0369"
FT   CDS_pept        complement(403715..405139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0369"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: ajs:Ajs_3939 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32644"
FT                   /db_xref="GOA:B1XWZ8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ8"
FT                   /protein_id="ACB32644.1"
FT                   /translation="MCGLMLLAGGTGAPSAGAQVPPAGQPGTPLPTTIRTALAQAQLPA
FT                   DSLYLWIAPAGGGEARLSHQAGQLAHPASLMKLVTSAAALQQLGRSFQWHTTLHLDGTP
FT                   RQGVLAGSLHIKGGGDPKLVPERLWLLLRQVQQLGIDEIRGDIVLDRSAYALPEIDPAA
FT                   FDGEPLKPYNVRPDALLVNYKSITLGFRPDPARGVASVSAEPALAGWTPPDSVRLSDGP
FT                   CNDWRAGLQADFSSPQRWRLTGSYPLACGERNWPIAYNEPASYAARVIEAQWRALGGRL
FT                   QGRVREGLVPAGLPETAAFLSPPLAEVMRDMNLHSNNQIAQQMLLALSPQLPATFEAAR
FT                   QPVANLLGAVGCDSAELRLDNGSGLSRDERITPRCLGRWLQWSWRQPWMPDLLGSLPLA
FT                   GEGTARRAFSVAGRAHLKTGSLANVAAIAGVVHGADGQRQVVVAMLNHPQASRDGARQV
FT                   LDAVLRWSVEEPTAPR"
FT   sig_peptide     complement(405083..405139)
FT                   /locus_tag="Lcho_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.982 at
FT                   residue 19"
FT   gene            405334..406080
FT                   /locus_tag="Lcho_0370"
FT   CDS_pept        405334..406080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0370"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   mpt:Mpe_A0301 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32645"
FT                   /db_xref="GOA:B1XWZ9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B1XWZ9"
FT                   /protein_id="ACB32645.1"
FT                   /translation="MSSPRLLALDTATETLHLALVQGDQVLTRALPGGAQSSALLLPAV
FT                   AELLAQAGWTLAQLDAVAFGRGPGAFTGLRSACSVSQGLALGLDRPLIALDTLAAVAEA
FT                   AFQRGAGAQVWALLDARMGEIYAAPWRRIGPGHWAAPDDLAAGVDPAPCLYTPAALLRA
FT                   IEAAPADLAGPGLDAHADALAAAPGRRLAAALPDGAALAVLARAAHARGAWIDPALALP
FT                   LYVRDKVAQTTVERGLARQAAASSAA"
FT   gene            406088..406594
FT                   /locus_tag="Lcho_0371"
FT   CDS_pept        406088..406594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0371"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: mpt:Mpe_A0302 putative ribosomal-protein
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32646"
FT                   /db_xref="GOA:B1XX00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX00"
FT                   /protein_id="ACB32646.1"
FT                   /translation="MSARASNWPAAPILRSIGIEHLDQVMAIELQAYPFPWSRGNFVDA
FT                   LAAGYLAQCLQAPSGELLAYQFAMAGFEEWHLLNLTVAPAHQGQGHGLRLLDTLAQHTR
FT                   ATGAHFLWLEVRPSNLRARALYHRFGFEQIGLRRAYYPDTGGRREDALVLRWRAGAAEA
FT                   ADAVD"
FT   gene            406581..407465
FT                   /locus_tag="Lcho_0372"
FT   CDS_pept        406581..407465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0372"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   mpt:Mpe_A0303 putative DNA polymerase-related protein,
FT                   bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32647"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX01"
FT                   /protein_id="ACB32647.1"
FT                   /translation="MPWTERQRAMLGEIGIRLWPSPQAGAAETPAAPPAAVPVVPVARS
FT                   LAQPAPGLAVPTAANPAPSATAPPPSVVRPRVDPAPAAPAAPLARPGGLIQAAPAGAVS
FT                   ALDWPELQAVVEACRACGLCESRRQTVFGVGHHQAHWMLVGEAPGEQEDLQGEPFVGKA
FT                   GQLLDNMLRAVGLTREQAEPARQVYIANVLKCRPPGNRNPDPQEVQRCEPFLQRQVELV
FT                   RPRLILAMGRFAVQSLLKTSEPIGRLRGKSHHYHGVPVVVTYHPAYLLRNPLDKARAWE
FT                   DLCLARELIQAAA"
FT   gene            complement(407485..408567)
FT                   /locus_tag="Lcho_0373"
FT   CDS_pept        complement(407485..408567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0373"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mpt:Mpe_A0305 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32648"
FT                   /db_xref="GOA:B1XX02"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX02"
FT                   /protein_id="ACB32648.1"
FT                   /translation="MRAFLIDDSGCVELDAWPDQLPPGGHLWLACPRREFEVQVAQVQA
FT                   ALHRWTGGSLVDLHISDLLNQHLPSHYDYTSWYDLLVFRRLAAAPGSNGPPTPESTAQA
FT                   MQALQAIDTHPVGFAVFDRVLLTVHPADCPVREFFAQRLTQIQPVSGGTSRLPASPADL
FT                   MLRIVNHMVDGYLELRRLLSRQLDTLQNKLLGPRSRHRNWQALLESRNSLHQLEDICED
FT                   QRSAMQEWIDALDEWPPAKDSQAARERELLRVRSRDVLEHIERVLSHVRRLESSSESAM
FT                   QMHFSALGQRTNDIMRTLTVLTAIFLPLNLITGIFGMNFDFLPLIHSNTGFWIAMALMA
FT                   SVAVGLGAFFWRKRYLGTRH"
FT   gene            complement(408584..409591)
FT                   /locus_tag="Lcho_0374"
FT   CDS_pept        complement(408584..409591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0374"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32649"
FT                   /db_xref="GOA:B1XX03"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX03"
FT                   /protein_id="ACB32649.1"
FT                   /translation="MFAPASYPISRPRRLRRDAHTRALVREHQLQVSDLIYPVFVLEGQ
FT                   NLVQDVASMPGVQRRSLDQLLPVAEQCVALGIPVMALFPVLGPDGKTPDGREACNPDGL
FT                   VPQVVSELKRRFPELGLMTDVALDPYTSHGQDGLIDDSGYVLNDETIDVLVKQALVQAR
FT                   AGVDIVAPSDMMDGRIGAIRRALEAEGLIHTRIMAYSAKYASAFYGPFRDAVGSAGNLG
FT                   KSDKKVYQMDPGNSDEALREVAMDLAEGADMVMVKPGMPYLDIVRRVKDEFRVPTFAYQ
FT                   VSGEYAMLKAAAANGWLAHDAVMMESLLAFKRAGADGVLTYFAIEAARLLRQQP"
FT   gene            complement(409947..410774)
FT                   /locus_tag="Lcho_0375"
FT   CDS_pept        complement(409947..410774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32650"
FT                   /db_xref="GOA:B1XX04"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX04"
FT                   /protein_id="ACB32650.1"
FT                   /translation="MDFSVLESTPFILVALSAIGVALLYWAWRRSHVNKASAPPAGRPR
FT                   TLDAVDTVIGWPPDATRVLTVRHQRAYEVLSRALPDHLILAQVPISHFIKVPTRHSYVE
FT                   WLRRVGHVCVDLMICDSASNVLAVVEVRQSERVETERARKRHLRVERVLRAAGIPLHVW
FT                   NEALLPDPSAVRKAFAPDTESDERDAGPDTSPLEQPLHGSGGRLRGRVPADADDESPGS
FT                   REPPRSTWFDELHATQPNSLDGADVTTHDIGHPGASAGGGLHPATRGAVPSHR"
FT   gene            complement(410901..412268)
FT                   /locus_tag="Lcho_0376"
FT   CDS_pept        complement(410901..412268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0376"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: ajs:Ajs_3626 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32651"
FT                   /db_xref="GOA:B1XX05"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX05"
FT                   /protein_id="ACB32651.1"
FT                   /translation="MASALSDRLSKLVKTMRGQARITESNVQDMLREVRMALLEADVAL
FT                   PVVRDFIARVKEKALGQEVAGSLNPGQALVGIVHKELAATMGEGVSDINLTVQPPAVIL
FT                   MAGLQGAGKTTTTAKLAKHLIERRKKKVLTVSADVYRPAAIEQLKTVTRQAGAEWFPSQ
FT                   GDQKPRDIALAAIDYARKHHFDVLLVDTAGRLAIDEALMAEIKDLHATLTPIETLFVVD
FT                   AMQGQDAINTARAFKEALPLTGIVLTKLDGDSRGGAALSVRSITGAPIKFAGVSEKIDG
FT                   LEVFDADRHAGRVLGMGDIVALVEEVQKGVDMQSAQKLADKIKSGDAFDLNDFLSQLSQ
FT                   MKKMGGLSSLLEKLPAEMAAKAGQADMGKAEKDVRRMEGMINSMTPLERRKPDLIKASR
FT                   KRRIAAGAGVQVQEVNRMLNQFEQMRDMMKKMKGGGLMKMMKRFGGAKRGFPGMGR"
FT   gene            412448..413215
FT                   /locus_tag="Lcho_0377"
FT   CDS_pept        412448..413215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0377"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   mpt:Mpe_A3219 ABC-type uncharacterized transport system
FT                   permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32652"
FT                   /db_xref="GOA:B1XX06"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX06"
FT                   /protein_id="ACB32652.1"
FT                   /translation="MLAYAIAARGVGGAWPYRALTLAWVAHGTAFLTHLFGIGLAGDGA
FT                   RFGFAPALSATAWLVLAVHAVESRFLPVPAVRRLLSVLGGVSVLLALLFPGEGAIHSGS
FT                   PWAPLHWLLGLASYGLFGAAVLHAAWLDRAERALRARTLPAGPSGPLPLLMLEKLTFRF
FT                   VAAGFVVLSIAVLLGVWFTPAWRWDHKTVFSMLGWLVFAGLLGGRQIFGWRGRRATRWL
FT                   YVGTGLLLLAYVGSRFVFEVLLHRSATMAGLGS"
FT   gene            413212..413472
FT                   /locus_tag="Lcho_0378"
FT   CDS_pept        413212..413472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_5308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32653"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX07"
FT                   /protein_id="ACB32653.1"
FT                   /translation="MRVLWWILLGLAAVWLFKSWRRRIDRADEPAAPPPTRPAPPTLPL
FT                   EMVRCAHCGVHLPSSEAIQSAGLPYCSPAHRDAGPRSPARG"
FT   gene            413479..415563
FT                   /locus_tag="Lcho_0379"
FT   CDS_pept        413479..415563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0379"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mpt:Mpe_A3217
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32654"
FT                   /db_xref="GOA:B1XX08"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX08"
FT                   /protein_id="ACB32654.1"
FT                   /translation="MPPRGPMGLPPFVDSDLPPRQAGRAAVRRESWFAGLGAGADSTRP
FT                   QEEDEPRAPDPVQPPRRRLAWPGRPAADKSIPLPDTVPADLFQAPAPPAPEPAAAPTRP
FT                   PRSGPPTEAPADSQRDESILRAEADTTPPKAFQRIFRGFVVARALLGVLLLAMQGVITV
FT                   YASVGPSLSGLAVCAAYSLSSLWLLAQVEMHWPPRLGPALGAGGQLRRRWVLVTVGVDL
FT                   LCFSLLLVATAQGPLNIGALLLLPVLMAGALMPRRAGVAVAAGVVIVMLAGAWWRVLAG
FT                   AEMAAQLTQAGMSGAVVFAMALLTTEMAERLARQEVTARSTLELARQQALLNRLMIEEM
FT                   QDGVMVVDRIGHVRAANPAAMALIGAPQGRRFAAFDLQEHEAWLPLWTALERGYAHGIW
FT                   PEGGEEISLQLNQGPHIEARGLRVRMRFTRRRDARSGEALCVLFLEDLRMLRARARQEK
FT                   LAAMGRVSAGIAHEIRNPLAAISQANALLAEDLTVPAQRQLARMVADNVERLQRIVDDV
FT                   MEVAPGAPRDAPAIDLPLQVQALCAEWARTAGLPQAGQSPLRVDVDEGVMAVKFDPDHL
FT                   RRVLVNLLENALRHGSGRPDALWVQVQSRGTDEVVLSVASDGAPIAGDVEPYLFEPFFS
FT                   TRSRGSGLGLYICRELCERYGATIEYRPRGAGARHRNVFVLTLPRRVPVPMSARQPKFS
FT                   "
FT   gene            415560..417128
FT                   /locus_tag="Lcho_0380"
FT   CDS_pept        415560..417128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0380"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: mpt:Mpe_A3216
FT                   type IV pilus expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32655"
FT                   /db_xref="GOA:B1XX09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX09"
FT                   /protein_id="ACB32655.1"
FT                   /translation="MSPSPLHSLLVVDDEPDLRTLYELTLLREGYEVETAATVEEAWAQ
FT                   LKDRTYSVLITDMRLPDGNGLELLRRLEQSGRSERTIVITAYGSAENAVLALKAGAYDY
FT                   LTKPVDLKLFRSVIASALGRTPNVRGTAASADVPADFGHGSRLLARRSSDNGSAALRRM
FT                   AGQSQAMQQVRELVEKVARSMAPVLVQGESGTGKELVARSIHQVSARAAQPFIAVNCGA
FT                   IPEQLLEAEFFGYRKGAFTGAAEDREGFFQAARGGTLFLDEIGDLPISMQSKLLRAIQE
FT                   RAVRPVGAVSEVPLDVRIISATHRDLATEVAAGRFRQDLYYRLNVIQIRVPPLRERSDD
FT                   LPELCTRVLERIAADTGLTQIPRLTVQALEHLARYDFPGNVRELENLLHRALALSGAAQ
FT                   ICVDDLELPRGQARAGEGGWGVAPPASTALQATQPPGAAVADTGAPPASLADLAIPTDL
FT                   VGYLDEVERAVLVRALERHRYNRTAAGSSMGLTLRQMRYRMARLGIHVAGEGLMVDDVD
FT                   GTGLE"
FT   gene            417125..417754
FT                   /locus_tag="Lcho_0381"
FT   CDS_pept        417125..417754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0381"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: mpt:Mpe_A3215 N-acetyl-anhydromuranmyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32656"
FT                   /db_xref="GOA:B1XX10"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX10"
FT                   /protein_id="ACB32656.1"
FT                   /translation="MTPGCGMRRSGAWSRGWHRDARRVPSPNFGSRPVGASIDLAVVHS
FT                   ISLPPGVYGGDAIERFFTNRLDPAAHPYFATLAGLQVSAHFVIRRDGELLQFVDVRERA
FT                   WHAGASSWRGRSNCNDHSLGIELEGLEGQRFEPAQYRVLAGLLRDARTAWPLREVVGHE
FT                   HIAPGRKHDPGAGFDWCRLARHLRGARLWVPAEVLAQPCRAVVRRA"
FT   gene            418116..420992
FT                   /locus_tag="Lcho_0382"
FT   CDS_pept        418116..420992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0382"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: mpt:Mpe_A3214 ribonucleotide-diphosphate
FT                   reductase subunit alpha; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP-cone domain
FT                   protein; Ribonucleotide reductase large subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32657"
FT                   /db_xref="GOA:B1XX11"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX11"
FT                   /protein_id="ACB32657.1"
FT                   /translation="MQATGTVHNVSRAPTVGQVHRDAAANASAYVGYQIIRRNGAVVAF
FT                   EPHKITVALMKAFLAVHGTHGAASASVRETVDGLTEAVVRALMRSRPSGGSFHIEDIQD
FT                   QVELGLMRGGHHDVARAYVLYRERRTQERASQGRAPVAAEPAVMVTDRGQRVPLDMARL
FT                   AGLIEAACADLGPEAIGAPVLAETRRNLYDGVSIDEVYKASILAARTLIEKDPSYSRVT
FT                   ARLLMHTIRRDVLGEEVTQAEMAARYADYFPAFIKKGVDAELLDERMAQFDLARLGAAL
FT                   KAERDLNFDYLGLQTLYDRYFLHIRKQRIEMPQAFFMRVAMGLALNEIDREARAIEFYE
FT                   VLSAFDFMSSTPTLFNAGTRRSQLSSCYLTTVPDDLEGIYDAIKDNALLSKFAGGLGND
FT                   WTPVRALGSHIKGTNGESQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEF
FT                   LELRKNTGDDRRRTHDMNTANWIPDLFMKRVMEGGDWTLFSPANCPDLHDLFGTAFEAA
FT                   YTAYEARADRGEITFFKRVRAVDLWRKILSMLFETGHPWITFKDACNVRSPQQHVGVVH
FT                   SSNLCTEITLNTNAGEIAVCNLGSVNLAQHVKDGEVDQAKLCRTVTTAMRMLDNVIDIN
FT                   YYAVKKARDSNLRHRPVGLGIMGFQDALYQLRVPYASNEAVEFADRSMEAVCYHAYWAS
FT                   TELAAERGRYATYRGSLWDRGILPIDSIALLAEQRGGYLDVDTRTTLDWDALRARIAQY
FT                   GMRNSNCVAIAPTATISNIIGVDASIEPCFGNLSVKSNLSGEFTVVNEYLVRDLKALGL
FT                   WDDVMVMDLKHFDGSLRRIDRVPEELKRLYATAFEVETQWLVEAAARRQKWIDQAQSLN
FT                   IYMAGASGKKLDETYKLAWLRGLKTTYYLRTMGATHAEKSTVKAGSMNAVSNGAHGSAS
FT                   EPAAVSSNEPATDVKFCAIDDPSCEACQ"
FT   gene            421096..422304
FT                   /locus_tag="Lcho_0383"
FT   CDS_pept        421096..422304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0383"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: mpt:Mpe_A3213
FT                   ribonucleotide-diphosphate reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32658"
FT                   /db_xref="GOA:B1XX12"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX12"
FT                   /protein_id="ACB32658.1"
FT                   /translation="MLVWEDTPRSTPTPASPMPSNVSRDVSMRVSSPSSVPSFSHPFVQ
FT                   STSQPPAAPSAASAAADAARRVNVADKRIINGQTDVNQLVPFKYKWAWEKYLATCANHW
FT                   MPQEVNMSRDIATWKDPNGLTDDERRLIKRNLGFFVTADSLAANNITLGTYRHITAPEC
FT                   RQFLLRQAFEEAIHTHAYQYIVESLGLDESEIFNAYHEVASIREKDEFLIPYIDAIMDP
FT                   HFKTGTPENDQTLLKSLIVFACLMEGLFFYVGFTQILALGRQNKMTGAAEQYQYILRDE
FT                   SMHCNFGIDLINAIKLENPHLWTPAFKAEIKALFLKAVELEYRYAEDTMPRGVLGLNAS
FT                   MFKGYLRYIANRRATQIGLEELFPNEENPFPWMSEMIDLKKERNFFETRVIEYQSGGAL
FT                   SWD"
FT   gene            423175..423552
FT                   /locus_tag="Lcho_0384"
FT   CDS_pept        423175..423552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0384"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   pol:Bpro_1104 protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32659"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX13"
FT                   /protein_id="ACB32659.1"
FT                   /translation="MPTSSRRTAVPAAVAGVPVLQAPFLIQQPDEVFLIDVAVVPNARR
FT                   TEVVGLHDQALRLRLAAPPVDGAANDALQRWLADELGVSKQQVSLLRGASGRRKRLRVQ
FT                   VPPAQMAAWLAALRLAGLLDA"
FT   gene            complement(423587..423982)
FT                   /locus_tag="Lcho_0385"
FT   CDS_pept        complement(423587..423982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32660"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX14"
FT                   /protein_id="ACB32660.1"
FT                   /translation="MSLLEGSLVALLLTLAGALLWHQHRQAVRARRESEQTLAISRETA
FT                   ARQLLELRAALAEALAEAQSERDKKQVQIDEVARLRSKYRRLYGNYTKLAEHLAAHLPD
FT                   SPPASSTSGERHAADMTPETRPGPTRG"
FT   gene            complement(424027..424935)
FT                   /locus_tag="Lcho_0386"
FT   CDS_pept        complement(424027..424935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0386"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mpt:Mpe_A3210
FT                   putative sugar kinase transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32661"
FT                   /db_xref="GOA:B1XX15"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX15"
FT                   /protein_id="ACB32661.1"
FT                   /translation="MPVLICGSLAFDTIANFHGRFAQQILPEHIHILNVSFLVPTLRRE
FT                   FGGCAGNIAYSLKALGGEPRVMATVGADGEGYLARLKAMQIDTRHIELLADAYTAQCHI
FT                   TTDQDNNQITAFHPGAMQQAARLVVPNPAGDIAIGIIAPDGREAMLLHARQMADAGIPF
FT                   VFDPGQGLPMFDGAELQHFLSLATWVTVNDYEGRMLCDRTGCDLDTLSRSHLRGLIVTL
FT                   GHEGCDVWIQGQVTRVPGIEASAVVDPTGCGDAFRAGLLYGLERGWDLVRSVELANRVG
FT                   AIKIASAGTQNHRLDPAELGL"
FT   gene            complement(425260..425376)
FT                   /locus_tag="Lcho_0387"
FT   CDS_pept        complement(425260..425376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32662"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX16"
FT                   /protein_id="ACB32662.1"
FT                   /translation="MKKFRWTDWAAAAALVFALSAFAGSENLDDPQASAQMR"
FT   sig_peptide     complement(425305..425376)
FT                   /locus_tag="Lcho_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 24"
FT   gene            complement(425522..427894)
FT                   /locus_tag="Lcho_0388"
FT   CDS_pept        complement(425522..427894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0388"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold domain protein; KEGG: mca:MCA0985 sensory box
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32663"
FT                   /db_xref="GOA:B1XX17"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX17"
FT                   /protein_id="ACB32663.1"
FT                   /translation="MSSRTDPANLDTAATPQAAQPRGDVSAQMVDLFYRQSPAALLGGA
FT                   IGALLVVLALQDALPALWLRSWLLAAELLIVGRLTTTLHYMHGGAERHSLARWRQLALV
FT                   FTIAQGLTWGSLGLMSLAVPTAQDEALILVCLLVIVAGSAALVGTLPLLVPLFGVLTLL
FT                   PITLVMALGSSGAQHFLAFCSFTFMLTVTVSLPRSMQRAIRARHSASLAQRDTLQRLEM
FT                   AEQMAHVGHLVWDAGAAQAQLSAGAQRMLGLDGVGALEHRDIVELVVPADRERVRLLIR
FT                   NSLQQTQSQLRYETQVSTPAGVRDLMVVQHLETGADGRVTRLMSTLQDTSELKQTQREL
FT                   QKLAFNDPLTGLGNRAWFMQALAGMLRQGERSALLMLDLDHFKAINDTLGHHAGDLLLG
FT                   MAAQRLQRVLGDTASLARLGGDEFAIILPAIASSAAAAQQAQALIDTLTRPFSVAGVEV
FT                   YVSASIGIAVSPQDADDTEALLRCADVAMFDAKGLGRAGYQFYAAQQSERARERVLLEG
FT                   DLRRAIERGELELHYQPKVDMRTDRVVGAEALLRWHHAERGMVPPDRFIPVAEDTGLII
FT                   PIGEWVLRTACTAATHWNRTRRARGQEALKIAVNLSPRQFWSPHFVAMVRAVMHETGCR
FT                   PEWIELEITESLLIDTRGQVSEILAELSRLGFTLAIDDFGTGYSALGYLTRFPISTLKI
FT                   DRSFVNEVATHPARASLVRAIVAMGHSLQLELVAEGVETHEQVQVLREMGCQLAQGWLY
FT                   GRPQARALFEAAHAPAELPVVTESAPSSQTDHFRHAA"
FT   gene            complement(428049..428807)
FT                   /locus_tag="Lcho_0389"
FT   CDS_pept        complement(428049..428807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0389"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   mpt:Mpe_A3628 putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32664"
FT                   /db_xref="GOA:B1XX18"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX18"
FT                   /protein_id="ACB32664.1"
FT                   /translation="MCQLLGLNANTPTDLVFSFTGFSQRAVEHKDGFGIAFFEGAGARL
FT                   FVDHHSATESPVAQMVRNYPIRSRHILAHIRKATQGGVALENTHPFQRELWGRYWVFAH
FT                   NGNLTDFKPKLHAAYHPVGQTDSERAFCWLLQELAKNHASLPSVAHLSETLAELVPQVA
FT                   RHGTFNFLLGNGEALWAHCSTRLHYVLRRHPFASAHLQDDDLTVDFATQTTPTDRVALI
FT                   VTEPLTRNEDWIALTPGELAVFVDGQRAAL"
FT   gene            complement(428830..430107)
FT                   /locus_tag="Lcho_0390"
FT   CDS_pept        complement(428830..430107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0390"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: mpt:Mpe_A0164
FT                   putative electron transfer oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32665"
FT                   /db_xref="GOA:B1XX19"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX19"
FT                   /protein_id="ACB32665.1"
FT                   /translation="MPHDPPLPDPDLARRALPRAPLPADCEVLVVGAGPAGSACATWLA
FT                   RAGVDVVLVDQHDFPRDKVCGDGLIPDAHAALARLGVLDAVMAQAQPIGHVRCVAPRGG
FT                   QVDVAGRLAVLPRRILDHLLVRHAQAGGARLHTPVKFEGLIEDGGRVRGARLRQAGADT
FT                   IHELRAGWVVLATGAAMPAMLGAGLCERRAPSGVALRAHVRNPALAGRQTTMDVVWHRA
FT                   LSPGYGWIFPCGGDVYNIGVGSFFKRDASTDAANLRDMFDAFTRVHAPAQALMQGGEWV
FT                   SELKGAPLRCTLAGARTGRPGLLATGEAIGSTYDFTGEGIGKALETGLMAAEALLAGRA
FT                   QGSAAAPADAQTLADYDARLATLKPRFSLYARANHINRYPWLADLVIWRARRSPGMRQR
FT                   MSGLLNETSNPGTLISLRGMLKLFTV"
FT   gene            430207..432579
FT                   /locus_tag="Lcho_0391"
FT   CDS_pept        430207..432579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0391"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: mpt:Mpe_A0430 patatin-like
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32666"
FT                   /db_xref="GOA:B1XX20"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX20"
FT                   /protein_id="ACB32666.1"
FT                   /translation="MNGPCLLPNPCATRPVLHRLAAVLLVLGLCGPARAEPAPTEPAPT
FT                   APSPRLKTCGTAQQPRPCVGLVLSGGGARGLAHVGVLKVLERERIPVDLIAGTSMGAII
FT                   GGLFASGMGAAELERELLALDWEALFASRVPRETLSQRRKEEDFEISPAVEIGLARDGS
FT                   PMLPLGSVSSRGLELLLRRYTLPVRTAPHFDALPIPFRAVATDMESGAPVVFERGDLAQ
FT                   ALRASMSVPAVFPPTDVDARVLGDGGLVDNLPVDVVRALGAQVVIAVNIGTPLAARDTL
FT                   GTVLGLTAQMINILTEQNVQRSIAGLDAERDLLIAPELGKITAADFGRVRELITLGESG
FT                   AQALQPRLQALALPAPEWAAHQAARRREWPQTAPITSVRFEGADITSPQRLAGALASQP
FT                   GQPFDIDRAEADTRALAASGDYLHADYGLEDLPAGTGLVFRLEEKPWGPHYFRLGLDVA
FT                   SDFVGRGEFNLKLSHNRHWLNEAGGEWRNRLQIGSVPRWHTEWYQPAGLLLADGGDTFV
FT                   SVHSDVERRRINVYAPLAPSADAAGAPLLGRFARAHWRAGIDLGRPLGSWGEWRLGVVR
FT                   QAQHFSPEIVAGGSSVSALESSRAQEWALRGALLLDQLDHVSFPRRGWRVRLVGEVGRR
FT                   WVAESVLAGGTESFHRLEADANTVTSAGPHTLDASLRLRHAHQGLIQGLGYYTLGGFHN
FT                   LSGYQAEQLSGNEVLLGRLTYTVRLNQRPVLTRGFFAGASLEAGNAWARSSEVDLGRLR
FT                   GGGSVFLGADTGLGPLYFGLTWAPRGSAGLYLQLGRP"
FT   sig_peptide     430207..430314
FT                   /locus_tag="Lcho_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.986 at
FT                   residue 36"
FT   gene            complement(432596..433588)
FT                   /locus_tag="Lcho_0392"
FT   CDS_pept        complement(432596..433588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0392"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pna:Pnap_0226
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32667"
FT                   /db_xref="GOA:B1XX21"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX21"
FT                   /protein_id="ACB32667.1"
FT                   /translation="MADLARLAGVSVATVSRALNGSPEVSLATRQRIGELARSLNYTVN
FT                   IGAKNLRTKQNRTVAVVIPYDEQSRQHITDPFFLAMLGSLADALTDRGFDLLLSRVDSG
FT                   YLAAASQLYESGAVIGTVLIGQWRHHAQLNALAQRGAPLVVWGAQLPQQVYCSVGGDNL
FT                   AGGQLATRHLIERGGRRIVFMGDPSLPEVAQRLAGYHQALAEAGIAPDPALQLNVPFET
FT                   GQARAALTRLIESGIAFDAIFACSDVLAISSMQLLRLYGRAVPQQVLVVGYDDIEWASH
FT                   ADPPLTTVRQPIAAAGIEIVQALFDGVAGQPTPPRTLPVELVVRQSSLR"
FT   gene            complement(433690..434487)
FT                   /locus_tag="Lcho_0393"
FT   CDS_pept        complement(433690..434487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0393"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mpt:Mpe_A0431 putative GTP-binding cell division protein
FT                   EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32668"
FT                   /db_xref="GOA:B1XX22"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX22"
FT                   /protein_id="ACB32668.1"
FT                   /translation="MMTPNPAPTQGGADATRAALSWAHTARFLTTASRLDQLPAHDLPE
FT                   IAFVGRSNAGKSTAINTLAQQRQLAFASKKPGRTQHINLFELGPKDAPSALWADLPGYG
FT                   YAAVERAAKLRWQAVMADYLKMRRNLAGVVQMIDSRHGFTALDRQLLEFVGPRVVTGEV
FT                   KLLVLLTKADKLNRKEASAALRSAQDFLADLSTDQSDLSVTLFSALKRQGVEDVAQTLH
FT                   DWRDASAAPIEGGLLAASAALRAERFETPDDVVIPADPAEPAA"
FT   gene            434538..435167
FT                   /locus_tag="Lcho_0394"
FT   CDS_pept        434538..435167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0394"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: mpt:Mpe_A0432
FT                   cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32669"
FT                   /db_xref="GOA:B1XX23"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX23"
FT                   /protein_id="ACB32669.1"
FT                   /translation="MKSPAQKLLALLAAVTLATPLWAADAAPAAKVDPAKGEALSAQVC
FT                   GACHTADGSRGTPANPILQGQHPEYLVKQLSEFKAGKRDSAVMKGFASMLSDADMKNVA
FT                   AFYAGKQAKPGAAKDKDLVVLGEKIYRGGIADRSIPACSGCHSPTGAGIPAQYPRLAGQ
FT                   HSDYTELQLKGFRDGVRKNNLQMTGVAAKLNDREIKAVSDYIAGLH"
FT   sig_peptide     434538..434609
FT                   /locus_tag="Lcho_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            435283..435672
FT                   /locus_tag="Lcho_0395"
FT   CDS_pept        435283..435672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32670"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX24"
FT                   /protein_id="ACB32670.1"
FT                   /translation="MPHVLRSPDGQVDSIHRHAVPGSEFLGDDAPELRQLLGDSAGGSA
FT                   DAAFASLDAGLIRVLEDLVDVLVARNIIRITDLPGEAQHKLFARKNFRDRFQRNSLDLG
FT                   VADQGMAGLLSFPGTPARHTDFDAL"
FT   gene            435763..436767
FT                   /locus_tag="Lcho_0396"
FT   CDS_pept        435763..436767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0396"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   mpt:Mpe_A0436 putative sulfite oxidase subunit YedY"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32671"
FT                   /db_xref="GOA:B1XX25"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX25"
FT                   /protein_id="ACB32671.1"
FT                   /translation="MSTRRHSHPDAGFIHPIASEITPSGVYASRRDLLRLGGLGALAGL
FT                   GLGHEAWAQAGAVARPGKLAALASARSSVAGAQVMEKITAYNDASTYNNYYEFGTDKAD
FT                   PARNAHKLITRPWTVTVEGECLKPGVFDMEALLKLAPMEERIYRMRCVEGWSMVLPWVG
FT                   WSVAELLKKVQPKGNAKYVEFVTLADPKQMPFVGSRVLDWPYIEGLRLDEAMHPLTLMA
FT                   FGMYGEVLPNQNGAPLRLVVPWKYGFKGAKSIVRIRLVEKQPATAWVKAGPQEYGFYSN
FT                   VNPNVDHPRWSQATERRIGEDGLFAKKRPTLMFNGYEAQVGQLYAGLDLKKNY"
FT   gene            436769..437494
FT                   /locus_tag="Lcho_0397"
FT   CDS_pept        436769..437494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0397"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: mpt:Mpe_A0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32672"
FT                   /db_xref="GOA:B1XX26"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX26"
FT                   /protein_id="ACB32672.1"
FT                   /translation="MDAASIASRGGAANAGSVQVRPAGLASRAHTLLQRALLKPWAKPV
FT                   ILLLCLLPIAGWVWGGVNNTLGANPAETILRGTGLWTLRMLCITLAVTPLRTWGKLPGL
FT                   ARMRRLFGLTAFFYGVLHFLSYAWLDMGFDPAAIVRDLDKRPFALVGFLALLLMLPLAL
FT                   TSFNRAIKAMGAARWQLLHKLVWPVIGLGLLHFLWMRASKQRFDEVALYAVLVLLLIAA
FT                   RWLRSRMTPAATRPATTRR"
FT   gene            437561..438190
FT                   /locus_tag="Lcho_0398"
FT   CDS_pept        437561..438190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0398"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   mpt:Mpe_A3339 conserved hypothetical protein VC0940"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32673"
FT                   /db_xref="GOA:B1XX27"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX27"
FT                   /protein_id="ACB32673.1"
FT                   /translation="MSTPAPAAASAAVTRHSRFEDLQALLSGTLLIALAVLMYRHAGLL
FT                   SGGTAGLAFLGHYASGWRFGTLFFLINLPFYWLAWRQMGRAFSVKTFLAVLLLSAESEV
FT                   LPQLISFRTLEPLYAAVMGGLLMGTGFLILFRHRASLGGVGILALALQERRGWRAGHVQ
FT                   MAVDVMIVAMALWLVEPQKVLMSIAGAVALNMILAINHRPGRYIAQ"
FT   gene            complement(438197..438961)
FT                   /locus_tag="Lcho_0399"
FT   CDS_pept        complement(438197..438961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0399"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: eba:ebA3865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32674"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX28"
FT                   /protein_id="ACB32674.1"
FT                   /translation="MQPDHATPARRASKPNRRSHRVRRALALLVLAGSQAAIAAPAAAT
FT                   LAAPGAGNGAAGSASALIAAVIEHRAGHFDKAARAFDELARAGLPAAMHNLAVMHLGGE
FT                   VTPASVETARGLLEQAAAAGFISSQLALAELHESGRLGRRDPAGALPWLRRAADAGHVD
FT                   SQVAVGTAYYLGRGIARDESQALDWYRKAARAGDVGAQYLVASMYETGLGVAVDLRLAR
FT                   YWYDVAAHLGDPAARGKRDQLDRQLSTATGAP"
FT   sig_peptide     complement(438842..438961)
FT                   /locus_tag="Lcho_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 40"
FT   gene            439096..439764
FT                   /locus_tag="Lcho_0400"
FT   CDS_pept        439096..439764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0400"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: pna:Pnap_0243
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32675"
FT                   /db_xref="GOA:B1XX29"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX29"
FT                   /protein_id="ACB32675.1"
FT                   /translation="MLIRNLARVPYEPTYDAMRAFTAARTPDSADELWLCEHDPVYTQG
FT                   IAGKAEHVLAPDGVPVVATNRGGQVTYHGPGQVVAYPLVDLKRLGIYVKEYVYRVEEAV
FT                   IRTLATWHVTGHRVSGAPGIYVRLDDPFDHRALTGPHDPRDPFRGLGKVSALGIKIANH
FT                   CTYHGVALNVAMDLSPYARINPCGYAGLQTVDLATLGVAAEWPDAAQRLGDRLAALLAP
FT                   "
FT   gene            439839..440834
FT                   /locus_tag="Lcho_0401"
FT   CDS_pept        439839..440834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0401"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: mpt:Mpe_A0316 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32676"
FT                   /db_xref="GOA:B1XX30"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XX30"
FT                   /protein_id="ACB32676.1"
FT                   /translation="MSTENTTRQAETGAAYDATAKQKAQAKTARIPIKVVPAETLKKPD
FT                   WIRVKAGSPTTRFYEIKNILREHQLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDVNEPANLAKTIAALKLKYVVITSVDRDDLRDGGAGHYVECIRQTR
FT                   AASPETRIEVLVPDFRGRMDRALEILKTAPPDVMNHNMETVPRLYKEARPGADYQFSLT
FT                   LLKRFKEEVPGVPTKSGLMVGLGETDDEILDVMRDMRAHDIDMLTIGQYLAPSGHHLPV
FT                   RRYVHPDTFRMFETEAYKMGFTHAAVGAMVRSSYHADQQAHQAGVDGAIG"
FT   gene            440921..441844
FT                   /locus_tag="Lcho_0402"
FT   CDS_pept        440921..441844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0402"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: azo:azo3910 hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32677"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX31"
FT                   /protein_id="ACB32677.1"
FT                   /translation="MRAAVSTRRIWLQAAALAAVSGAVPARAAPAAGLAIVGILEGSAR
FT                   LIRRAQRFAVLEGLALQAEDIVETAAGGFAQIEFADGLLIGLGDRSRLMLAPRWTPSAA
FT                   RDKPARAPLLYLLDGWLKFSQGGAAPAGPATRGDCLSPRLALNCKDATVVLQLEAAQSA
FT                   AFVETGALRLAERGGARGTLDVPANGFVVLRATGKPELAQRPSADFLAGMPRPFRDPLP
FT                   ARAARFAGREIVPKPLAEVSYDDVSAWLQAEPALRLPLLKRWRGRAADPAFRRAVQANL
FT                   AAHPEWEPVVYPERFRPKDGGSAGSR"
FT   sig_peptide     440921..441007
FT                   /locus_tag="Lcho_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(441836..442753)
FT                   /locus_tag="Lcho_0403"
FT   CDS_pept        complement(441836..442753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0403"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pol:Bpro_1453 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32678"
FT                   /db_xref="GOA:B1XX32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX32"
FT                   /protein_id="ACB32678.1"
FT                   /translation="MAHIPPLANLQAFEAVARRRSFALAAGELNLTASAVSHQIARLES
FT                   FLGVRLFDRSAQGVKLSAAGEGYLRRVAGALGAIGAATDDVRQGVRNSLYVHASPSFAS
FT                   LWLMPRLAHFAQAHPGISLFLSASPTHSDFALGQADLDVRYGTPQWPDLVVQPIFEEPI
FT                   LPLASPAFIARHRLREPAELLLTPLIQSTVSVVQWADWLTTQGVTQGPERFALRFDRAQ
FT                   LALDAAVQGLGVALESATIAQAHIAEGRLAPLFDTARAVRVQAHFLVYPARHAKRPEVE
FT                   SFNAWLKDQASAAPGAAAQVPPSA"
FT   gene            442958..443707
FT                   /locus_tag="Lcho_0404"
FT   CDS_pept        442958..443707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0404"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pol:Bpro_1454 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32679"
FT                   /db_xref="GOA:B1XX33"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX33"
FT                   /protein_id="ACB32679.1"
FT                   /translation="MLLKDKVALITGGAGPNGLGFATARMMAEQGARIVILDLAQADPA
FT                   GAAARLGPQHIGVVADVTDKASCELAARTVLETCGRIDVLVNNAGITQPRKTVDITGAD
FT                   YDAVLDVSLRGTLYMSQAVLPAMRAQKGGAIVCISSVSAQRGGGILGGPHYSAAKAGVL
FT                   GLARAMAREYGNDNVRINCVTPGLIATDINKGLIPADRMVGILEQIPLNRIGGPDDVAG
FT                   CVVFLASDLARYCTGVTLDVNGGMLIH"
FT   gene            443860..444852
FT                   /locus_tag="Lcho_0405"
FT   CDS_pept        443860..444852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0405"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: pol:Bpro_1455 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32680"
FT                   /db_xref="GOA:B1XX34"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX34"
FT                   /protein_id="ACB32680.1"
FT                   /translation="MQRRNLTLASIAFAVQALLAVGAAQAQAVKLSLGHGAAPGNPRHE
FT                   ASVKFAEVVKAKSAGRIEVQVSPSAQLGDDAAMVTALRTGAIDFSANSQGAVAGVVPEY
FT                   AAFGMPFLFANLPQAWKVLDGPLGQELAQKSADKGLVVLGYWDNGVRHMSNSKRPLLKP
FT                   EDLKGLKMRTPPDAVTVDIMQSLGAEAQQIKFAELYVALQQGVVDGQENPLMNIHASKL
FT                   YEVQKFISLTGHKYEMTPFLMSKRSWDKLSDADKKAVQEAAAEATALQRKLSQESDEKL
FT                   VADLKAKGVRVDVADKAAFEKATGTVDDKWMASPIGPFVKKVITTARAQ"
FT   sig_peptide     443860..443940
FT                   /locus_tag="Lcho_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.902 at
FT                   residue 27"
FT   gene            444932..445462
FT                   /locus_tag="Lcho_0406"
FT   CDS_pept        444932..445462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0406"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: dac:Daci_0730 tripartite
FT                   ATP-independent periplasmic transporter DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32681"
FT                   /db_xref="GOA:B1XX35"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX35"
FT                   /protein_id="ACB32681.1"
FT                   /translation="MKSLERAITRVCQSVMWITTAVIFVILAINTLLRYSTGASLQWGN
FT                   EVPELLFPWLVMAGVVLGAVHGSHITTSFLMDAVPAALRRIVAVLGWLGVAGLYATLTW
FT                   ATWNMLDIVADEKSPILQVPGSVTYGCVMGGMAMLAVLALGSAWTAWRGESNGLGHGQG
FT                   HDDAAAAPQVNIA"
FT   gene            445478..446737
FT                   /locus_tag="Lcho_0407"
FT   CDS_pept        445478..446737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0407"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: pol:Bpro_1457 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32682"
FT                   /db_xref="GOA:B1XX36"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX36"
FT                   /protein_id="ACB32682.1"
FT                   /translation="MTALILMVFGIAAVAAVPIAHALLMAAMAAAATSDRVPLDLLVQQ
FT                   MVAQVQSFPLIAIPFFMLTGTLMMGGKLGESLIGVLTTLIGRFHGGPGQVGVLSSTLFG
FT                   GVSGSAVADASAIGSLLIPWQKRLGYPPAFSAATLAAAATIDILIPPSIPMILFALSSN
FT                   TSIAALFVAGILPGLAMCVGFMAVCWWVGKRRNFPRDVRTLDWPVFRKQLLYASPALVL
FT                   PVLIIVFLRFGIATPTEVSVLSTLYAGVVSAVIYRDLGMKRLNHAVFEAGLATGVVLLV
FT                   IMASAAIGWLLTYDHMPDGVVAWATANLDSAWSVILLMNLLMLVCGMFIDLPAAVLLLT
FT                   PVFVPLANAIGMDLTQLGIMMTVNLAIGLYTPPVGTTLFITSAVARVKVGETVRELGPF
FT                   YLVAFGILALVSYVPATILR"
FT   sig_peptide     445478..445573
FT                   /locus_tag="Lcho_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.704 at
FT                   residue 32"
FT   gene            446756..447640
FT                   /locus_tag="Lcho_0408"
FT   CDS_pept        446756..447640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0408"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: pol:Bpro_1458 xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32683"
FT                   /db_xref="GOA:B1XX37"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX37"
FT                   /protein_id="ACB32683.1"
FT                   /translation="MTHLHVPATPGRDRIVSISGAPYDGYPAPHMFESLARIGATHVEP
FT                   AYIVGYTEPFDESSFTDERGAEYARWLADAGIGCFAMSSHIDLGRPDALAVFAGRMRFA
FT                   ARIGAKVINTNATARANEARFFQNIEPLARLAEQLDLVIGLENPGDGSDNLLNTAADAQ
FT                   ALLARIGHPRVGLNYDAGNTLSHRPAVSPADDALAAMPLCLHTHVKDVQRRPEGYFFTA
FT                   LGEGEIGCDRILRAIAATPLSLSIEIPMRLHRGPDAQPSRAAWRVPVADIEARLTAALD
FT                   YVGHHLAAARQAA"
FT   gene            complement(447659..448678)
FT                   /locus_tag="Lcho_0409"
FT   CDS_pept        complement(447659..448678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0409"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   vei:Veis_2041 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32684"
FT                   /db_xref="GOA:B1XX38"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX38"
FT                   /protein_id="ACB32684.1"
FT                   /translation="MTDTAARPLDKPPARSAASSPMSHEELTQIATLYYIDGQTQDELS
FT                   RRFGISRATVGRVLKRAQELGIVEIRVHHHPTKTVDLEAQLIERFGISRALLSVDHKDP
FT                   DKQRALLGGLVATYLERTLSDGAIVAVGMGRNVSAVSEHAMSATQRHCTFVCAIGGSYR
FT                   GGESMNPDHICRRLAARYGGESETLYAPAMVGDAALRRALVDNDTVRHTLDKARRADIA
FT                   LVGVGDMSEDSNMVRMGWFTAQEIAEAKRSGTVGDVMGYDFIDIHGLPSLAPIQGRVVG
FT                   LHTGDLQRIPNVIAIAAENTKVTALLGALRTGSIDTLATTASNAMAVLHLDDATRAGS"
FT   gene            complement(448715..449164)
FT                   /locus_tag="Lcho_0410"
FT   CDS_pept        complement(448715..449164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0410"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /EC_number="5.3.1.26"
FT                   /note="KEGG: vei:Veis_2042 sugar-phosphate isomerases,
FT                   RpiB/LacA/LacB family; TIGRFAM: sugar-phosphate isomerase,
FT                   RpiB/LacA/LacB family; PFAM: Ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32685"
FT                   /db_xref="GOA:B1XX39"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX39"
FT                   /protein_id="ACB32685.1"
FT                   /translation="MKIAIGCDEAACQMKDAIKAELAAQGHEVQDYGTHDNAPVLYPDI
FT                   GVALAEGVARGEAQRGLLFCGTGIGMAISANKVPGIRAAQAHDTYSAERASKSNDAQII
FT                   TIGARVVGIELAKAIVQAFIGSSFEPRSQSKLDALAAHEQRLRQP"
FT   gene            449455..451221
FT                   /locus_tag="Lcho_0411"
FT   CDS_pept        449455..451221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0411"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="KEGG: pol:Bpro_1459 dihydroxyacetone kinase, subunit
FT                   L; TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM: Dak
FT                   kinase; Dak phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32686"
FT                   /db_xref="GOA:B1XX40"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX40"
FT                   /protein_id="ACB32686.1"
FT                   /translation="MAMNRVINNPDLVVEDMLTGWLAAHAATVCATAENPRVVKRVQSP
FT                   EAGKVGVVTGGGSGHEPAFLGYVGDGMVDAVAIGEIFSSPTAKSFLDAMRAADGGAGVA
FT                   CLYGNYAGDNMNVKMAIQMAEREGIVVRTVVANDDVPSAPKGDEAKRRGVAGEIVMWKV
FT                   GAAKAAMGGSLDEVIAAAQKAIDHTRSIGIGLSACVIPAVGHANFTIEHGTMEVGIGHH
FT                   GEPGIDVRATASAAEMAEMMLNVVLPDLPFGAGDRVAVLVSGLGATPLMEQYILYGEIR
FT                   KRLAAQGITVAFNQVGNLFTSLEMMGVTLTLMKLDDELEACLAHPCSCVGLTVAGDASQ
FT                   ASAGRAYSGSATAKSTGPVAARAAAVARTAVGPALALNGAGGLVRDLIDTIVANRQYLS
FT                   DIDGLIGDGDHGINMAKGFTGCGTRLDALGDAAQSLPAALEQLSKALMDDIGGSMGPLY
FT                   GNFFLGFVNTLEPHAMLDAALFGDALAAAVANVQAMGNAQVGDKTLIDTLIPALAAFKA
FT                   AQAGGADFSAALSAMSAAAEAGKDSTKALQARIGRSARLGPRSIGVLDAGATSCCLILQ
FT                   TLARSLQQRLAA"
FT   gene            451356..454517
FT                   /locus_tag="Lcho_0412"
FT   CDS_pept        451356..454517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0412"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transaldolase; transketolase; PFAM:
FT                   Transaldolase; Transketolase domain protein; Transketolase
FT                   central region; KEGG: azo:azo2836 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32687"
FT                   /db_xref="GOA:B1XX41"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX41"
FT                   /protein_id="ACB32687.1"
FT                   /translation="MTAPTRTTLANALRVLAMDAVQQANSGHPGMPMGMADIAESLWRH
FT                   TVRHNPANPKWPNRDRFVLSNGHGSMLLYGLLHLTGYDLPIEQIKRFRQLHSQTPGHPE
FT                   LGYTPGVETTTGPLGQGIANAVGMALAEQLLAAEFNRDGLPVVDHHTYVFLGDGCLMEG
FT                   VSHEACSLAGTWGLGKLVAFWDDNGISIDGHVEGWFTDDTPGRFEAYGWQVIRAVDGHD
FT                   PAALDAAIAAARAESAKPTLICCRTVIGKGSPNKAGTHDSHGAPLGAAEIAASRAALGW
FT                   TRAPFEIPADVGAAWDAREAGALAEAAWNELFVAYERAHPALAAEFRRRMAGELPAGFA
FT                   DLADAALAQVVDKGETLASRKASQNAIAALVPALPEMVGGSADLAGSNLTLWPQAIPVA
FT                   AAEQAGAGPSQAGLQPPRGADAVARGRGSYIHYGVREFGMAAVMNGLTLHGGLRTFGGT
FT                   FLMFSEYARNALRMAALMKLNPIYVFTHDSIGLGEDGPTHQPVEQTATLRLIPNMDVWR
FT                   PADAVETQVAWTAAIESRDHPTSLILSRQNLPHNLRSAEQIAAIRRGGYVVSEASGGAA
FT                   RAVVIATGSELGLAIAAQKQLAAQGVPVRVVSMPSTHVFDRQDAAWRDSVLPAGLPRVA
FT                   VEAGVTDGWRKYVGLDGAVVGIDRFGESAPAGELFALFGITADAVVAATLGVLGVSARA
FT                   GSRVAPVAAHGQQIWLDKLSRSLVASGELQRWVDEHAVAGVTSNPAIFAQALAGDAAYA
FT                   PALAELRGVEPDLERRFERLAIPDVQAACDVLRPLYERSRGEAGYVSFEVSPSLSRDGA
FT                   GTLAAARRLWAQIARPNAMIKIPATPECLEAISAALADGININVTLMFSRRHAEQVFAA
FT                   QAEGLRRRHAAGLAVDRVRSVASVFVSRVDAKVDPLLEASADAGAKALLGEVAIASARC
FT                   AYARWLDRFGGSAFAGLRAAGAQPPLCLWASTGNKNPAYRDVRYVEALIGPQTVNTVPD
FT                   ATLAAFADHGETARTLDTDLAGASLIVERAAALGIDLDAIGETLQAEGLLQFEQAFERL
FT                   LQSVA"
FT   gene            454793..455476
FT                   /locus_tag="Lcho_0413"
FT   CDS_pept        454793..455476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0413"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pol:Bpro_4502
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32688"
FT                   /db_xref="GOA:B1XX42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX42"
FT                   /protein_id="ACB32688.1"
FT                   /translation="MNEPVHSARVRPARNGPKAKAPTRTNDPERTMAGILEVATQEFAE
FT                   KGLAGARIDEIAAATQTSKRMIYYYFGSKEGLYIAVLEEAYRRVRSIEAEQQLEGLPPE
FT                   QALRRLVAFTFDHHHNNPAYIRLVASENMNRAQFMAQSRIIQGLNVPAIEAIRRLYERG
FT                   VASGEFRPGLDVVDIHASISALTFFNVSNRHTFGLIFKHDLGAPETLALRRANIVEMIV
FT                   RYVRA"
FT   gene            455656..456216
FT                   /locus_tag="Lcho_0414"
FT   CDS_pept        455656..456216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0414"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: aav:Aave_0752 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32689"
FT                   /db_xref="GOA:B1XX43"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX43"
FT                   /protein_id="ACB32689.1"
FT                   /translation="MNRVIDVYCRVLEWALVVMLALMVVLVFGNVVMRYAFNSGITVSE
FT                   ELARWLFVWMTFLGAIVALKEHGHLGTDMLTSHLSLAGKKVCALISQVLMLYVTWLLFS
FT                   GSWAQAVINREVEAPVTGLSVAIFYGAGIVFAVSSAVLLLMQLWRTLSGQATEAELSMS
FT                   QESEDLAQVQALHLDQSQTFKKR"
FT   gene            456233..457513
FT                   /locus_tag="Lcho_0415"
FT   CDS_pept        456233..457513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0415"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: pol:Bpro_4500 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32690"
FT                   /db_xref="GOA:B1XX44"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX44"
FT                   /protein_id="ACB32690.1"
FT                   /translation="MTVFIFLGSLLAAMAIGLPIAYSLLLSGVALMWHLDLFDAQILAQ
FT                   NVINGADSFPLLAVPFFMLAGEIMNVGGLSRRIVNLALTLVGHKRGGLGFVAIVAACLL
FT                   AALSGSAVADTAALAALLLPMMVRAGHDKARAGGLIASAGIIAPIIPPSIGFVIFGVAA
FT                   NVSISKLFLAGIVPGLLMGLSIAVTWYFVSKKENITPPPKASWAERIVALRQATWALVL
FT                   PVIVIVGLKFGVFTPTEAAVVAAVYALFVSTVIYGELKLHQLHEVFVSAAKTTAVIMFL
FT                   VAAAMVSAWLITVADIPSKMITLLEPFMDNQTLLLLAIMFLVIAVGTAMDMTPTILIMT
FT                   PVLMPVIKAAGIDPVYFGVLFIMNNAIGLITPPVGTVLNVVAGVGKMKMDEVTKGVMPF
FT                   MLAQFFVMFMLVFFPSIVTVPAKWLAN"
FT   sig_peptide     456233..456298
FT                   /locus_tag="Lcho_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.434 at
FT                   residue 22"
FT   gene            457631..458626
FT                   /locus_tag="Lcho_0416"
FT   CDS_pept        457631..458626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0416"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: pol:Bpro_4499 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32691"
FT                   /db_xref="GOA:B1XX45"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX45"
FT                   /protein_id="ACB32691.1"
FT                   /translation="MKRLFIKTVLATVALAACGFAAAQERTFKFALQNPKGHPLEVGAS
FT                   KFAELVAAKSGGKFKVNVFAGGTLGGDAANVSALQGGTIEFVMLNSGILASQVKDFEVF
FT                   DFPFLFANAKEADAIVDGPFGQKLHAKLADKGIIGLAYTELGFRNITNSKKPINTVEDL
FT                   AGLKLRVIPNAINVDWVKAVGANPTPLAFPEVYAALEQKAIDGQENPLSVILANKFFEV
FT                   QKNLAVTNHQYNPQSIIFSKKVWDSLTPADQKVLQDAAKEASAFQRKVNRDKSADDLAE
FT                   LKKAGMTVTEFSAAEQAKLRDKFKPVIDKHGAAISATVAEVQAELAKIRK"
FT   sig_peptide     457631..457702
FT                   /locus_tag="Lcho_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            458696..459145
FT                   /locus_tag="Lcho_0417"
FT   CDS_pept        458696..459145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0417"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: pna:Pnap_3996 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32692"
FT                   /db_xref="GOA:B1XX46"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XX46"
FT                   /protein_id="ACB32692.1"
FT                   /translation="MNILVLNGINLNMFGKRDPKQYGTITLAQIDEQLDALGAELGATV
FT                   QHFQSNHEGEMAERIHQAHVDNVDAVLINAGAWTHYSYGIRDALAILKCPIVEVHMSNI
FT                   HAREPFRHHSVIAEIARGQIAGFGVDSYLMGLRAAVNLVNAAKAG"
FT   gene            459189..461096
FT                   /locus_tag="Lcho_0418"
FT   CDS_pept        459189..461096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0418"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; Xylose isomerase domain protein TIM
FT                   barrel; KEGG: pna:Pnap_1560 4-hydroxyphenylpyruvate
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32693"
FT                   /db_xref="GOA:B1XX47"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX47"
FT                   /protein_id="ACB32693.1"
FT                   /translation="MRRSIATVSLSGMLKEKLQAAAAAHFDGVEIFENDLLQFSGTPRD
FT                   VRRICEDLGLAIDMFQPFRDFDAPTPAQLARSLERAERKFDVMAELGTPLILVCSNVQP
FT                   DAIGDVDQLAEQFHQLAERAAKRGMRIAYEALAWGSQVKLFSQAWAVVERVNHPNLGLA
FT                   LDSFHTLSLRDDPAPIAKLPGDKIFYMQLADAPWLAWGPSDVLTYSRHYRCFPGQGELD
FT                   VTGFVRAALDAGYTGPISLEIFNDEFRSAPARANAVDAMRSLLWLEEQVRHTPPAPQAR
FT                   PVTVPLFDPPPAPVLTGWSFIEFAVDPATATRLAGQLTSLGFARIGRHRSKDVDLYGQG
FT                   DVRIVLNLEQDSFARSHFDVHGTSVCALALATVDAQAALVRAEALACPRVTGRIGSDEL
FT                   SIPAVRSPDGSLLYFCDAKQGGHSFEADFIIDAEALRNTPAGVGARVDHLTQALPGGQV
FT                   EPWVLFYRAVLGLAPQRNTVLHDPYGIMRSREIESADGAVRCSLMVSERDNTAVSRSVS
FT                   RFGGAGVQQIAIGVGDAIATVTALRQRGAPLLPVPHNYYDDLAAKYELDPAFLAALRAA
FT                   GVMYERDAKGEFLHAYTAPFEDRFEFEFVERRGAYDLYGSTNAPVRLAALAEWRASHGR
FT                   "
FT   gene            461152..461988
FT                   /locus_tag="Lcho_0419"
FT   CDS_pept        461152..461988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0419"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: pna:Pnap_1561
FT                   shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32694"
FT                   /db_xref="GOA:B1XX48"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX48"
FT                   /protein_id="ACB32694.1"
FT                   /translation="MNIRGTTGLIAHIGYPTHAFKAPMIYNPYFEQAGIDAVVMPMGCK
FT                   PEDYPAFLRLVFRLSNIRGALITMPHKVTTVGLLDEVSPTAQIAGACNAVRLGPDGQLQ
FT                   GDMFDGEGFVRGLQRKGLDLHGKRVLVVGAGGVGSAIAASLAAAGIGAIGLFDARAESA
FT                   EALGQRLSQHYKTLDVRTGSNDPAGYDVVVNATPMGMNDGDELPMDVSRIAPGSFVGEV
FT                   VMKTEMTAFLRAAQARGCAVQIGSDMLFEQIPAYLEYFGLPTTTPEVLRSVARLSY"
FT   gene            complement(462037..462513)
FT                   /locus_tag="Lcho_0420"
FT   CDS_pept        complement(462037..462513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0420"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pna:Pnap_1409 putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32695"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX49"
FT                   /protein_id="ACB32695.1"
FT                   /translation="MIFPFQLSDEPIMTSVADILKSKPQAVVHTTTPSTTVFDAVKLMA
FT                   EKGIGALLVTEGEQLVGIVTERDYARKVALMSRSSRETPVRDIMTADVMFVRPDQTSSE
FT                   CMALMTENRLRHLPVMADGKLLGLISIGDLVKDIISEQRFIIEQLEHYITGERA"
FT   gene            complement(462586..463482)
FT                   /locus_tag="Lcho_0421"
FT   CDS_pept        complement(462586..463482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0421"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: mpt:Mpe_A0588
FT                   putative pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32696"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX50"
FT                   /protein_id="ACB32696.1"
FT                   /translation="MPLERLHPHTKDIGGGFVVRRALPAAQRQAVGPFLFLDHFGPLHV
FT                   GPDDNHDVRPHPHIGLATVTYLFEGVLQHRDSLGVSQRIEPGAINWMTAGRGIVHSERR
FT                   PDDLRGRGYTQHGLQLWVALPEADEETEPQFEHTPAARIPSLERCDARVRVLVGSAHGL
FT                   SSPVSTRSPTLFLDHALDARAECALPAPTAGIERALYGVDAPFELVMGDGTVESFEPHT
FT                   LVVLPDDRVATLRAGAEAARVALVGGAPLGHRHMAWNFVSTRRERIAAAAEAWEHDALG
FT                   QVPGETERIPLPPNLRR"
FT   gene            complement(463507..464283)
FT                   /locus_tag="Lcho_0422"
FT   CDS_pept        complement(463507..464283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0422"
FT                   /product="Adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   mpt:Mpe_A3574 5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32697"
FT                   /db_xref="GOA:B1XX51"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX51"
FT                   /protein_id="ACB32697.1"
FT                   /translation="MRPTAIVSAMAQEMAALLALCEDTRLQRVAGRDFHCATLHGQPVV
FT                   LVLCGIGKVAAATTAVLLAERFGARRLIFTGVAGGLGAQVRVGDVVLAETLLQHDMDAS
FT                   PLFPRYEVPLTGRSHFDTDAALNTPLADAVQAVLARPDHHGPDAQALGVTAPVLHRGLV
FT                   ISGDLFVATAAQSLALQGALPEALAVEMEGAALAQVCHDLGLPCAVLRTISDRADDSAH
FT                   VDFLRFIDVVAAQASAAIIGQWLADESRSRQPSPVA"
FT   gene            complement(464287..465024)
FT                   /locus_tag="Lcho_0423"
FT   CDS_pept        complement(464287..465024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0423"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3573 putative proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32698"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX52"
FT                   /protein_id="ACB32698.1"
FT                   /translation="MAEYFRKTDRGRREVRERSINLPRAARNLLLILDSSKSLDSWIGM
FT                   INGASLTDGEILIEAGLIELQPGPGLPSRPAAFEPTEPAGLDAWPPVTRPAPLGAAKPF
FT                   GLSAAAKAPLPTTFDEPVSPDRHRQVPLPIAHATDSSFLETTAGTLPSRLPEDISTFIP
FT                   LDAGGLPEGSTGLGYTELYDSLNALLRETLGLFRGYRYTLRIERAQNIAELEAVAREFI
FT                   TEVKQVRGESMARMVQRALGLGG"
FT   gene            complement(465061..466746)
FT                   /locus_tag="Lcho_0424"
FT   CDS_pept        complement(465061..466746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0424"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpt:Mpe_A3572 putative long-chain-fatty-acid--CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32699"
FT                   /db_xref="GOA:B1XX53"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX53"
FT                   /protein_id="ACB32699.1"
FT                   /translation="MNKIWLKHYPAGVPAEVNVAQYGSLVALIDESFSRNADRPAYRYL
FT                   DRDFSYRQVDELSRAFAVWLQAQGLQPGDRVALMMPNVPQYPVAVAGVLRAGGVVVNVN
FT                   PLYTPRELEHQLKDCGARILVILENFAHTLQQVRKAVPVKHVVLASMGELMGFPKGLIV
FT                   DFVVRKVKKLVPAFELPGAVRFKDTLAEGRGKTPKPVSTGPDDVAVLQYTGGTTGVSKG
FT                   AVLLHRNLVANLLQSEAWYQPALHKVPAGEQIVQVCALPLYHIFAFNVNMMLGLRVGAC
FT                   NILIPNPRDLPAVFKALAGRRFHTFPAVNTLFHAMANHPDFGSVDWSHLKISAGGGMAV
FT                   QQATAKLWLEKTGCPICEGYGLSETSPVVAANPTDTTAYSGTIGLPIPNTDVRLLDDNG
FT                   AEVGPGLAGEIAVKGPQVMAGYWQRPDETAKVMTADGWFRTGDIGMVDERGYFRIVDRK
FT                   KDMILVSGFNVYPNEIEDVLTQMPGVLECAAVGVADARTGEAVKVVIVRKDPSLTEADV
FT                   RAYCEQNLTGYKRPRLIEFRPDLPKTPVGKVLRRELRDKPAVAP"
FT   gene            complement(466921..468345)
FT                   /locus_tag="Lcho_0425"
FT   CDS_pept        complement(466921..468345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0425"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   pol:Bpro_4544 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32700"
FT                   /db_xref="GOA:B1XX54"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX54"
FT                   /protein_id="ACB32700.1"
FT                   /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSIRGNLFGMIGMAIAV
FT                   LTTAALIVKLAAGNASGMVWVLIGLLAGAAYGAWRAKTVEMTKMPELVAFFHSMIGLAA
FT                   VFIAIAAVAEPSAFGITVKGEPIPAGNRLELFLGAAIGAITFSGSVIAFGKLSGTYKFR
FT                   LFQGKPVQFGGQHMLNLVLGLITIGLGLVFTFTESWPAFFAMLALAFVMGVLIIIPIGG
FT                   ADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFFNV
FT                   ILGGFGGDTATAAAGAQEQRPVKSGSADDAAFVLGNAETVVIVPGYGLAVARAQHAVKE
FT                   LAEKLTHKGITVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINGEFGQADVAII
FT                   LGANDVVNPAALTKGTPIYGMPILEAYKAKTIIVNKRSMAAGYAGLDNELFYMDKTMMV
FT                   FGDAKKVVEDMVKAIE"
FT   gene            complement(468346..468666)
FT                   /locus_tag="Lcho_0426"
FT   CDS_pept        complement(468346..468666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0426"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: mpt:Mpe_A3570 NAD(P) transhydrogenase, subunit
FT                   alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32701"
FT                   /db_xref="GOA:B1XX55"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX55"
FT                   /protein_id="ACB32701.1"
FT                   /translation="MDIVSPTIINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTETTLGKTMGVLAVALAAVNVFGGFLVTRRMLEMFKKKDRPAKAVEG
FT                   KH"
FT   gene            complement(468669..469811)
FT                   /locus_tag="Lcho_0427"
FT   CDS_pept        complement(468669..469811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0427"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: pna:Pnap_3800 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32702"
FT                   /db_xref="GOA:B1XX56"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX56"
FT                   /protein_id="ACB32702.1"
FT                   /translation="MLVGVPLELAAGETRVAVTPETAKKLKAQGHTVRIQSGAGVAASA
FT                   PDEAYVAVGAEITDAAGVLACDLVLKVRAPSESELAGYRAGTTLVGMLDPFDKPGLQRL
FT                   AAAGLTSFALEAAPRTTRAQSMDVLSSQANIAGYKAVMMAADKYQRFFPMLMTAAGTVK
FT                   AARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQIESLGGKFIDVPYETDEERE
FT                   AAVGVGGYAKPMPPSWMARQKIEVAKRVAMADIVISTALIPGRAAPTLITEDMVKAMKP
FT                   GSVIVDIAAGKGPNLAGEIGGGNCPLTVAGQTVKVHGVTIVGETNLPALVAADASALYA
FT                   RNVLDFLKLILTKEGTLAVPMDDDIVAACLMTQNGELKRT"
FT   gene            469926..470426
FT                   /locus_tag="Lcho_0428"
FT   CDS_pept        469926..470426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0428"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mpt:Mpe_A3567
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32703"
FT                   /db_xref="GOA:B1XX57"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX57"
FT                   /protein_id="ACB32703.1"
FT                   /translation="MAEHRWKPNVTVAAVVEADGRFLLVEEETVEGLRLNNPAGHMDCG
FT                   ESPLEAVVRETLEETARHFRPRHFLGVYLSRFQRPATDEDVTYLRLAYAGSVGEPVPGR
FT                   ALDSGIVRTVWMDLDELRASRARHRSALVLRCIEDHLAGRHHPLDVVTADATLHAPEIK
FT                   RAF"
FT   gene            complement(470410..471552)
FT                   /locus_tag="Lcho_0429"
FT   CDS_pept        complement(470410..471552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0429"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   reu:Reut_B4386 lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32704"
FT                   /db_xref="GOA:B1XX58"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX58"
FT                   /protein_id="ACB32704.1"
FT                   /translation="MMWTHSDDSRTSDPDAPVVIRFPALGDAVLLTPLLAALARRYGRP
FT                   VHLLTSGAWTPIVLGHDPAVGEIRSVSSRRAPYWLTPSQWTAVRWLRAHRGPIYLCERD
FT                   EHAARLLARAGLPAGRIVRAWDHHPAQPIHWADWWLQVARLDAPDCPGPHDDRPDIAPL
FT                   PRLHAPAEWTVQTREWLAQRGLAGRALVLIQPGNKKTHKRGRIATAAHDKHWPSGHWAE
FT                   VIRGVLAGLPGAAVLVCGSPREAGLVQEIVDATGAGADQVLNIAREAPLPRLVGLAALA
FT                   HSMISVDTGPAHVAGAMDCPLVVLYGRFGWLRWVPRTAGASVVPLGPREPDERARLLDL
FT                   TPAAVLAAWHTLRPRATAAPVRSGHPLPQAADAAALRTPA"
FT   gene            471680..471919
FT                   /locus_tag="Lcho_0430"
FT   CDS_pept        471680..471919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0430"
FT                   /product="zinc finger CDGSH-type domain protein"
FT                   /note="SMART: zinc finger CDGSH-type domain protein; KEGG:
FT                   mag:amb4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32705"
FT                   /db_xref="GOA:B1XX59"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX59"
FT                   /protein_id="ACB32705.1"
FT                   /translation="MSQPHIAQKAPFPVAVEAGKSYWWCACGQSRNQPFCDGSHKGSAF
FT                   SPMEYKAAEAGTVYFCGCKHSAKAPLCDGTHKSL"
FT   gene            471958..473100
FT                   /locus_tag="Lcho_0431"
FT   CDS_pept        471958..473100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0431"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: aav:Aave_4724 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32706"
FT                   /db_xref="GOA:B1XX60"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XX60"
FT                   /protein_id="ACB32706.1"
FT                   /translation="MNTQLPPKQRIVVGLSGGVDSAVSAWLLKQQGHEVVAIFMKNWED
FT                   DDDSEFCSSRQDFLDAASVADVLGIEIEHVNFAAEYKDRVFAEFLREYSAGRTPNPDVL
FT                   CNAEIKFKAFLDHAMRLGADRIATGHYARVRHNPATGLHELLKGLDPLKDQSYFLHRLN
FT                   QAQLASTLFPVGELPKTEVRRIALEIGLPNAKKKDSTGICFIGERPFREFLNRYLSHEP
FT                   GPIKDDRGRRIGEHVGLSFYTLGQRKGIGIGGLKEKGAPRGGGEHEPWFVARKDLASNT
FT                   LYAVQGHDHPWLQSQRLSADDASWIGTVPQPGQGGLAAKTRYRQADSACAVDALDAAAR
FT                   TLSMSFPAPQWAVTPGQSVVLYEGEVCLGGAVIAAADQRA"
FT   gene            complement(473111..474415)
FT                   /locus_tag="Lcho_0432"
FT   CDS_pept        complement(473111..474415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0432"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: pna:Pnap_1118 fumarylacetoacetase; TIGRFAM:
FT                   fumarylacetoacetase; PFAM: fumarylacetoacetate (FAA)
FT                   hydrolase; Domain of unknown function DUF1969"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32707"
FT                   /db_xref="GOA:B1XX61"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX61"
FT                   /protein_id="ACB32707.1"
FT                   /translation="MSALYGVDETHDPALRSWVESANDPACEFPIQNLPFGRFREAADL
FT                   DWRIGVAIGDQVLELRRIGLINHAEMNRLMRLKPETRLELRRALSAGLRAGSGQQARWR
FT                   DALLPMARVQLGLPCQIGDYTDFYVGIHHATTVGKLFRPDQPLLPNYKWVPIGYHGRAS
FT                   TIGVSGQDFVRPMGQVMAAGAEAPQLMPSQRLDFELELGIFIGRPNAQGQAIPIEQAEE
FT                   HVFGLALFNDWSARDLQAWEYQPLGPFLSKNFASTVSPWMVTMEALAPFRRAFERPAGD
FT                   PPPLPYLDSAAQRAQGAIDVDLEVRLQTAAMRAAGQPAVCISRSNYADAAYWTVAQLVS
FT                   HHSVNGCSLSNGDLLGTGTLSGPRPDQAGSLLELSAGGRTPITLPNGEQRRFLEDGDSV
FT                   ELHGRCERAGYRAIGFGACRATVLPAASTVANETD"
FT   gene            complement(474412..474951)
FT                   /locus_tag="Lcho_0433"
FT   CDS_pept        complement(474412..474951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0433"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pna:Pnap_1119
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32708"
FT                   /db_xref="GOA:B1XX62"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX62"
FT                   /protein_id="ACB32708.1"
FT                   /translation="MKIDRIHHVAYRCRDAKETVLWYQKMLKMDFVLAIAEDLVPSTKE
FT                   PDPYMHIFLDAGGGNVLAFFELPTQPPMGRDPNTPAWVQHIAFRVADRATLLEFKAHLE
FT                   ANGVEVLGVTDHGAFHSIYFFDPNGHRVELACPDPDETAMIARLDAVKWDMLEDWSKTK
FT                   RAPRHADFLHAREFKS"
FT   gene            complement(474963..476039)
FT                   /locus_tag="Lcho_0434"
FT   CDS_pept        complement(474963..476039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0434"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: pna:Pnap_1120 4-hydroxyphenylpyruvate
FT                   dioxygenase; TIGRFAM: 4-hydroxyphenylpyruvate dioxygenase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32709"
FT                   /db_xref="GOA:B1XX63"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX63"
FT                   /protein_id="ACB32709.1"
FT                   /translation="MADLFENPMGLMGFEFVEFASPTPDVLEPLFEQLGFTLVARHRSK
FT                   DVLLYRQGDINFIVNRDPKSPAAYFAAEHGPCACGMAFRVRDSHHAYQRALELGAQPIE
FT                   MPTGPMELRLPAIKGIGGAPLYLIDRFKDGESVYDIDFAFIEGVDRHPVGHGLKLIDHL
FT                   THNVYRGRMAFWGAFYEKLFNFKEIRYFDIQGEYTGLTSRAMTAPDGKIRIPLNEESSK
FT                   GSGQIEEFLMKFNGEGIQHVALICDDLLATVDRLALAGVPLMTAPSASYYEMLDARLPG
FT                   HGQPVSELQTRGILLDGSTEGGKPRLLLQIFSGTLLGPVFFEFIQRKGDEGFGEGNFKA
FT                   LFESLERDQIRRGVLATE"
FT   gene            complement(476086..476610)
FT                   /locus_tag="Lcho_0435"
FT   CDS_pept        complement(476086..476610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0435"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: rme:Rmet_1059 transferase hexapeptide
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32710"
FT                   /db_xref="GOA:B1XX64"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX64"
FT                   /protein_id="ACB32710.1"
FT                   /translation="MSLYRLSGQAPQVPASAYVAAEATLIGRVVLGEQASVWSGAVLRG
FT                   DNEPIRIGAASNIQEGAVLHADPGFALDIGANVTVGHQAMLHGCTIGEGSLIGIQAVVL
FT                   NGAVIGPHSLVGAGAIVTERKRFPARSLIIGAPAKVMRELTDEEVANLIESAASYARRA
FT                   KLFQHELERIG"
FT   gene            complement(476618..477631)
FT                   /locus_tag="Lcho_0436"
FT   CDS_pept        complement(476618..477631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dac:Daci_3139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32711"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX65"
FT                   /protein_id="ACB32711.1"
FT                   /translation="MNTIPLRRRPLLALPALSAISTLAAALALTVGASVAQAQSTAPLR
FT                   IILPVGPGSGVDVIARSAQLALSKALGGQPVVIENLPGAGGITGTQAIVKAAPDGNTIG
FT                   IVSNNHAVNPSVFKKMPYDGIADLTPISVVGGSHFVLVVNPAKVPAKNAKELQAFLKAK
FT                   PDGYNYGSSGNGTIIHLAGEMFVDAAGVQIRHIPYKGMGPMISDVIGGQVELGVAAVQA
FT                   VQSHLKSGTLRAIGVMGKQRAASLPDLPTIAEQGFPDVDVAGWFAFVAPKGLPPVQVKR
FT                   LHEAVVAAFNDPEVKAAMLKQDNFINPSTPEAALQFFKTEQDRYARLVKKAGITLE"
FT   sig_peptide     complement(477515..477631)
FT                   /locus_tag="Lcho_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 39"
FT   gene            complement(477684..478862)
FT                   /locus_tag="Lcho_0437"
FT   CDS_pept        complement(477684..478862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0437"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pna:Pnap_1122 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32712"
FT                   /db_xref="GOA:B1XX66"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX66"
FT                   /protein_id="ACB32712.1"
FT                   /translation="MNTAPSSPRRLPLEGVRVIEFTHMVMGPTCGMVLADLGAEVIKIE
FT                   PPGGDKTRSLPGLGIGFFRSFNRNKKSVVLDIQTPEGLATAKELIAQSDVMLENFRPGL
FT                   MARLGLDHATLSAQCPRLIYVSHKGFLPGPYEHRTALDEVVQMMGGLSYMTGPEGRPLR
FT                   AGTSVNDIMGGMFGAIGVLAALRERDHPTHGTGRGQEIQSALFENCAFLSAQHVQQFLM
FT                   TGEPAPPMPSRVSAWSVYDVFTLAEGEQLFVAATSDKQFQTLCQVLDRPDLAADPALAS
FT                   NAQRVAVRPELLKRLGETMALQRKAALSARLEAAGLPYAPITRPDELVNDPHLLASGGL
FT                   APMTTDDGDTTQVVLLPLLMDGHRPGVRSALPRVGEHTDEVLARLHASRTAA"
FT   gene            complement(478933..479877)
FT                   /locus_tag="Lcho_0438"
FT   CDS_pept        complement(478933..479877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0438"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   pna:Pnap_1123 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32713"
FT                   /db_xref="GOA:B1XX67"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX67"
FT                   /protein_id="ACB32713.1"
FT                   /translation="MPHPSPRPVVIREVGLRDGLQSIATIVPTEHKRAWLAAAHAAGQR
FT                   EIEVGSFVPARLLPQLADTAELLAYARTLPGLKASVLVPNLKGAERALDGDAHLMILPL
FT                   SASHAHSLANLRKTPDEVVAELGRIRAARDASGRKTLIEGGVGTAFGCTIQGEVPVSEV
FT                   LRLLQALLDAGADRVSLADTVGYADPGAVARLFEQALKIAGERFCCGHFHDTRGLALAN
FT                   VAAALDLGVARFDASLAGIGGCPHAPGASGNATTEDLAFMLEAMGHHTGLDLDALLRLR
FT                   AQVVGWIPGEPTHGALWRAGLPGTFRPARASAR"
FT   gene            480015..480971
FT                   /locus_tag="Lcho_0439"
FT   CDS_pept        480015..480971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0439"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_6279 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32714"
FT                   /db_xref="GOA:B1XX68"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1XX68"
FT                   /protein_id="ACB32714.1"
FT                   /translation="MRDLDLKSLRLLVAVCDCQNIKLAAQQEHIEPSAISKRIAQLEAT
FT                   LGTPLLVRGRRGVLPTPAGLALLEHARTLLDTLERIETDVAAYAGGLRGHVRLVASVSA
FT                   IAESLLDDVALFMRDPDNRGIRIDIEERLSTDVVRLVRDGRASIGVCWDSVDLAGLSHV
FT                   GYRRDQLVLAVHPEHELASRRSLRFEQTLAHEHVGLPPTTAVYSMLHRAAARAGRTLVN
FT                   RVVVSNFDAALRVVRANLGLSVIPMQVSRSWAASGEIVAIPLLDGWAQRRFAVCFRERG
FT                   ALTPAAARLVDFLVGRAEAAEAADGVEPAEPAGGPAA"
FT   gene            481133..481936
FT                   /locus_tag="Lcho_0440"
FT   CDS_pept        481133..481936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0440"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: sme:SMb20586
FT                   putative transcriptional regulator, IclR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32715"
FT                   /db_xref="GOA:B1XXU6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXU6"
FT                   /protein_id="ACB32715.1"
FT                   /translation="MSAPAATLSADDDALLAASPRDFVAALQSGLLVIEAFDQDRPRLS
FT                   ISEVAQRAGLTRAAARRHLLTLTALGYARQDGRLFALTPKVLRFGQSYMHSARLPRLLQ
FT                   PQLTRLALTLQEASSAGVLDHDDVIALAAATAGRVVSATLQPGTRVPAWCTANGRVLLA
FT                   ALPNDALTDFLARQVMLPLTPQTITQPERLRLEIERVRVRGYALVDQELEPGLRTLSVP
FT                   LRNYRGDVLAALNISAHAGRMRSEELLERCLPMLLEVQAHLREHL"
FT   gene            482023..483222
FT                   /locus_tag="Lcho_0441"
FT   CDS_pept        482023..483222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0441"
FT                   /product="4-hydroxybenzoate 3-monooxygenase"
FT                   /EC_number="1.14.13.2"
FT                   /note="KEGG: rpe:RPE_3808 4-hydroxybenzoate
FT                   3-monooxygenase; TIGRFAM: 4-hydroxybenzoate
FT                   3-monooxygenase; PFAM: monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32716"
FT                   /db_xref="GOA:B1XXU7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012733"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXU7"
FT                   /protein_id="ACB32716.1"
FT                   /translation="MSTQRTQVAIIGAGPSGLLLGQLLHKAGIANIVIEQRSGDYVLGR
FT                   IRAGVLEQVCVDLLDEAGVGARMHREGLVHHGIELAFAGQRHRIDLSGPTGGKAVMVYG
FT                   QTEVTRDLMDERTANGAPIVYEAEHVEVHDFDGSNPRVTYLKDGVRHEVLCDFIAGCDG
FT                   FHGVCRASVPAGAIRNFERVYPFGWLGILADVAPAADELIYSNHERGFALCSMRSKTRV
FT                   RHYVQCSLQDKIEDWSDARFWDELKSRLDPEAAATIPTGPSIEKSIAPLRSFVAEPMRF
FT                   GRMFLAGDAAHIVPPTGAKGLNLAAADVRYLSRAFIEFYADKTAAGIDDYSRKALRRIW
FT                   KAERFSWTMTSLLHKFPAGAGDTGDVGFKLQMAELDYLVNSPAAMASLAENYVGLPFEE
FT                   "
FT   gene            483230..484984
FT                   /locus_tag="Lcho_0442"
FT   CDS_pept        483230..484984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0442"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: bpt:Bpet3318 putative sulfate
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32717"
FT                   /db_xref="GOA:B1XXU8"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXU8"
FT                   /protein_id="ACB32717.1"
FT                   /translation="MLLSRWLGDWVDIVTPQTLRADLQAGLLGALLVLPQGIAFATLAG
FT                   LPPQYGLYSAVLPGIVAALAGSSRHVVSGPTNANSLALMAMLAPLAATGSAPYIELALA
FT                   VTVLVGLMQLAVGALRLGLLANFISPAALQGFTSGAALLIAVHALRDGLDAGVPGGQSA
FT                   AATLWQTLQGLPHTNLAALAAATSALLIAVLVRRRWPRSPHMLIGLLLATALGWLLRHE
FT                   TGATLVLTGALPSPLPSWHPPSFDTATLGTLFEKALALSVIALGQSLSIAKVLAARSGQ
FT                   RLDVNREFVGQGLSNLIGGFFSCYLSCGSLNRSLPNLQAGARTPLAAVAAALWLLLLVA
FT                   LLAEPLAQIPRAAIAGLLLLVAASLLDLSAWRYLWRLDRSEFAVAAATLLATLTLRLES
FT                   AILLGTGLSLVIYLYRTSRPAMRLMGFDRWRADRRFVVRADTPEPLPACPQLHLLRMEG
FT                   AIYFGAAAHVADQLHALRAAPDAPRHLLVMAKSMNFIDLAGVEVWETELRERRALGGDL
FT                   YFHRPRPQVLAMWRSSGFLQRLGEDHVYPDKRSALADIYRRLDRNVCAQCQARVFWECR
FT                   DDDPRALI"
FT   gene            485051..485932
FT                   /locus_tag="Lcho_0443"
FT   CDS_pept        485051..485932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32718"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXU9"
FT                   /protein_id="ACB32718.1"
FT                   /translation="MHRTPSFRRVSIGLLLSLIVAGTLLGCGTLDEKQRAWIFQPSKNT
FT                   WRGSAWAAEGMDSVWIDFKSAETGQPVRLHGLWLAQPRADAPVLLYLHGARWNVRSSAT
FT                   RMRRLHSLGFAVLGVDYRGFGESTDTLPSEAMAYEDARAAWDWLAQQHPQRARFVFGHS
FT                   LGAAIAVNLAGQVSDESGVILEGSFPSIADVVAASRWGWLPVSPLITQRFEAGERVAAI
FT                   GSPLLVVHGSADRLIPPELGRALYDKAREPKRFELVEGGSHHNTNAVGLDQYRAAVRAV
FT                   FGLASDERLSLD"
FT   sig_peptide     485051..485131
FT                   /locus_tag="Lcho_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.974 at
FT                   residue 27"
FT   gene            485970..486392
FT                   /locus_tag="Lcho_0444"
FT   CDS_pept        485970..486392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0444"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /EC_number="3.1.2.23"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   azo:azo2495 probable thiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32719"
FT                   /db_xref="GOA:B1XXV0"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV0"
FT                   /protein_id="ACB32719.1"
FT                   /translation="MNTHTYTLRVEFGDCDPAQIVWFPNFFRWVDAASRHFFVQCGLPD
FT                   WKVSERERGIIGTPLADTQAKFVRPASYGDVLQIESGVSEWRRKSFVMKHVIRRADLVL
FT                   VEVTEVRVFARRKGDGGDPHAIEAVAVPEDWRALCE"
FT   gene            complement(486408..487346)
FT                   /locus_tag="Lcho_0445"
FT   CDS_pept        complement(486408..487346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0445"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   pol:Bpro_4514 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32720"
FT                   /db_xref="GOA:B1XXV1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV1"
FT                   /protein_id="ACB32720.1"
FT                   /translation="MTSRTDVLISEVGPRDGLQSVAAVMPTAAKRAWIDALHAAGLREI
FT                   EVGSFVPARLLPQMADVAEVVRHALGLPGWTVMALVPNTRGAEAALAAGVHKLTLPVSA
FT                   SQAHSLANVRKTREQMVDEVRAVVRLRDQSAPGVKVEAAISTAFGCTLQGAVAEDEVIR
FT                   LAEQLTQAGADETGLSDTTGMANPAQVRRLFTRLRAAIGAHAGAAHLHNTRGLGLANCL
FT                   AAYDVGVRTFDASLGGLGGCPYAPGASGNVVTEDLVFMFEAMGVRTGIDLARLMAARDA
FT                   LRAGLPGEAIYGMTPEAGLPKGFVPASALGR"
FT   gene            complement(487366..488733)
FT                   /locus_tag="Lcho_0446"
FT   CDS_pept        complement(487366..488733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0446"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: scl:sce1470 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32721"
FT                   /db_xref="GOA:B1XXV2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV2"
FT                   /protein_id="ACB32721.1"
FT                   /translation="MAKTPRPHITPIAGPILGEFLIGISVAMAGLWMASEISDAAAGAF
FT                   GMANQVMETLFVIFRVLAIGVGVTITQAIGGHQPEAARRTALVGLGASTWAGAAAALWV
FT                   LLGSNWTLDVLNAPDAVMALAEPYLPLLALALLLEAYNLTMASILRAHLRARDALVVMV
FT                   LMHTSHVVLAFPLMLGVGGWDGLGLPGYALALTISRALGVVLHLRLWRINMKLVPHRRD
FT                   WWVCPVRALAPVLRIGIPGASLELGYRIAFMMSLSAAAKLGVAALATQAYTLQTLRYVL
FT                   LISLAIGWACEIMVGHLIGAGEFRTAHQLVRKGLRNGLLASGALALIAAAAAPWLMRGF
FT                   TRDPAIIEMAQTLLWISFALETGRVANLVVLGALRSTGDVIYPVAASITSLILVLGVGS
FT                   VLLGREFGLVGIWIAYAADEWIRSALMYWRWETHGWVAHARAIHQRIRSPGVESRF"
FT   gene            489558..490070
FT                   /locus_tag="Lcho_0447"
FT   CDS_pept        489558..490070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32722"
FT                   /db_xref="InterPro:IPR025444"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV3"
FT                   /protein_id="ACB32722.1"
FT                   /translation="MSEIFRGRYTAQIEGPFVVFIIGMRINRLLAVHKWLPVAQAMGPM
FT                   VKHLMAHKELGLLHAQSYAYWRGAALVQYWRSFEQLERFARDPSLNHLEPWKRFNRAVA
FT                   ADGSVGIWHETYVVQADQYECIYGNMPKMGLALAGTHMAAIGAKETAKRRLGMKGDPAV
FT                   ASYDNPQ"
FT   gene            490114..490344
FT                   /locus_tag="Lcho_0448"
FT   CDS_pept        490114..490344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0448"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   xcv:XCV3888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32723"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV4"
FT                   /protein_id="ACB32723.1"
FT                   /translation="MSNLPDLPEARLGRYRHYKGGEYEVVGVARHSETLEPMVVYRPLY
FT                   NETGLWVRPYEMFFGQIEVDGQPQLRFAPVD"
FT   gene            490407..491237
FT                   /locus_tag="Lcho_0449"
FT   CDS_pept        490407..491237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0449"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: par:Psyc_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32724"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV5"
FT                   /protein_id="ACB32724.1"
FT                   /translation="MATEIPGIEKLRALAHRRVSPRLILPLALLVLAAIGARQFGEISL
FT                   SLGAHQYARFFYLVAAWQGNSAAQNNLGALYLEGKGGFPDPVAAAHWLQKAAEQGQSAA
FT                   AFNLGNLYEEGRGVPRDSRRAAALFEQAAQAGDHDAAFNAGRLYADGRPDLPKDVNAAI
FT                   KWYTKSADAGFASAQYNLGSLYAQGDGVAKDFSMAAQWYQRAVKSGHPKAQLDLGSMYA
FT                   FGIGVDRDLARGLQLLEAAAQTKELAPKAKAHAALACRDRTPLERDLCDRRVRN"
FT   gene            491412..492782
FT                   /locus_tag="Lcho_0450"
FT   CDS_pept        491412..492782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0450"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   pmy:Pmen_2247 chromate transporter, chromate ion
FT                   transporter (CHR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32725"
FT                   /db_xref="GOA:B1XXV6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV6"
FT                   /protein_id="ACB32725.1"
FT                   /translation="MNPPSPSRPDADTAPASVSFAEALRFWLKLGFISFGGPAGQIAIM
FT                   HTELVERRRWISERRFLHALNYCMLLPGPEAQQLATYIGWLMHRTWGGIVAGALFVLPS
FT                   LFILIALSWIYMRFGDLPLVAGIFYGIKPAVTALVLHAAHRIGTRALKNRWMWGIAAAA
FT                   FVAIFAFDTPFPAIVAAAALIGHFGAKHAPTVFALGGGHGAAKQGYGPALIDDHTPTPD
FT                   HARFSRSHLAKVLAVGLGLWALVMTVLVATQGLHGTLATMGWFFTKAALLTFGGAYAVL
FT                   PYVYQGAVETHQWLSGAQMIDGLALGETTPGPLIMVVAFVGFVGGWLTQVFGADALFMG
FT                   AAVAATVVTFFTFLPSFVFILAGGPLVEATHGKLGFTAPLSAITAAVVGVILNLALFFA
FT                   YHVLWPQGFGGRFDAVSAVIAVAAALALFRFKIGVMPLLGGCAAAGLAVTLLAPALR"
FT   gene            complement(492803..493855)
FT                   /locus_tag="Lcho_0451"
FT   CDS_pept        complement(492803..493855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0451"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: azc:AZC_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32726"
FT                   /db_xref="GOA:B1XXV7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV7"
FT                   /protein_id="ACB32726.1"
FT                   /translation="MATPPRGPALRGGVLALLASALFGISTPLVQHFGAGLGAFSTAAL
FT                   LYAGAAVLGAALRQPVEAEARLRRSDARRLLAMAGFGAVIGPVALAWGLQRTSGTSASL
FT                   MLTLEALFTALLAWRLYHETLDRRVRAAMALLLAGGMVLVLDQGRTGGTQLLGLLAVLV
FT                   ATAAWGIDNTLSRALAERDPAQVVMAKAALGATATTLLAIASGEPLPGVVAALALLAVG
FT                   ATGYGLSLRFYLLAQRAFGAARTGSVFAFAPFIGAVLAVVLGDRSASWVMALGSVLMLA
FT                   GVLLHLAESHGHEHPHEALDHEHAHRHDDGHHEHRHDPMPAGEHSHAHHHEPMRHGHPH
FT                   VPDAHHRHRH"
FT   sig_peptide     complement(493781..493855)
FT                   /locus_tag="Lcho_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.372 at
FT                   residue 25"
FT   gene            complement(493864..494382)
FT                   /locus_tag="Lcho_0452"
FT   CDS_pept        complement(493864..494382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0452"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   bmu:Bmul_1674 protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32727"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV8"
FT                   /protein_id="ACB32727.1"
FT                   /translation="MSPLTSDQMKTLQHDLARIADQESRLHLPHFNQAIAWDIGLALKR
FT                   LAEARGHAVTIEIRLAHELVFFHAMPGTTPANADWARRKRNTVELLHRSSYAVGRSLAL
FT                   EGSSLETMMGLPARDYASHGGSFPVRLAGGACVGTVTVSGLPQREDHALVVEVLALQCD
FT                   LEPTAIALD"
FT   gene            complement(494464..495702)
FT                   /locus_tag="Lcho_0453"
FT   CDS_pept        complement(494464..495702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0453"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   bpd:BURPS668_0335 N-acylglucosamine 2-epimerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32728"
FT                   /db_xref="GOA:B1XXV9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXV9"
FT                   /protein_id="ACB32728.1"
FT                   /translation="MTDTSAHPDFRSPDFLLGHIRHTLAFYDARCVDPSGGFFHFYKDD
FT                   GTVYDHRTRHLVSSTRFVFNHAMAWRRFGAAVYPDYQQRVRHGLAFLQQAHAQPQGGYA
FT                   WQIDWDGRRATVQDGTHHCYGLAFVLLAHAHAVMAGVDEARAGLEATFELMEQRFWEPA
FT                   HGLYADEATPQQWQDGQVGPYRGQNANMHGCEAMIAAYDATRDAKYLQRALTLAESITQ
FT                   RQAALADGLVWEHYRADWSVDWDYNRDDKSNIFRPWGYQVGHLTEWAKLLMQLERHLPV
FT                   NHRPAWLLSTAQRFFDTAMRHGWDAQNGGLVYGFAPGGEVCDADKYFWVQAESFGAAAL
FT                   LAVRTGDEAYWDWYDRIWAYSWAHMIDHRHGAWYRIRTPDNRACSDEKSPAGKTDYHTM
FT                   GACYDVLRGLGVP"
FT   gene            complement(495791..496810)
FT                   /locus_tag="Lcho_0454"
FT   CDS_pept        complement(495791..496810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0454"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bxe:Bxe_A4284
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32729"
FT                   /db_xref="GOA:B1XXW0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW0"
FT                   /protein_id="ACB32729.1"
FT                   /translation="MRVTIREVALAAGVSIGTVSRALKNQRGLSDETRRHVRAVARQLG
FT                   YDSDRLRSGKAQRLVFLVHRHHSSFALNPFFSLVMHGVEEACREFGIAPTLLAAGPADP
FT                   VRDLLRLHEPDALLAAGYFEAELLTLLKGLELPMALVDFWMPGCASVNPDNRMGGYLAT
FT                   RHLLDLGRRRIAYLAGSLAHFSSRERELGYRRALFEAGVLADPDLEVIAPPGLDVASGA
FT                   EAAMRVLLRLHPRPDALFAYNDTAALAALEVCQEAGLRVPQDIAIVGFDDIPAAGYAPT
FT                   PLTTLRVDKAALGRTGVELIMRGAEMPQETTLPVTLIVRASSRIDSSSAVEAATAAID"
FT   gene            497131..497292
FT                   /locus_tag="Lcho_0455"
FT   CDS_pept        497131..497292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32730"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW1"
FT                   /protein_id="ACB32730.1"
FT                   /translation="MKYLLRNDHQAPRRPPVPERSTDKGQKHESFDFGRIGFDQRSMAL
FT                   AQRMDRKR"
FT   gene            497640..497879
FT                   /locus_tag="Lcho_0456"
FT   CDS_pept        497640..497879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32731"
FT                   /db_xref="GOA:B1XXW2"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW2"
FT                   /protein_id="ACB32731.1"
FT                   /translation="MSPDLSSSTLSATVAGLTRLLVVLLMAPGVIAAALVAGALALCLM
FT                   PLLLLVAPGRRAGFSIHSLMPMRAQMAARRPAGS"
FT   sig_peptide     497640..497738
FT                   /locus_tag="Lcho_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.855 at
FT                   residue 33"
FT   gene            complement(497929..498498)
FT                   /locus_tag="Lcho_0457"
FT   CDS_pept        complement(497929..498498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0457"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: pna:Pnap_3578 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32732"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW3"
FT                   /protein_id="ACB32732.1"
FT                   /translation="MKKSLLALAAVSAFVTGTAQAATYAIEPTHTFVTFEIGHFGTSTN
FT                   RGRFDKKEGTVQFDRAAKTGKVDITIDVASINTGTGPFNSHIKSAEILDAEKFPTARFV
FT                   GDKFVFTGDKVSEVSGMFTLMGKTLPLTLKATQFNCYDSPMLKREVCGGDFEATLKRSA
FT                   WGVKYGLDWGFQDDIRLVIQTEAVKQ"
FT   sig_peptide     complement(498433..498498)
FT                   /locus_tag="Lcho_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(498553..499125)
FT                   /locus_tag="Lcho_0458"
FT   CDS_pept        complement(498553..499125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0458"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: aav:Aave_3506 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32733"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW4"
FT                   /protein_id="ACB32733.1"
FT                   /translation="MNTSLTFTAAVAAFTFLASGAACAQQKVDAAKSEIGFVSKQMGVP
FT                   VEGKFRKFDAQLAFDPKKPEGGKVSFSIDLGSATLGVPESDAELPKATWFNVPKFPQAT
FT                   FQSSAIKALGGGKYEVAGKLSIKGAVKDVTVPVALAQAGGATTATGSFAIKRLDFKIGD
FT                   GDWADTSMVANDVQVKFKLQISGMAAL"
FT   sig_peptide     complement(499051..499125)
FT                   /locus_tag="Lcho_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(499166..499735)
FT                   /locus_tag="Lcho_0459"
FT   CDS_pept        complement(499166..499735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0459"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: mpt:Mpe_A3506 putative
FT                   cytochrome b-561 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32734"
FT                   /db_xref="GOA:B1XXW5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW5"
FT                   /protein_id="ACB32734.1"
FT                   /translation="MNTTSTPTPARRYGSVAIALHWLLGLAIIGSFAVGVYMTDLPFSP
FT                   QRLKLYNWHKWAGVVILALSALRLLWRLTHRPPALPAEVEAAMPRWQRIAHHGTHHLMY
FT                   LLFFAIPLTGWAYSSAAGFPIVWFGVLPLPDFIGVDKELAELIKPLHKLAAFGLGALVL
FT                   MHIGAALKHQWIDRDRLLGRMGIGPA"
FT   gene            complement(499880..500839)
FT                   /locus_tag="Lcho_0460"
FT   CDS_pept        complement(499880..500839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0460"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: mpt:Mpe_A0238
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32735"
FT                   /db_xref="GOA:B1XXW6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW6"
FT                   /protein_id="ACB32735.1"
FT                   /translation="MSIESPTEAPASPLSLTIAAVERDTRIGKDTLRVWERRYGFPQPS
FT                   RDANGERLYPPDQVERLRHVKRMLDAGHRPGRIVNLSLDELQRLGDGSPVGGSPAARAS
FT                   TDAHDDTEVQRLLRLLRAHDLGALRRALSQALLRVGLERFVIDLAMPLVAEVGQAWARG
FT                   QLEVFEEHLCSETLETVLRTAMSASPEASAASRPRVVLTTFPFEAHGLGLLMADALFLV
FT                   HGCTTMNLGRQTPLHDLMLASQAHATDIVALSFSAASNPNQAADSLAELRSRLPAEVEI
FT                   WAGSPLAALHRRAVDGVLLISSLDAIGPEIERWKAARR"
FT   gene            500997..501572
FT                   /locus_tag="Lcho_0461"
FT   CDS_pept        500997..501572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0461"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: mpt:Mpe_A0237
FT                   putative glutathione peroxidase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32736"
FT                   /db_xref="GOA:B1XXW7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW7"
FT                   /protein_id="ACB32736.1"
FT                   /translation="MDNPFRRRALLGLAAWPLVLASGQASGASTACPALLDRSIPRLQD
FT                   EQAQALCQYSGKVLLIVNTASACGYTSQYEGLQKLHEQYRERGLVVMGFPSNDFAGQES
FT                   GDNRQIAEFCENQFAVRFPMFVKGAVRGPQAQPLYADLKRLSGQAPGWNFHKYLVGRDG
FT                   RSVRSYASAVGPDDRRLRLDIETFLNAR"
FT   sig_peptide     500997..501080
FT                   /locus_tag="Lcho_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 28"
FT   gene            501876..503195
FT                   /locus_tag="Lcho_0462"
FT   CDS_pept        501876..503195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0462"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: mpt:Mpe_A0236 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32737"
FT                   /db_xref="GOA:B1XXW8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW8"
FT                   /protein_id="ACB32737.1"
FT                   /translation="MRRIAVIGSGIAGLSTAWHLSEPGAGCRVTLFEANDYVGGHTHTV
FT                   DVSLPDGHGERVTHGVDTGFLVFNRRTYPELLKLFAALDVEVAASEMSFSVQAESGGLE
FT                   WSGCSLDTVFAQRRNLLRPRFLGMLAEVLRFNRLCTALAEAGDDTALAQGIGDFLDEHR
FT                   FGQAFRRWYFLPMIGCIWSCPTEQMLAFPVATLIRFCHNHGLLQVTDRPQWYTVVGGAR
FT                   NYVQRMLPRIADLRLATPVIGVRRTGLGAGVQVFSATGAEHFDEVVFACHSDQTLRILG
FT                   AEASQAERAVLGAISYQRNRAVLHTDASLLPQRRKAWAAWNYEHAPDVDTESSGVCLHY
FT                   LLNRLQPLPFAQPVVVSLNPVREPRADQVLASFDYAHPVFDLGAIAAQRRVGELQGRQH
FT                   SWFCGAWTGYGFHEDGLKSGLAVVAGLRERWAGSTDRLAA"
FT   gene            503192..504022
FT                   /locus_tag="Lcho_0463"
FT   CDS_pept        503192..504022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0463"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   mpt:Mpe_A0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32738"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXW9"
FT                   /protein_id="ACB32738.1"
FT                   /translation="MSPPGRPQGEYRRAPHEGAPVNAAALIGRGTVRHTRLRPVLHAFA
FT                   YPTWFLMLPMRSLRRQPLAALPRNRAGVVSFHDADHGAGGADALAWFEDLLRQEGVDGV
FT                   DGEVWLQTYPRVLGYAFKPVSFWYGHAADGRLKAVLAEVNNTFGERHCYLLHGEHLAFG
FT                   RELLADKVFHVSPFCAVQGAYRFRFMQVPAQGGQPPRLIARVDHEDADGPLLQTSVSGQ
FT                   LTPLTRAALWRAWAAMPLLTLGVMARIHWQALRLWLKRVPFLHKPTPPSALVSR"
FT   gene            504096..505361
FT                   /locus_tag="Lcho_0464"
FT   CDS_pept        504096..505361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0464"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mpt:Mpe_A0234 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32739"
FT                   /db_xref="GOA:B1XXX0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX0"
FT                   /protein_id="ACB32739.1"
FT                   /translation="MPDTATTHRPLFCPGARVAAPADLQSVLSRAPAAARAVFKLLGRL
FT                   EHGTLELQLPDGSHTRMGSGAAPRAAIRIDDWAVCAATLKSGDIGFAESYIAGHWGTPD
FT                   LAALLRLFIANRERIESVIYGKRWGGLLYRLRHLFNRNSRAGSRRNIHAHYDLGNAFYR
FT                   RWLDETMNYSSAWFDGRLDQPLAQAQRAKVRRAIDEVGVRPGQRVLEIGCGWGAVAESV
FT                   ARERGAHLTGVTLSTEQLDYARQRLADAGLAERADLRLQDYRDIADAPFDAVISIEMFE
FT                   AVGRSYWPSYFETVKRCLKPGGRACIQSITIRDDLFERYVRSTDFIQQYIFPGGLLPSI
FT                   SEFTRAAERAGLVVERQLAFGPDYAETLRRWRAAFLAQEREVIGLGFDTRFMRTWEFYL
FT                   AYCEAAFDTGNTDVVQFTLRRP"
FT   gene            505445..506032
FT                   /locus_tag="Lcho_0465"
FT   CDS_pept        505445..506032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32740"
FT                   /db_xref="GOA:B1XXX1"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX1"
FT                   /protein_id="ACB32740.1"
FT                   /translation="MKPASLARRRCLADLGAACVVLAAAPSLAWAQSVDPATAAPAEVA
FT                   STLTGARLQGQLRFRWFGLHIYDARLWSRERVASDDYAGREFALELQYARSLAGSAIAE
FT                   RSIDEMRKLDAVNEAQATAWLAAMRAAFPDVQAGERITGRHRPGQGASFYFNGRATREI
FT                   ADSEFARLFFGIWLSPRSGSASQRAALLGQPA"
FT   sig_peptide     505445..505540
FT                   /locus_tag="Lcho_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 32"
FT   gene            506029..507315
FT                   /locus_tag="Lcho_0466"
FT   CDS_pept        506029..507315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0466"
FT                   /product="sodium:galactoside symporter family protein"
FT                   /note="KEGG: mpt:Mpe_A0232 sodium:galactoside symporter
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32741"
FT                   /db_xref="GOA:B1XXX2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX2"
FT                   /protein_id="ACB32741.1"
FT                   /translation="MNAAQQAVPWRAGLGYGALGLPLAFVALPLYVLLPLHYADRYGVS
FT                   LAALGLLLLAARAFDAGVDPLLGRWADRLLAAGPRAAWAVIGGAAGVLALGFVALFFPL
FT                   VRGESALLVWCGVGLLVTYLAYSTASIVHQAWGARLGGGDAVQARWVSWREGAALAGVI
FT                   VASVLPSLAGLGWTAATLAVLLLIAWAMLGRVQRVSVPRHETAPTPHAPIWAPWSQPAF
FT                   RRLIGVYLLNGVASAVPATLVLFFVRDRLQAPAWEGAFLAAYFAAGALSLPVWVRVISA
FT                   WGLIRSWAAGMVLAVLTFAGAWSLGAGDVAGFMLVCLASGLALGADLAVPGALLAGVVR
FT                   RSGSGGIAEGAYFGWWNGATKLNLALSAGLVLPALEWAGYRPGSTDGEGLLALSLAYAV
FT                   LPCVLKLLAGLVLWRSAPAISAGSSTKET"
FT   gene            507318..507866
FT                   /locus_tag="Lcho_0467"
FT   CDS_pept        507318..507866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0467"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: mpt:Mpe_A0231 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32742"
FT                   /db_xref="InterPro:IPR024409"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX3"
FT                   /protein_id="ACB32742.1"
FT                   /translation="MNPLRSIRRLGLLFALCTPLWLAGCASPQPQDYADQTPKLDLREY
FT                   FNGDLTAHGLFTDRSGAVKRRFTVKMKGTWQGDQGVLEEDFLYSDGQTERRVWRLTRGA
FT                   DGRYTGQADDVIGTAQGQAAGNALRWQYTLRLKVDDSTYDVKFDDWMFLMDRQVMLNRA
FT                   AMSKFGFHLGDVTLSFHKP"
FT   sig_peptide     507318..507398
FT                   /locus_tag="Lcho_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.635 at
FT                   residue 27"
FT   gene            507876..508649
FT                   /locus_tag="Lcho_0468"
FT   CDS_pept        507876..508649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0468"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pna:Pnap_1455 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32743"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX4"
FT                   /protein_id="ACB32743.1"
FT                   /translation="MSLNPKLTDWHGKVVWLVGASSGIGRSTAERLAERGARVVVSARN
FT                   VQALQQFTDRYPKSLALPVDVTDPGGLAGAADALMARWGRLDLVVYCAGHYRAQRATSF
FT                   DLDEMLRHVQINYVGALHLLDVVLPILLNQRSGHISLISSVAGYRGLPQGLAYGPTKAA
FT                   LHNLAETLYMDLRDRGVAVSVINPGFVETPLTAHNEFRMPALISPLAAADAMLKGWARG
FT                   EFEIHFPKRFTRILKLLGWLPQGLYFAAVRRATGL"
FT   gene            508646..509095
FT                   /locus_tag="Lcho_0469"
FT   CDS_pept        508646..509095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32744"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX5"
FT                   /protein_id="ACB32744.1"
FT                   /translation="MTPPLPRHADVRVDRLVRYFESLAPADLDRLDQIYSADAAFKDPF
FT                   NEVRGIAAIRPIFEHMFRTLRTPRFVVREAIGQGDQCCLTWDFLFVAPGMGEREQCIRG
FT                   ATHVRFDAAGRVCLHRDYWDAAEELYEKLPLLGALMRWLKRRAAT"
FT   gene            complement(509102..510064)
FT                   /locus_tag="Lcho_0470"
FT   CDS_pept        complement(509102..510064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0470"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mpt:Mpe_A0227 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32745"
FT                   /db_xref="GOA:B1XXX6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX6"
FT                   /protein_id="ACB32745.1"
FT                   /translation="MLNVFTLASGRLYQEEIDQPDTMAALSPVWVDLEAPTRQEKDWIQ
FT                   TRFGLHIPDDVVGEDLEESARFYEEDNGELHIRSDFLIDDDVTPRNVRVAFILYNNVLF
FT                   SVHAEDLPVFRLLRLRARRIPALIEDAKDVLLKLYDADAEYSADALEGIYDNLEKVSAR
FT                   VLKQEVDDRAAGEALGAIAHEEDLNGRIRRNVMDTRRAVSFMMRSRMLNAEQFEEARQI
FT                   MRDIDSLDSHTAFLFDKINFLMDATVGFININQNKIIKIFSVASVALLPPTLIASIYGM
FT                   NFAHMPELSQRWGYPFALGLMVASVAAPLIYFRRKGWMR"
FT   gene            510510..510857
FT                   /locus_tag="Lcho_0471"
FT   CDS_pept        510510..510857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0471"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   mpt:Mpe_A0226 putative PTS system, EIIa component"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32746"
FT                   /db_xref="GOA:B1XXX7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX7"
FT                   /protein_id="ACB32746.1"
FT                   /translation="MNLTISGHHLEVTPALREYVLTKLDRVTRHFDQVVDVNVLLTVEK
FT                   LKEKERRQKAEVTLHVKGKDIFVESASEDLYAAIDQLMDKLDRQVVRHKDRLQDHHHES
FT                   HKRTDAAGGVV"
FT   gene            511078..511548
FT                   /locus_tag="Lcho_0472"
FT   CDS_pept        511078..511548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0472"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: mpt:Mpe_A0225
FT                   putative nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32747"
FT                   /db_xref="GOA:B1XXX8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXX8"
FT                   /protein_id="ACB32747.1"
FT                   /translation="MNRLAAILPASNVLVQVDASSKKRAFEQAGLLFENQHAIARATVT
FT                   DNLFARERLGSTGLGHGVAIPHGRIKGLKNPLAAVLRVAQPIAFEAPDDEQVTLLIFLL
FT                   VPEAATQRHLEILSEIAELLSDRELRERLKTEPDPAKVHEMISRWEPLKSVA"
FT   gene            511607..512584
FT                   /locus_tag="Lcho_0473"
FT   CDS_pept        511607..512584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0473"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   mpt:Mpe_A0224 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32748"
FT                   /db_xref="GOA:B1XXX9"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XXX9"
FT                   /protein_id="ACB32748.1"
FT                   /translation="MKPTVISADALFDAHRAALKWEWIAGHAHPERRFDEVAVRDAQSA
FT                   ADLVGYLNYIHPYRVQIVGRREVRYLQPGDASGDNPVELQEKRISRIVTLEPPVLVVAD
FT                   GCTPPDRLVAMCERADIPLFCTEDSAGHVIDVLRGYLSQHFAERTSRHGVFMDILGLGV
FT                   LLTGESGLGKSELGLELISRGHGLVADDVVDLFRVSQAAIEGRCPELLRNLLEVRGIGL
FT                   LDIRAIFGETAVRRKMRLKLIVHLVRKETLDRDFERLPYEPLFEDILGMPVRKVVIAVD
FT                   AGRNLAVLVEAAVRNTVLQLRGIDTYRDFIQRHRDLMDSGDSGL"
FT   gene            complement(512621..513052)
FT                   /locus_tag="Lcho_0474"
FT   CDS_pept        complement(512621..513052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0474"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: mpt:Mpe_A0223
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32749"
FT                   /db_xref="GOA:B1XXY0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY0"
FT                   /protein_id="ACB32749.1"
FT                   /translation="MTNADELKSSGLKATLPRIKILEIFQRAQERHMTAEDVFKLLLAD
FT                   GSDIGLATVYRVLMQFEQAGILSRNHFESGKSIFELNEGQHHDHLVCMDCSRVEEFFDP
FT                   QIELRQREIATERGFRLQEHSLALYAHCTKDACPHRHSK"
FT   gene            513161..513709
FT                   /locus_tag="Lcho_0475"
FT   CDS_pept        513161..513709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0475"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: mpt:Mpe_A0222
FT                   small protein A (tmRNA-binding)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32750"
FT                   /db_xref="GOA:B1XXY1"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY1"
FT                   /protein_id="ACB32750.1"
FT                   /translation="MALVSRLFARSATGALTLLALAGCSTNTDRNLLGVITPYRMEVVQ
FT                   GNVVTQEMAAQLRNGLTREQVRSLLGSPLLMDIFHADRWDYVFTIRRQGTAPQQRRVTI
FT                   LFDKDRVASFEAAQLPSEREFVDSIDASKVERRAQPLALSDDQLRALPLPQPSKAAAPS
FT                   VGASGPLRNYPPLEPILAR"
FT   sig_peptide     513161..513229
FT                   /locus_tag="Lcho_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.259 at
FT                   residue 23"
FT   gene            513721..514530
FT                   /locus_tag="Lcho_0476"
FT   CDS_pept        513721..514530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0476"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   pna:Pnap_3789 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32751"
FT                   /db_xref="GOA:B1XXY2"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY2"
FT                   /protein_id="ACB32751.1"
FT                   /translation="MTATLPIAVAGCTGRMGHMLIEAVLAADDCRLAGALDRPGSPAVG
FT                   HDATAFLGQASGVLVASDLHAGLKDARFLIDFTRPEGTMAHLAVCRELGVKMIIGTTGF
FT                   TDEQKAQIEAASNDIAIMMAPNMSVGVNVVLRLLDMAARALDQGYDIEIVEAHHRHKVD
FT                   APSGTALKMGEVVAAALGRDLKDCAVYGREGVTGERDPSTIGFATVRGGDVVGDHTVMF
FT                   MGTGERIEITHKSSSRSTYAQGSLRAARFLAGRSHGLFGMDDVLGLA"
FT   gene            514543..515244
FT                   /locus_tag="Lcho_0477"
FT   CDS_pept        514543..515244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0477"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mpt:Mpe_A0220 putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32752"
FT                   /db_xref="GOA:B1XXY3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY3"
FT                   /protein_id="ACB32752.1"
FT                   /translation="MNGLQQIWSEGDAVSRGVALLLLAMSVSAWVLIFWKSWVLGRARR
FT                   DLAVVVPAFWRAPDLDAGQRLLASRDREQLLLPLLDAALRPVSADTLEAGTHTQAQLTR
FT                   RLRDALHGVLAQLQQGQVLLASVGATAPFIGLFGTVWGIYHALLGISAAGSVSIDKVAG
FT                   PVGEALIMTAAGLAVAIPAVLAYNLFGKWVGACEADLEGYAHDLREMLVEQAGLTPRHP
FT                   PAGEESWPSAG"
FT   gene            515226..515666
FT                   /locus_tag="Lcho_0478"
FT   CDS_pept        515226..515666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0478"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mpt:Mpe_A0219 putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32753"
FT                   /db_xref="GOA:B1XXY4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY4"
FT                   /protein_id="ACB32753.1"
FT                   /translation="MAFGRLERRSLPQPMSDINMTPLIDVMLVLLVIFMITAPLMSASL
FT                   KLDLPRADGAGPVNETPQSVSIALQANGALYIGDERLEPAAFAQRLTEIGQRGGTPPEV
FT                   QLRADQAAPYGLVARLIGQLQTAGLNRIAFVTEPGAAASGPR"
FT   gene            515745..518408
FT                   /locus_tag="Lcho_0479"
FT   CDS_pept        515745..518408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0479"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: pol:Bpro_4605
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32754"
FT                   /db_xref="GOA:B1XXY5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XXY5"
FT                   /protein_id="ACB32754.1"
FT                   /translation="MNEKYDPAAIESAAHAQWVAADAYRVDENARDSQGQLKPKFYACS
FT                   MLPYPSGKLHMGHVRNYTINDMLTRQLRMKGMNVLMPMGWDAFGLPAENAALKNSVPPE
FT                   KWTRENIATMKGQMLAMGLAIDWSREVATCDPTYYKWNQWLFLKMLEAGIAERRTQVVN
FT                   WDPVDQTVLANEQVIDGRGWRSGALVEKREIPGYYLNIVKYADELLGAVANPEDPNYLS
FT                   GWPERVRLMQENWIGKSEGVRFAFPHQIAGADGELIQGGKLYVFTTRADTIMGVTFCAV
FT                   APEHPLAAHAAATNPALAAFIAECAHGGTTEAELATQEKKGLPTGLFVTHPLTGAQVEV
FT                   WVGNYVLMSYGDGAVMGVPAHDERDFAFAKKYGISIRQVVQAEGQTFSLDGWADWYGDK
FT                   QRAVCVNSGLLDGLPYKEAVSKVAELVGAQGLGEKKTTWRLRDWGISRQRYWGTPIPII
FT                   HCDDCGSVPVPEKDLPVVLPIDCVPDGSGNPLKKRTDFLNVACPCCGKPAQRETDTMDT
FT                   FVDSSWYFMRYCDARNSEQMVAGGTDYWMPMDQYIGGIEHAILHLLYARFWTKVMRDLG
FT                   LVKVNEPFTKLLTQGMVLNHIYSRRTDKGGIEYFWPHEVENVFDAGGKVTGAKLKSDGS
FT                   AVDYGGIGTMSKSKNNGVDPQDLINQYGADTARLFVMFASPPEQTLEWNDAGVEGAHRF
FT                   LKRVWGFGVKQAELLKGATEVGAELSGDAKALRREVHLVLRQVSYDYERMQYNTVVSGS
FT                   MKLLNALEAYKHDGSAGSAAVLREGYSVLLRGLYPACPHITHHLWSELGYAAKLGDLLD
FT                   APWPEVVEAALVQDEIELVLQVNGKTRGSIKVPAAADKAAIEAAAAASAEVAKFADGKP
FT                   IRKLIVVPGRLVNVVV"
FT   gene            518405..518977
FT                   /locus_tag="Lcho_0480"
FT   CDS_pept        518405..518977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0480"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: mpt:Mpe_A0217
FT                   putative lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32755"
FT                   /db_xref="GOA:B1XXY6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY6"
FT                   /protein_id="ACB32755.1"
FT                   /translation="MSTAPFDRAPRRRLLVRAGAAGAAGALLAALAGCGFQLRRPPELQ
FT                   LKRIHLKGFDRYSSMADELRRQLRLSPGAQLVEAAGEADAVLEAIVDTSGRVVAASTAA
FT                   GQVRELTLRAALRFRVLDAAGRELLGPTELAQSRDMSYAENDALAKENEAQLLLRNMHG
FT                   DIANQVLRRLAALAPAAAPASAASAAR"
FT   sig_peptide     518405..518494
FT                   /locus_tag="Lcho_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.867 at
FT                   residue 30"
FT   gene            518987..520075
FT                   /locus_tag="Lcho_0481"
FT   CDS_pept        518987..520075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0481"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: mpt:Mpe_A0216 DNA
FT                   polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32756"
FT                   /db_xref="GOA:B1XXY7"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXY7"
FT                   /protein_id="ACB32756.1"
FT                   /translation="MQLRSDQLGAALQRGLRPLYVIHGDEPLLAQEAADLIRAAARKAG
FT                   HTERSVYTVAGAHFDWSGLLGEAQALSLFADKRLIEIRIPGGKPGKDGSEALQRYVETL
FT                   SDDNITLIVLPRLDRTQLASAWFTALDGAGASVRVDPIERRALPQWIAQRLAAQQQRVE
FT                   DGEPGQRCLAFFADCIEGNLLAAHQEISKLGLLHPPGVLTFEQVEGAVLNVARYDVFKL
FT                   GESVLAGQVARALRMLEGLQAEGEAAVLVHWTLSEDLRSLARVQAALQQGRPLPMALRE
FT                   ARVWGVKEKLFERIVPGLSTERLAELIAAAHLCDGIVKGLRAPGWPQDPWAALQRLLLM
FT                   TIDALPGQGGGAKTAARLALRA"
FT   gene            520250..520540
FT                   /locus_tag="Lcho_0482"
FT   CDS_pept        520250..520540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0482"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: mpt:Mpe_A0427 10 kDa
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32757"
FT                   /db_xref="GOA:B1XXY8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XXY8"
FT                   /protein_id="ACB32757.1"
FT                   /translation="MKLRPLHDRVIVKRLEQETKTASGIVIPDNAAEKPDQGEVLAVGP
FT                   GKRNDKGDFVALNVAVGDRVLFGKYSGQTVKVDGDELLVMREEDLFAVVGK"
FT   gene            520586..522235
FT                   /locus_tag="Lcho_0483"
FT   CDS_pept        520586..522235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0483"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: pna:Pnap_0657 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32758"
FT                   /db_xref="GOA:B1XXY9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XXY9"
FT                   /protein_id="ACB32758.1"
FT                   /translation="MAAKDVIFGGEARARMVEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   APTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQAIVREGM
FT                   KYVAAGMNPMDLKRGIDKAVHALVAELKKASKATTTSKEIAQVGSISANSDESIGTIIA
FT                   NAMDKVGKEGVITVEDGKSLDNELDVVEGMQFDRGYLSPYFINNPEKQAALLDNPFVLL
FT                   FDKKISNIRDLLPTLEQVAKAGRPLLIIAEEVDGEALATLVVNTIRGILKVVAVKAPGF
FT                   GDRRKAMLEDIAILTGGKVIAEEVGLTLEKVTLADLGQAKRVEVGKENTTIIDGAGAAG
FT                   DIEARVKQIRIQIEEATSDYDREKLQERVAKLAGGVALIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALLRAKQAAGEIKGDNADQDAGIKLVLKAIEAPLREIVYNA
FT                   GGEASVVVNAVLAGSGNYGFNAANDTYGDMIEMGILDPTKVTRTALQNAASVASLMLTT
FT                   ECMVAEAPKDEAAGGGMPGGMGGMGGMGGMDM"
FT   gene            complement(522307..524430)
FT                   /locus_tag="Lcho_0484"
FT   CDS_pept        complement(522307..524430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0484"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   nmu:Nmul_A1173 methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32759"
FT                   /db_xref="GOA:B1XXZ0"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ0"
FT                   /protein_id="ACB32759.1"
FT                   /translation="MLITAHYAQLNAQLHADRPDYGTSGQRWAPVVAALADRVKAGDIL
FT                   DYGCGKQTLAAALAARQVRGYDPAIPELSAEPKPADVVVCTDVLEHVEPDCIDDVLDDL
FT                   CRVTQKAALITVATRPAVKKLADGRNAHLTIQPFSWWREHFLSRFDIVDVREEEGNEFT
FT                   LILKALHAEDLDLSGFRLPQPANPSKPAKTATPDAAATVTSILVDDKRLKFHTPNRMTQ
FT                   WRVESLFTKEPDTIAWLKQMKSGEVLVDVGANVGMYSVFGAVCRGVQVHAFEPESQNYA
FT                   LLNSNIALNGLSGRVVAYPLALSDTSGADKLYLSDFSPGGSCHSFGEQVGFDLKPRGSA
FT                   FAQGAFSVTLDQLVSAGSVPVPDHIKLDVDGFEHKVIAGALTTLRDPKVKTVLVELNTH
FT                   LDEHRQVIQTLHELGFSHDPQQAQGALRASGAFEGVGEFIFTRQLEKKVELIQRTTLRL
FT                   PMSSRARDVLHHVLERVAQAPVTDAPFPHAVIDDVFPPDYYAEMLRQFPALSSMRPLSE
FT                   TGRVGKDNYKERMTTLFEESDFARLSQEQARFWRELADWMYSDTFLQAFVEKFHQALEP
FT                   RIAAVQRAEGQLNVRGDALLVNDQTRYAIGPHTDAPHRLVTFLFYLPSDTSMQELGTSL
FT                   YRPKQADFTCWGGPHYPHAKFDQVGRVDFLPNRLLAFPKTERSFHGVEPIDRADVNRRL
FT                   LINNIRLTNRVMY"
FT   gene            complement(524537..524947)
FT                   /locus_tag="Lcho_0485"
FT   CDS_pept        complement(524537..524947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0485"
FT                   /product="Fimbrial protein pilin"
FT                   /note="PFAM: Fimbrial protein pilin; KEGG: mca:MCA1510
FT                   fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32760"
FT                   /db_xref="GOA:B1XXZ1"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ1"
FT                   /protein_id="ACB32760.1"
FT                   /translation="MKSIQRGFTLIELMIVVAIIGILAAVALPAYRDYTLRAKVSELLL
FT                   AASSTRTAVTENSQNAGAINVSGITAPGAAGKVASASVAATGIVIVGATAEFGGTAVTV
FT                   TLVPSWNASANTVVWSCTVNPENLSPSSCRQD"
FT   sig_peptide     complement(524864..524947)
FT                   /locus_tag="Lcho_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.749 at
FT                   residue 28"
FT   gene            complement(525113..526558)
FT                   /locus_tag="Lcho_0486"
FT   CDS_pept        complement(525113..526558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0486"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mca:MCA1511 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32761"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ2"
FT                   /protein_id="ACB32761.1"
FT                   /translation="MSALTAAVNALNVAVTLEPRLADAWYRLGETLLRQDHYEEALTAL
FT                   LACVDVTPNEPLRAKAQFHIGQCHFALNRIELARDAFQASLNGSASADALTGLGHAYLR
FT                   LDQDTRAITAYEEALHSLENPSNILLLNLGCAYQHAGNYAGAREVFQKVITRSPSDHHA
FT                   RWYLCQLDLLECRWEQGWANYSARFAAGASPFRPMPFRRWNGRPSPEDTLLVLADEGLG
FT                   DEIMFASCTPDLSSRMGHVILECDPRLGRLFQRSFPQVEVIATQRRNQADWLSGCRTPQ
FT                   WQIPSGDLPSFFRNRDEDFPRHSGFLKADPERVTAWTERLDRSIGAGLKVGLSWRGGTD
FT                   RTRIRARTIQPETWGPILNVPDVHFVNLQYGNYSPELTQLEQLHGVRIHDFPEAHVDYD
FT                   ETAALVCSLDLVITVCTAVAHLSGAIGKEVWVLTPHAPGWRYTAGRNSMPWYPSSRIFR
FT                   QPAPGDWAQTCRELALALKALTN"
FT   gene            complement(526855..528555)
FT                   /locus_tag="Lcho_0487"
FT   CDS_pept        complement(526855..528555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0487"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   mca:MCA1512 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32762"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ3"
FT                   /protein_id="ACB32762.1"
FT                   /translation="MGDWLLQAGRHDEAESAYRKALQIKPLHARAQEGLGLVLLRIGRL
FT                   EEAFLHLEAAHKVEPDNAEILTHWGLVDLEMGNLGNAAGKFHRAIERDPRNPHAWHNLG
FT                   LVALKQGQVDTSIELLRKAIEIRPQHGLAYSNLAMALRRAERLDDALDAARKATEYKAD
FT                   NARVWVVLADVQMNLGDFDAAGQSLERATAIDPQHVGTFVGLGKRHAATGDPTRSREAY
FT                   TRALQLNPDSADARGGLGELELLLGQWSTAWDLYEARRRVEGTPVRPYPFKPWQGEDLQ
FT                   QRHILVHAEQGLGDIILFASCLPQLQALGGQCTIEVRSRMQALFARSFPQARVIGRAAN
FT                   AELLDWPAELPAFDYEIPFGSLPRWFRARATDFPAHQGYLVADAARVQTWRDKLAPGGR
FT                   PTVGIAWRGGMAATSKLQRSLELKALVSALAPTGVQLVCLQYGNVDAELEQVRSELGVH
FT                   IDPGVSGFGDLDDLAALTQACDRIVTVCSTQAHLTGALGKPGLVLVPSNPSWRYLHTGT
FT                   SMPWYPSLQLVRQQQPGDWSAVLTQAQSWVTSQTAASHSIADAPSGDAL"
FT   gene            complement(528779..529114)
FT                   /locus_tag="Lcho_0488"
FT   CDS_pept        complement(528779..529114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32763"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ4"
FT                   /protein_id="ACB32763.1"
FT                   /translation="MPLSFLKGLFGSSEIKTLAQSLANELSRRYPPAMATGEGRKLSPQ
FT                   AVTNILESVINKAVSKSHEWNLGVIGKAKLGNALRWELKDKGYPDKFIEMVTEALVVYM
FT                   SRQEKKS"
FT   gene            529236..531053
FT                   /locus_tag="Lcho_0489"
FT   CDS_pept        529236..531053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0489"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: mpt:Mpe_A0063
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32764"
FT                   /db_xref="GOA:B1XXZ5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ5"
FT                   /protein_id="ACB32764.1"
FT                   /translation="MSSNYPPVTSPWQPDGMLLAALSAVALPMLLAPTVSPTSTFFNQL
FT                   CAFAGMALWLGLWVGRATPVPIRRMPGALRGLLLLLVMLIVAQGLTEAPFGQRLMPIAT
FT                   LSLGAALALAAGLSAQSGRDDALWSGLLVALLAAGLLSVGISLLQVFAPTWTDGVWVAM
FT                   PTTPGRAIGNMRQPNQLSTLLLWACAAAVWLSQRHRWFLRELAAVLVLLVLADVLTASR
FT                   TGMVGVLMLAGWGAIDRRLPGRVRLLLLAMLAVYALGWWGMEQWSASTGQFFYGDDQIK
FT                   KTLHGDPSSSRGRIWANTLALIAQHPWTGVGPGAFNFVWSMTPFPDRPVAFFDHSHNLL
FT                   LQLAVDSGLPFAAAVLALALWVAWRSRAAFTQADDLRAGGARCAAFMLALVLVHSLLEY
FT                   PLWYAYFLLPTALMAGWMTGLVPPPASADRVGELDAGWRRPPTLARSVCGLVSALGMLA
FT                   SGWAAHQYYTVAVIFEPDVSIGIPEALPQRIARGQRSILFGHHADYAEVTMAPQPEQVF
FT                   DAFRRPLHHLLDTRLMTAYARALAARGDVERSRHVAARLREFRNPASDAFFAPCQAAAL
FT                   PASGAAAVAASVPFQCEPDPRWPAEAMHP"
FT   gene            531100..532614
FT                   /locus_tag="Lcho_0490"
FT   CDS_pept        531100..532614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0490"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: neu:NE0383
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32765"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ6"
FT                   /protein_id="ACB32765.1"
FT                   /translation="MTEGAKKLDLRSLGDLSQLVETVTLECKLAQGEDGQGALPKDFWP
FT                   TYSAMANSHGGLLLLGVRERHGRFSVAGVPDADKVRRDLFNNLNNPGKVSANLLGEDDV
FT                   QALMLEGRTVLAVQIPQAPRKLRPIYLNGQPLGHTWRRLHDGDRLCDVETVKRMLAEQL
FT                   EDSRDTRLLNRFGLPDLDPESLRAYRQMFAVVRPDHPWNAPDDTAFLKLIGGWRDDRDS
FT                   GDSGLTLAGLLMFGQWPSISEAAPLYFVDYQEQTDASDAATRWLDRLVPDGTWSGNLFD
FT                   FYRRVIRKLGADLKVPFMLKGDTRIDDTPQHQALREALVNTLVHADYNDRASVRIVKRP
FT                   SGFEFRNPGALRIPAEQALHGGVSDCRNRTLQQMFLMLNLGERAGSGLPRIRAGWDGDG
FT                   RTLTLHDDFEPYDHTVLTMSWGSSRAAIRRAQVETPGKTPGKTPGKTPDLVLHALQADP
FT                   QATVPTLALQLGKSESAILRVIRKLREEGRLRRIGPDKGGHWEVAV"
FT   gene            complement(532644..533078)
FT                   /locus_tag="Lcho_0491"
FT   CDS_pept        complement(532644..533078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0491"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: mpt:Mpe_A0062 molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32766"
FT                   /db_xref="GOA:B1XXZ7"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ7"
FT                   /protein_id="ACB32766.1"
FT                   /translation="MVDVAAKAVTHRVATATGCIRMLPATLALITQGSAKKGDVLGIAR
FT                   IAAIQGAKRTADLIPLCHPLPLTRVAVEFEIDTALPGVTCTATAETLGQTGVEMEALTA
FT                   VQVGLLTIYDMCKAADRGMVMDGVRLLEKRGGKSGHWQAE"
FT   gene            533233..534894
FT                   /locus_tag="Lcho_0492"
FT   CDS_pept        533233..534894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0492"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: mpt:Mpe_A0060
FT                   conserved hypothetical signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32767"
FT                   /db_xref="GOA:B1XXZ8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ8"
FT                   /protein_id="ACB32767.1"
FT                   /translation="MTLPLTRLSPPRRLRRAGWCLAAALLCPAPIAVLAQGASSTLPAL
FT                   GDAASDEIAVAAEGRLGDRIMQELRRDPDVLDDPLLVEYIERIWQPLLAAAKARGDVSE
FT                   ELAQNLAWQTFVVRDRSVNAFALPGGYVGVHLGLLSMTGSRDELASVLAHEMSHVSQRH
FT                   IARMMTSGRRSSMLALATMILGIMAVSRSPDAAQALVMGGQAAAVQGQLNFSRDMEREA
FT                   DRVGFGVLQGAGYEGVGMVGMFERMQLAARLTDSNQFPYLRSHPLTSDRIAEARSRLGL
FT                   DGAQTPSASLGSGGASAAWLHAAMQGRARALMDGRNEALQRLASAPGDASAGQGSAGNG
FT                   TLGGPPALASAYAAALAASRLKQWPLADAALQRARDLAAPHEAAARAVAMLRIESLIER
FT                   DRAVEALNILQAPGGARVDDGSRAGLMLVARVALAAHRSPGGPQAALQRSSEALMTWVT
FT                   DHPNDASAWDLLAQLHERRGQPLAALRAQAEVRVALGDWQGAADRLRAGQRLARGQGQV
FT                   DHVEAAVLDVRLKVVEQKRRQQALDEGRAPGDESGR"
FT   sig_peptide     533233..533340
FT                   /locus_tag="Lcho_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 36"
FT   gene            complement(534928..535296)
FT                   /locus_tag="Lcho_0493"
FT   CDS_pept        complement(534928..535296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0493"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   mpt:Mpe_A0059 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32768"
FT                   /db_xref="GOA:B1XXZ9"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B1XXZ9"
FT                   /protein_id="ACB32768.1"
FT                   /translation="MLAAMVKILIRWCLLAAVLLLIAHLYSGVEVRSFSAALGAALVLG
FT                   LLNAVVRPVLVILTLPVTLVTLGLFLFVINALLFYSAAWLMDGLHVTSFGAALVASLIY
FT                   SVFGLVVEAALSQIFRDS"
FT   sig_peptide     complement(535210..535296)
FT                   /locus_tag="Lcho_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.539 at
FT                   residue 29"
FT   gene            complement(535400..536293)
FT                   /locus_tag="Lcho_0494"
FT   CDS_pept        complement(535400..536293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0494"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: azo:azo3332 succinyl-CoA
FT                   synthetase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32769"
FT                   /db_xref="GOA:B1XY00"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY00"
FT                   /protein_id="ACB32769.1"
FT                   /translation="MSILINKDTRVITQGITGKTGQFHTLGCQAYANGKNAFVAGVNPK
FT                   KAGEKFADIPIYASVKEAAQQQGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIP
FT                   VRDMLEVRNKMKAKEAAGGKKTLLLGPNCPGLITPEEIKIGIMPGHIHRKGRIGVVSRS
FT                   GTLTYEAVAQLTEIGLGQSSAVGIGGDPINGLKHIDVMRAFNDDPDTDAVIMIGEIGGP
FT                   DEAEAAMWCKANMKKPIVGFIAGVTAPAGKRMGHAGALISGGADTADAKLAIMEECGFT
FT                   ITRNPSEMARLLKALL"
FT   gene            complement(536311..537471)
FT                   /locus_tag="Lcho_0495"
FT   CDS_pept        complement(536311..537471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0495"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: pna:Pnap_3953 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32770"
FT                   /db_xref="GOA:B1XY01"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY01"
FT                   /protein_id="ACB32770.1"
FT                   /translation="MKIHEYQGKAILRQFDIPVPRGHAAFTVQEAVEAAQKLGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSLDDVKKLAEQILGMQLVTHQTGPEGQKVRRLYIEDGADI
FT                   QKEYYVSLVTDRQSQKVAFIASSEGGMDIEEVAHSTPEKIITEVIDPLTGLGAEQAEKI
FT                   ARAIGLPAESIAQAVTLFQNLYRCYMETDASLVEINPLNRDSKGGLIALDAKFNFDANA
FT                   LFRHPEIVACRDLDEEDPAEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATAEKVTEAFKIMLKNPEVKGILVNIFGGIMKCDTIAEGVITACKAVN
FT                   LSVPLVVRMKGTNEDLGKKMLAESGLPIIAADTMAEAATAIVNAVK"
FT   gene            complement(537626..538099)
FT                   /locus_tag="Lcho_0496"
FT   CDS_pept        complement(537626..538099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0496"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: pol:Bpro_4684
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32771"
FT                   /db_xref="GOA:B1XY02"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XY02"
FT                   /protein_id="ACB32771.1"
FT                   /translation="MASNRPQLSLKGRALKYLAAREHSRAELARKLAPHAGDPAEIEAV
FT                   LDDLQARGFLSEARYVASVVHRRAERFGVARIRQELLSKGTPADQMTDALDALRTTELE
FT                   RARELWRRRFGQPPADAREAARQNRFLMSRGFSSDVVRQVLRLADHEHDHDNT"
FT   gene            complement(538139..539200)
FT                   /locus_tag="Lcho_0497"
FT   CDS_pept        complement(538139..539200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0497"
FT                   /product="recA protein"
FT                   /EC_number="7.2.2.10"
FT                   /note="KEGG: mpt:Mpe_A0075 putative recombinase A; TIGRFAM:
FT                   recA protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32772"
FT                   /db_xref="GOA:B1XY03"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY03"
FT                   /protein_id="ACB32772.1"
FT                   /translation="MEATAKSALSGEKAKALQVALAQIEKQFGKGSIMRLGEGEVIEDI
FT                   QVVSTGSLGLDVALGVGGLPRGRVVEIYGPESSGKTTLTLQVIAQMQKLSGVCAFIDAE
FT                   HALDIQYAQKLGVNLQDLLISQPDTGEQALEIVDALVRSGSVDLIVVDSVAALTPKAEL
FT                   EGEMGDSLPGLQARLMSQALRKLTSNIKKTNCMVIFINQIRMKIGVMFGSPETTTGGNA
FT                   LKFYASVRLDIRRIGSIKKGEEVIGSETKVKVVKNKVSPPFKTAEFDILYGEGISREGE
FT                   IIDMGVVAKVVDKSGAWYAYNGEKIGQGKDNCREFLRENPALAHEIENKIRESLGISLL
FT                   PPQNGAAAAAPAA"
FT   gene            539365..540036
FT                   /locus_tag="Lcho_0498"
FT   CDS_pept        539365..540036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0498"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mpt:Mpe_A0076 response
FT                   regulator transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32773"
FT                   /db_xref="GOA:B1XY04"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY04"
FT                   /protein_id="ACB32773.1"
FT                   /translation="MRILIAEDDQVLADGLLRSLRSAGYAVDHVGSGSEADAALAAHEF
FT                   DMLILDLGLPKLHGLEVLKKLRGRGSSVPVLILTAADSIEQRVKGLDFGADDYMAKPFS
FT                   LQELEARVRALTRRGLGSASAIIRHGPLSFDATGRVAYINDLMIDLSARELSLLEVLLQ
FT                   RAGRLVSKDQLVERLCEWGEEVSNNAIEVYIHRLRKKIEQGPIRIATVRGLGYCLEKIP
FT                   G"
FT   gene            540079..541635
FT                   /locus_tag="Lcho_0499"
FT   CDS_pept        540079..541635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0499"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: mpt:Mpe_A0077 putative transmembrane sensor
FT                   histidine kinase transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32774"
FT                   /db_xref="GOA:B1XY05"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY05"
FT                   /protein_id="ACB32774.1"
FT                   /translation="MPALPAIVRRREQRSLFGEILDWMLAPLLVIWPMSLALTWLAAQG
FT                   IANKPYDRALLESVRTLAQRIEPGERGIRFDLPKETARLFRADELDNVYYQVLGTRGEF
FT                   VSGDRDLPVPPDGDGGVLGEPRIRDDEVQDDSVRVVYVWVAVPGSSRPALVQVGETLTK
FT                   RSRLATEIIKGVILPQFVILPVAVLLVWFALARGLAPLNALQRRIRERHSDDLSPIDVH
FT                   DVPEEVSPLVQAFNDLLERQQGSMSTQKRFLADAAHQLKTPLAGLRMQAELAARAVASG
FT                   NGDARALQASLEHMANASQRAAHMVNQLLSMARADAQAGIAARAVLDLRVLAIDVVRDF
FT                   VPKALDKGIDLGYEGPEPVPDDASEADTAAVDCRVLGHPLLLRELIANLVDNALQYTPT
FT                   RGTVTVRLLVDPFGQVVVLQVEDSGPGIPQAEKDLVFQPFYRALGTPVDGSGLGLAIVA
FT                   EIAAQHGTTIALDDARSGAQIPPGEGPGARFTLRLPRAQPSPPSDDADLAQTQTQTQTQ
FT                   A"
FT   gene            complement(541651..542805)
FT                   /locus_tag="Lcho_0500"
FT   CDS_pept        complement(541651..542805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0500"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: mpt:Mpe_A0079 putative rod
FT                   shape-determining transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32775"
FT                   /db_xref="GOA:B1XY06"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY06"
FT                   /protein_id="ACB32775.1"
FT                   /translation="MSHSLNQPTFRQRLRPWFTGFDIGLVIAIALLCGCGLLAMYSAGF
FT                   DHGTRFVDHARNMALAGLILFVVAQVPPQRLMALAVPIYTVGVVLLVATALFGLTKKGA
FT                   TRWLNVGVVIQPSEILKIATPLMLAWWFQRREGRAQPRHFVAAGLLLLVPTALIAKQPD
FT                   LGTAILVFSSGFFVIFFAGLSWRLILPVALVGGVSVVALVAAGPTLCEPGVDWVVLHDY
FT                   QKNRVCTLLDPTKDPLGKGFHIIQGMIAIGSGGVTGKGFMKGTQTHLEFIPERTTDFIF
FT                   AAFSEEFGLIGCLLLLMCFAFLILRGLAISFAAPTAFARLLGGAITLSFFTYAMVNMGM
FT                   VSGILPVVGVPLPFISYGGTAMVTLGLSLGMLMSIARARGLMQS"
FT   gene            complement(542802..544841)
FT                   /locus_tag="Lcho_0501"
FT   CDS_pept        complement(542802..544841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0501"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: mpt:Mpe_A0080 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32776"
FT                   /db_xref="GOA:B1XY07"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY07"
FT                   /protein_id="ACB32776.1"
FT                   /translation="MIELRNVEQELERYRTRLIVAAVFVLACFGLLAARLVYLQVVVHE
FT                   DLATRAENNRIAVVPIVPNRGLIVDRNGVVLADNYSAYTLEITRSQLTESLESTIDQLA
FT                   EVVEIQPRDRRRFKRLLEDSRSFESLPIRTKLSDAEVARFTAQRYRFPGVEIKARLFRN
FT                   YPYGELASHLLGYIGRINRNELAAMEEWPEEDWANYRGTEVIGKLGIEQKYERELHGTT
FT                   GVEEVETSAGGRPVRRLRSEPASPGSSVHLSIDIKLQALIERLFGERRGALVAIDPRNG
FT                   EVLAFVSKPTFDPNLFVDGIDHESWKELNESIDKPLLNRALKGTYPPGSTYKPFMAMAA
FT                   LTTGKRSATQVINDNGSFMFGNHRFRSHGDGGLGSVDMVKSIVLSSNVYYYSLANEMGV
FT                   DLIHDQLYPYGFGRRTGIDLDGESTGDLPSTAWKRSKYKRPDLQRWYAGETISLGIGQG
FT                   YNNFTMLQMASAMATLVSGGKRFEPRLVREIEDVLTHDRQRPSAQALEPLDLKPEHVAV
FT                   IRRAMHGVTQEGTSTRVFAGAAYPSGGKTGTAQAKSIGQKEKYNAAKLAEYFRDHSLYT
FT                   AFAPVDEPRVALAVVVENSGFGAEAAAPIARRVLDYLLLGLYPSEEDIALARLGKAGAP
FT                   VGPQRLAADVPLPTLMSAGMATPTDAAASAPAPASAPILLGGPR"
FT   gene            complement(544849..545355)
FT                   /locus_tag="Lcho_0502"
FT   CDS_pept        complement(544849..545355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0502"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: mpt:Mpe_A0081
FT                   putative rod shape-determining MreD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32777"
FT                   /db_xref="GOA:B1XY08"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY08"
FT                   /protein_id="ACB32777.1"
FT                   /translation="MGDQLLLPVNPWFMWASLLLALGLNMLPLGRLPAMPDLVALALVF
FT                   WNVHQPRRVGVGAAFCFGLLMDVHEGAVLGQHALAYTLLSYFAITIHRRLLWFSTPAQA
FT                   LHVLPLMAAAHLVTLLLRLATGGHFPGWSLLLSPLFETLLWPLVSLLLLAPQRRAPDPD
FT                   KHRPL"
FT   gene            complement(545475..546413)
FT                   /locus_tag="Lcho_0503"
FT   CDS_pept        complement(545475..546413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0503"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: mpt:Mpe_A0082
FT                   putative rod shape-determining MreC transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32778"
FT                   /db_xref="GOA:B1XY09"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY09"
FT                   /protein_id="ACB32778.1"
FT                   /translation="MPLGTLDRSPPPFFRQGPSALTRLVFFASLAVFLMAADTRLGLTG
FT                   PLRTAAAVALHPVERALLAPVDALSTVGAYFDGITVARQQADAAQARLTQQAERTLQVD
FT                   RLLQENTRLRALLELRAGLTYRSHAAEILYDAADPYTRKVVIDRGENVGILRGSPVIND
FT                   AGVLGQVTRIYPLTAEVTLLIDRDAAIPVLNTRTQLRNVAFGDPDSAGMELRYAAANTD
FT                   VKVGDVLSTSGLDGVYPPGLPVARVASLERRTQTDFARIVLQPVAQADGVRHVLVLDPM
FT                   STQLPVRPEAAASAAGRDKDALSLRKSTPRR"
FT   sig_peptide     complement(546303..546413)
FT                   /locus_tag="Lcho_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.625 at
FT                   residue 37"
FT   gene            complement(546468..547517)
FT                   /locus_tag="Lcho_0504"
FT   CDS_pept        complement(546468..547517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0504"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: mpt:Mpe_A0083 putative rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32779"
FT                   /db_xref="GOA:B1XY10"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY10"
FT                   /protein_id="ACB32779.1"
FT                   /translation="MFYGSLLRRYFSTDLAIDLGTANTLIYVRGVGIVLNEPSVVSIRH
FT                   EGGPHGKKTIQAVGAEAKAMLGKVPGNIEAIRPMKDGVIADFTVTEQMLKQFIKMVHPR
FT                   SLLRPSPRIIICVPCGSTQVERRAIRESALGAGASEVYLIEEPMAAAIGAGMPVSEASG
FT                   SMVVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDEAIINYIRRNYGMLIGEPTAETIK
FT                   KEIGSAFPGSEIKEMEVKGRNLSEGVPRSFTVSSNEILEALTDPLNQIVSSVKKALEQT
FT                   PPELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLIAEDPLSCVVRGCGMALERME
FT                   RLGSIFTSE"
FT   gene            547854..548153
FT                   /locus_tag="Lcho_0505"
FT   CDS_pept        547854..548153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0505"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: mpt:Mpe_A0084 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32780"
FT                   /db_xref="GOA:B1XY11"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XY11"
FT                   /protein_id="ACB32780.1"
FT                   /translation="MALTPADVSRIANLARLELSTAEQSDLLVQLNGFFGIVERMRAVD
FT                   TTGVAPLYTPLSAVQDVSLRLRDDAVTETDQREANQKSAPAVEGGLFLVPRVIE"
FT   gene            548162..549655
FT                   /locus_tag="Lcho_0506"
FT   CDS_pept        548162..549655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0506"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: mpt:Mpe_A0085 putative
FT                   glu-tRNA (gln) amidotransferase (subunit A) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32781"
FT                   /db_xref="GOA:B1XY12"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY12"
FT                   /protein_id="ACB32781.1"
FT                   /translation="MTELHQLDITELAALLDAGKVSSVELTRHQLARVAVHESLGAFLC
FT                   VDEDVALAQAGAADAWRARGIGGAAHRLLGVPIAHKDIFVTRDFPSTAGSKMLEGYRSP
FT                   FDATVVSRLSAAGAVTLGKLNCDEFAMGGSNENSAWFPARNPWDTGRITGGSSGGSAAA
FT                   VAARLVPGATGTDTGGSVRQPASFCGITGIKPTYGRCSRYGMIAFASSLDQAGPMARSA
FT                   LDCAHLLQAMSGFDPRDATSAEQAVPDFVAQTTALREGATADRPLAGLRIGLPKEFFGD
FT                   GVAADVLAATRAALAELEKLGATLVDVSLPRTELSIPVYYIIAPAEASSNLSRFDGVRY
FT                   GHRAEQYKDLSEMYSKSRSEGFGAEVKRRIMIGAYVLSHGYYDAYYLQAQKLRRMIADD
FT                   FQAAFTQCDLIAGPVAPTVARPLGSQSDPVAEYLADIFTLPASLAGLPGISVPAGSGEA
FT                   GLPVGLQLIGNYWREGALLHAGHAFQQATDWHRRSPAAA"
FT   gene            549655..549774
FT                   /locus_tag="Lcho_0507"
FT   CDS_pept        549655..549774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32782"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY13"
FT                   /protein_id="ACB32782.1"
FT                   /translation="MRTDGPAAARRDTRRYPSGDPCDAVRPYHPRPMSNRCLP"
FT   gene            549771..551069
FT                   /locus_tag="Lcho_0508"
FT   CDS_pept        549771..551069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0508"
FT                   /product="putative chaperone protein"
FT                   /note="KEGG: mpt:Mpe_A2203 putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32783"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY14"
FT                   /protein_id="ACB32783.1"
FT                   /translation="MTEEDFCAIDFGTSNSAIAVPDDAAPSGMTLVPLENGQPTMPTSV
FT                   FYLAEGPELQNLPRLFGRAGIAAYTEGHEGRLMRSMKSVLGSSLMDQHTDIGAGRSVSF
FT                   ADVITGYLLRLKRSAEAHTGRTLKRVVLGRPVHFVDEDDARDAQAQAALEAAARAVGFE
FT                   SVGFQYEPLAAAFHYEATVADEQHVLVADIGGGTSDFSVVRVGPAHRERLDRRDDVLAN
FT                   HGLHIAGTDFDRRVELASILPELGYGTFGPAIGGQPAREVPSRIYFDLATWHIVNTLYR
FT                   PQRIAEVRAMKVNFANPVLHQRLLTVLTDHLGHDLLGRAERAKIEVADGGQASIDLRLV
FT                   ERGLQVTLEDAQAQAALRDDVARIVAAAHEAVQMAGLAPERIDALYFTGGSTGLRLLTD
FT                   ALSAGFPAARPVHGERLASVATGLGLYARRLWA"
FT   gene            complement(551092..553317)
FT                   /locus_tag="Lcho_0509"
FT   CDS_pept        complement(551092..553317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32784"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY15"
FT                   /protein_id="ACB32784.1"
FT                   /translation="MFIKMCRPLWAMACLLLAALLAGPGLARAADDPPGRVGRIAWIDG
FT                   DARLARGDGGDTLDHARDSLRNWPVTSGDELSVGNNSRAEIGIGSTRLRLGENSQLLLR
FT                   RVDDERIELELLGGSLAVLLGSDEVARELSIETDAARLLPLGAGLYRIDVPDAERGHTH
FT                   LHAATAWRNGLRIEQPAGSYLLQPGQRAEIYVDGGFRLDTPEADGFARWAMNDDDLRLQ
FT                   QASRDAPVPDEMTGAHELDRHGDWTRSADYGWVWYPRTVVVGWAPYRHGRWSWVSPWGW
FT                   TWIDDAPWGFAPFHYGRWVWWRDRWGWVPGDHTPRPVYAPALVVWNGQPGLSWSISIGT
FT                   GVAWYPLAPREVYVPAYAFSPRHVRLLNQPHVHDGPLLRRVMERPDEVLRHTPYRYRQF
FT                   SGAVSTGIGRDGRDGRFFRPAPWRGAVELPPRMRAPQAPPVVTRIQPPQPPRERWERDR
FT                   RDRNERGDRIDRGDRFDRPDRQPAPPQPDMRHHGDIDRNRPPGANAPPAPPPNPSQRFV
FT                   PGQVPIQPGQAARPQPGLAQPVAPQPGASFPGLRPRDGARPDGRPDADPDGRTDNRRDG
FT                   RFGSRPELVPAAPPPVAAPAPTPARTQAPDQPRAQPPVQAVAPAAPIQQTPPPRGNFPG
FT                   LDRGQREAGGGRPAAPPAPMVQAAPVMPAAPPPAMVAAPPPAVVVTPPPRPEQRIAVPR
FT                   AEPPRPPEVRQEQRRDNPPQRTQGRPDGQPEPRQDGRRERWPPGREQ"
FT   sig_peptide     complement(553228..553317)
FT                   /locus_tag="Lcho_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            553422..554390
FT                   /locus_tag="Lcho_0510"
FT   CDS_pept        553422..554390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32785"
FT                   /db_xref="GOA:B1XY16"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY16"
FT                   /protein_id="ACB32785.1"
FT                   /translation="MLTGTLFALTAGLMWGLVFVGPLLLPEYSPALQSFGRYLAFGLIA
FT                   LPLAWFDRARLAQFTRADWREALRLSIVGNIVYYLCLAAAIQRAGGPLPTMIIGTLPVV
FT                   IAISSNLRDAARDGRLPWLQLAPSLLLIAAGISLVNQVEIEAMRAQPDADLGRYASGAL
FT                   LAICAVVCWTWYPLRNADWLRAHPDRSPRTWATAQGLATLPLALLGYAASWAWLSASGS
FT                   AFPMPFGPRPVFFLGLMFAIGLLASWLGTLCWNEASQRLPTTLVGQLIVFETLAALSYA
FT                   FMLRGQWPAPATLGGIALLVVGVLWAVRARPEPLVAQAHPD"
FT   sig_peptide     553422..553484
FT                   /locus_tag="Lcho_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.768 at
FT                   residue 21"
FT   gene            554429..555658
FT                   /locus_tag="Lcho_0511"
FT   CDS_pept        554429..555658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0511"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aav:Aave_1896 drug resistance transporter, Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32786"
FT                   /db_xref="GOA:B1XY17"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY17"
FT                   /protein_id="ACB32786.1"
FT                   /translation="MHAHARHLWTAPRWALAILLASLGMLGPFSIDTYLPAFTGIAASV
FT                   GASPVEMQQTLSAYLLGFAAMNLFHGALADALGRRPVVLTGVAVFTLASVGCALSDHVG
FT                   WLIAFRALQGMSAGAGMVVSRAVIRDLFPPDQAQKMMSQVTIYFGIAPAVAPMIGGWLF
FT                   VHLGWHAVFWFLSGVGLLIGLGVWRALPETLPAAQRQRLDLSHLWQGYRALGLDRRFWL
FT                   LALASGVPFNGMFLYVLSAPAFLGELMRLAPDQFFWFFIANIGGIMLGAWTSGRLAGRI
FT                   AGSVQIRAGFVIMSLASVANVAANLVWPPHISWALVPLFFYCLGWAILVPVVTLMVLDL
FT                   VPARRGMASSLQATVASTANALVAGVLAPLVMHSTLALSVASALLMTVGLVAWQCVRRS
FT                   VMVSPGARPD"
FT   sig_peptide     554429..554521
FT                   /locus_tag="Lcho_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.544 at
FT                   residue 31"
FT   gene            555767..556879
FT                   /locus_tag="Lcho_0512"
FT   CDS_pept        555767..556879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0512"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: dar:Daro_3922
FT                   carbonic anhydrase, eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32787"
FT                   /db_xref="GOA:B1XY18"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY18"
FT                   /protein_id="ACB32787.1"
FT                   /translation="MTRPLISCFSAALMGRGLAALLLCAAVGAAGASDGAHPSPDRGAK
FT                   AAPASRAAAARGQGAALEVSLDELRDRLASRVAEVRDAQARTPLLKVSVKGDKPLKVAG
FT                   DGHAPTAAAARSHAGAKGAKPDAVAHAAAPAVVHAVVHADAGHPHWSYQGDAGPAAWAS
FT                   LKPEFASCGNGQRQSPIDIRDGIKVELDAVQYDYRPSRFTVIDNGHTVQVNVAPGNSIE
FT                   VTGRRYELLQFHFHRPSEERINGRQFDMVAHLVHKDPQGRLAVVAVLLQQGRQHPLVQL
FT                   VWNSLPLEQNDETPAPVPLDLNMLLPEDRRYYTYMGSLTTPPCSEGVLWMVLKQPAQLS
FT                   PEQVAVFARLYPMNARPIQQAGGRIIKESN"
FT   sig_peptide     555767..555865
FT                   /locus_tag="Lcho_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.729 at
FT                   residue 33"
FT   gene            557202..557642
FT                   /locus_tag="Lcho_0513"
FT   CDS_pept        557202..557642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0513"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: mpt:Mpe_A0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32788"
FT                   /db_xref="GOA:B1XY19"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XY19"
FT                   /protein_id="ACB32788.1"
FT                   /translation="MADFHFQGTSALALDAKGRVTVPARHRESLVSLAGSQLTLTKHPE
FT                   GCLMVFPRPVWEGFRAKVEALPMAASGWKRIFLGSAMDVEIDSGSRMLISPELRAAAGL
FT                   VHDVLLIGMGNHLELWDAQRQASAEAAVLQQPMPDVLQDFSF"
FT   gene            557648..558625
FT                   /locus_tag="Lcho_0514"
FT   CDS_pept        557648..558625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0514"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: mpt:Mpe_A0454
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32789"
FT                   /db_xref="GOA:B1XY20"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XY20"
FT                   /protein_id="ACB32789.1"
FT                   /translation="MITAAAVPWQHRTVLLHEAVDALVQRPAGVYLDGTYGRGGHSRLI
FT                   LERLDPAGRLIAIDRDPEALANARSGETRIDDPRFSIHHARFAEFESVLDEAGVGQLDG
FT                   LLLDLGISSPQIDNPERGFSFRFDGPLDMRMDPTRGQSAAEFLASAPFERIKEVVRDYG
FT                   EERFADAVAKAIVARREEGRPVQRTAELAALVAGAVKTRERGQDPATRTFQALRILVNA
FT                   ELEEVEQGLNRALARLAPGGRLAVIAFHSLEDRIVKTFIARHAREVYDRRMPYATPAPL
FT                   LMRAVARIKPGEAEVAANPRARSAILRVAERTDVPLPVVVGRYA"
FT   gene            558622..558930
FT                   /locus_tag="Lcho_0515"
FT   CDS_pept        558622..558930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0515"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   pol:Bpro_1068 cell division protein, FtsL -like"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32790"
FT                   /db_xref="GOA:B1XY21"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY21"
FT                   /protein_id="ACB32790.1"
FT                   /translation="MMRLNVLLLVALLVSAVYLVQTAYHSRQLFVALERERNMARQLEI
FT                   EAERLTVERRAQATSLRVERVAREQLQMRVATPAVTQYVTDPLIAGAPAAALSGGTP"
FT   sig_peptide     558622..558684
FT                   /locus_tag="Lcho_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.647 at
FT                   residue 21"
FT   gene            558930..560774
FT                   /locus_tag="Lcho_0516"
FT   CDS_pept        558930..560774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0516"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   mpt:Mpe_A0456 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32791"
FT                   /db_xref="GOA:B1XY22"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY22"
FT                   /protein_id="ACB32791.1"
FT                   /translation="MKWLSRLWPGRAPANTARRSPRQQTAVRRNTSLGSGHLQYASSPL
FT                   LAAKTPLWRARLVVLGVGVGFLVLLGRAVYIQVIGTEFYQKQGESRYARTFELPASRGR
FT                   ITDRHGQILAASVPAPSIWAIPKDFRPDAKQQQALLRLLGMTSRELATRLADNPNFVWL
FT                   RRQVDESVAAQVKALGIKGLHQQREFRRQYPEGESAAHVVGFTNLEERGQEGIELAFQK
FT                   ELEGRAGSRSVVRDRLGRIVEDIGESREPVDGSDLALALDSKVQFFAYQRVRDAVLEHN
FT                   AKAGSVVVLDVLTGEVLALANYPSYVPGERQGLSGAQLRNRAVTDTFEPGSTMKPFIAA
FT                   LALQTGRVTPDTVIQTAPGRIHFGSATISDSHPHGLLSVEQVIQKSSNVGTVKMAMQME
FT                   PREMWEMFSSVGIGQKPQLAFPGLASGRLRPYKSWRPVEQATMSYGYGLSVSLLQLARA
FT                   YTVFARDGQLMPVTMLKNEVPAAGVQVFSPEVARSVRHMLNMAAAPGGTAPKAQAIGYS
FT                   VGGKTGTAHKQEGGSYVSNKYRAWFVGIAPVSNPRIVVAVMVDEPGNGRYFGGDVAAPV
FT                   FSQVVQQSLRMLGVPPDLEVQPQIVARAQAVKAEEESF"
FT   gene            560774..562315
FT                   /locus_tag="Lcho_0517"
FT   CDS_pept        560774..562315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0517"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: mpt:Mpe_A0457
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32792"
FT                   /db_xref="GOA:B1XY23"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1XY23"
FT                   /protein_id="ACB32792.1"
FT                   /translation="MALHQLPDVDAALAWLRARLGDAAELRTDSRSVRAGEAFIAWPGH
FT                   AADGRAYVGAALAAGAAACLIEADGAAAFGFDDERIAALPGLKAATGELAHRWYGEPGR
FT                   RLALIATSGTNGKTSTAWWTAQALSLAGQRCGVIGTLGVGEPPSRVHPDAQVHATGLTT
FT                   PDPLTLHRSLRDFADAGFAACAIEASSIGIVEHRLDAAPIRVALYTNFTPDHLDYHGDM
FT                   VAYWLAKRALFDWPGLQAAAINVDDAQGAVLADELAARGDLDLWTYALHRDARLRATGL
FT                   HYVDGGLAFTLHEGETDVAVHTHLIGAYNASNVLAVIGGLRALGLPLAQAAALAAEFTS
FT                   VPGRMHRVRPASPTGAVPQVVVALPQVVVDYAHTPDALDKALSALRPVAHAQGGRLVCV
FT                   FGCGGNRDATKRPQMGAIAAQLADAVCVTSDNPRLEEPQAIVDQILAGCAGAAHVRAEV
FT                   DRTRAIEQVLAQAAPEDVVLIAGKGHEDYQDIGGVKRPFSDIDVATAALQRRVTA"
FT   gene            562312..563781
FT                   /locus_tag="Lcho_0518"
FT   CDS_pept        562312..563781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0518"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: mpt:Mpe_A0458
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamino
FT                   pimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32793"
FT                   /db_xref="GOA:B1XYQ9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYQ9"
FT                   /protein_id="ACB32793.1"
FT                   /translation="MNTLMTLEHAHALIVRRQPAARLVGDGCQPIARVHSDTRSLRAGD
FT                   LFVALRGERFDAHDFLPQAQAAGAVAAIAERGLDASGMPGIEVPDSLLALQALAAGWRA
FT                   EHLLPVIAVTGSNGKTTVTQMIAAILRAWLGDAAHATAGNFNNHIGVPLTLLALHAGHR
FT                   AAVVELGMNHPGEIAELARIAQPTVALVNNAQREHQEFMQTVEAVARENGCVISALPAD
FT                   GVAVFPADDDYTPIWRELAQPRRVLTFALAEAGVAADCVAQASWAGDHWQARFDTPAGS
FT                   IDLALGVAGRHNVKNALAACACALAAGCPLDAVQRGLAGFAAVKGRSQVSLLDWGGRQV
FT                   TLVDDSYNANPDSVRAAIEVLAALPAPRWLLLGDMGEVGDQGPAFHAEVGTLAAQRGID
FT                   HFWTAGVLCADAARAYADAVHASHDATLVAHHVSYHGDTAALLQAIAAAGVALPPAASV
FT                   LVKGSRFMAMEKAVAALREAARHAGEQQDAG"
FT   gene            563771..564952
FT                   /locus_tag="Lcho_0519"
FT   CDS_pept        563771..564952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0519"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: mpt:Mpe_A0459
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32794"
FT                   /db_xref="GOA:B1XYR0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYR0"
FT                   /protein_id="ACB32794.1"
FT                   /translation="MLVSLANWLQGHYPDSFGFLRVVQYLTFRAVMSAMTALLLGLVFG
FT                   PWVIRRLTELKIGQPVREYGVQSHLVKTGTPTMGGVLILLSIAVSTLLWFDWSNRFVWV
FT                   VMLVTFGFGAIGWVDDWRKVVQKNPEGMASGEKYLWQSLIGLVAAIYLAFSVSETSNLR
FT                   VLELFLRWVGSGFSNDLPPKADLIVPFFKSVSYPLGVFGFIFLTYFVIVGASNAVNLTD
FT                   GLDGLAIMPVVLVGSALGLFAYVTGNSVFSKYLLLPHIPGAGELLIFCAAMAGAGLAFL
FT                   WFNAYPAQVFMGDVGALALGGALGTIAVIVRQEIVLGIMGGIFVVEALSVMAQVAYFKY
FT                   TKKRYGQGRRILLMAPLHHHYEKKGWEETQVVVRFWIITMLLCLVGLSTLKLR"
FT   gene            564960..566813
FT                   /locus_tag="Lcho_0520"
FT   CDS_pept        564960..566813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0520"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   mpt:Mpe_A0460 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32795"
FT                   /db_xref="GOA:B1XYR1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR1"
FT                   /protein_id="ACB32795.1"
FT                   /translation="MNFLRDLPVLVLGLGDSGLAMARWAQRCGAARIVVADSRSAPPQA
FT                   ARLASDVPAAELRCGAFTADLLDGVQLVLKSPGLSPLDAGVVPLLDAAGERGVVVLGEL
FT                   ALFAHALADLKTARGYAPKVLAITGTNGKTTTTALTALLVERAGLRVAMAGNIGPTMLD
FT                   TLGAALDLEPAAAELIAAAAVPDPEPSDEIDADEQADLAALDGVTADEADVADVAVDGV
FT                   DTSAIEPAAEESAAEGPSLDDLIEGGGPPPHLIPSPPPAPVFEHLPQAWVLELSSFQLD
FT                   GVHNFEPTAAAVLNVTQDHLDWHGDMAAYAAAKARIFGRQAVMVINRDDPAVLAMIPQP
FT                   PEPEVGKSGKVLKARGPRWQPRRVVRFGLDQPRQPGDWGLVIEQGMAWLVRAHERDDSE
FT                   PRTRRGAAVIDTEVTLQRLMPADALRIRGRHNAANALAALALASAAGLPLAPMLHGLRE
FT                   YRGEPHRVEYLLTVAGVDAYDDSKGTNVGATVAALTGLGPDKAPGKLVVILGGDGKGQD
FT                   FSPLAAAVAAHARAVALIGRDARAIGAVLAPLVADGLPVQSHDSLEAATRWCFEQARSG
FT                   DAVLLSPACASLDMFRNYAHRAQVFADTVAAMATEHGEFGA"
FT   sig_peptide     564960..565028
FT                   /locus_tag="Lcho_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.860 at
FT                   residue 23"
FT   gene            566872..568140
FT                   /locus_tag="Lcho_0521"
FT   CDS_pept        566872..568140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0521"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: mpt:Mpe_A0461 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32796"
FT                   /db_xref="GOA:B1XYR2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR2"
FT                   /protein_id="ACB32796.1"
FT                   /translation="MSAAANAVTGWQARLRARVAGWLPGGESAVLERDWVGATAGQPTR
FT                   WVGFDAALLWVVVGLLSLGLVMVYSASIQLPDNPRFANYEPTHFFSRQILAISMAGILG
FT                   GVTLTIPMRTWERVAPWLFVAALILLVLVLVPYIGKVVNKSRRWIPLGIINFQPSELAK
FT                   LAIAMYAANYMVRKMDVKESFTRAVLPMAIALLFIGLLLLAEPDMGAFIVIAMIAMGIL
FT                   FLGGVNGRMFLIIIAVLVGSFVLMISFSEVRRERILAYLNPWDELYAQGKGYQLTHSLI
FT                   AFGRGEIFGQGLGSSVEKLHYLPEAHTDFLLAVIGEELGLVGVVAVILAFFWMVRRIFM
FT                   IGRQAIALDRVFAGLTAQGIGVWIGGQAFINMGVNLGVLPTKGLTLPLMSYGGSAIVLS
FT                   VIALAVVLRVDIENRQLMRGAKA"
FT   gene            568137..569249
FT                   /locus_tag="Lcho_0522"
FT   CDS_pept        568137..569249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0522"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: mpt:Mpe_A0462
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32797"
FT                   /db_xref="GOA:B1XYR3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR3"
FT                   /protein_id="ACB32797.1"
FT                   /translation="MSRHLVIMAAGTGGHIMPGLAVAQEMSRRGWSVSWLGTQAGMENR
FT                   LVPPSGIPLDRVAFAGLRGKGLLGNLRGGLQLLWAFWQCLSILRRRSASAVLGMGGYVC
FT                   FPGGLMAKLLRRPLVLVNADAGLLLSNRALLRWADRLAFGFDGDAARAVPQGVVTGNPV
FT                   RAEIEALPAPAQRYAGRSGPLKILVVGGSLGAQVLNENIPRALARLSAAERPQVVHQTG
FT                   VAHLARVREAYVQSGLPDGRQPGQGVELLPFIDDMPRRLAECDLIICRAGAVTVSELCA
FT                   GGIASVLVPLVVSTTAHQRDNAIWMQHQRAAIHLPQAELTPERLADLLRQLDRTGLQAL
FT                   AQRAHALAQPHAAQRVADEIEALTPMKDVA"
FT   sig_peptide     568137..568208
FT                   /locus_tag="Lcho_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            569246..570655
FT                   /locus_tag="Lcho_0523"
FT   CDS_pept        569246..570655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0523"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: mpt:Mpe_A0463
FT                   UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32798"
FT                   /db_xref="GOA:B1XYR4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYR4"
FT                   /protein_id="ACB32798.1"
FT                   /translation="MKHAVKHIHFVGVGGAGMSGIAEILHNLGYTVSGSDQADGAVTRR
FT                   LAELGIRIFVGHDAAHIAGAQAVVTSTAVKGDNPEVIAARAARIPVVPRAVMLAELMRL
FT                   KSGIAIAGTHGKTTTTSLVTSVLAEAGLDPTFVIGGKLNSAGANSALGKGDYIVVEADE
FT                   SDASFLNLLPVLSVITNIDADHMDTYGHDFARLKQAFVEFLHKMPFYGAAILCGDDPGV
FT                   RSIIPMISRPVITYGLGEDVQVRAVDVVALPGGQMRFTCQRRNGTVLPDLEITLNLPGV
FT                   HSVRNALATIAVATELELPDAPIVSALAKFSGVGRRFQRWGDWPCAAGGEFTLIDDYGH
FT                   HPVEMAAVIAAARGAFPGRRLVLAFQPHRYTRTRDCFEDFVKVMGSADAILLTEVYAAG
FT                   EAPIVAADGRSLTRALRVAGKVDPLFVDDVNELPATIAEQALAGDVVIAMGAGTIGGVP
FT                   ARVVELVKERA"
FT   gene            570652..571641
FT                   /locus_tag="Lcho_0524"
FT   CDS_pept        570652..571641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0524"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: mpt:Mpe_A0464 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine--D-alanine ligase; PFAM: protein of
FT                   unknown function DUF201; D-alanine--D-alanine ligase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32799"
FT                   /db_xref="GOA:B1XYR5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR5"
FT                   /protein_id="ACB32799.1"
FT                   /translation="MSAVDVKALGRVAVLMGGSSAEREISLMSGAGVLQALLSQGVDAH
FT                   AFDPAERELAELKHEGYARCFIALHGRHGEDGTVQGALELLGIPYTGSGVMASAIAMDK
FT                   VMTKRIWLAEGLPTPRYVWLASDDQGAERVGRVSAELGLPLIVKPPREGSSIGVTKVVE
FT                   AAQVGAAVALSAGYDADVLCEAFIEGEELTCPVLGEGAHAVALPVIRIVPPAAGYDYQN
FT                   KYFTDEVQYLCPSGLSAELEREIQRITLASYRALGCRGWGRADLMLRAGDQQPFLLEMN
FT                   TSPGMTGHSLVPMSARASGISYEALCLQLLAAARLDNPAPAPLSSAGG"
FT   gene            571669..572472
FT                   /locus_tag="Lcho_0525"
FT   CDS_pept        571669..572472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0525"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   FtsQ-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein FtsQ-type; KEGG: mpt:Mpe_A0465 cell division
FT                   protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32800"
FT                   /db_xref="GOA:B1XYR6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR6"
FT                   /protein_id="ACB32800.1"
FT                   /translation="MARALQTPSSLPFDVRLMHAGAQLLLVLALLAVLASALAWVARSP
FT                   VFSLRQIRIEGDVTHSSAATIRSHAVPQLAGSYFSLNLREARQAFETVPWVRHAQVRRV
FT                   WPHQLLVTLEEHRPVAYWERADADPLLVNSHGEVFEVNLGDVEDEALPVLRGPNGSAAQ
FT                   VWAMWQRLAPEFELLGARMLRLALSDGGSWQARLDKAQAVIELGRGEPEEVLQRTRRFT
FT                   HSVTEISARYENRLIEYADLRHSDSYALRLVGMGTIEPTQLRKGR"
FT   sig_peptide     571669..571788
FT                   /locus_tag="Lcho_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.455 at
FT                   residue 40"
FT   gene            572509..573735
FT                   /locus_tag="Lcho_0526"
FT   CDS_pept        572509..573735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0526"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   mpt:Mpe_A0466 putative cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32801"
FT                   /db_xref="GOA:B1XYR7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR7"
FT                   /protein_id="ACB32801.1"
FT                   /translation="MAKEYKDLIVGLDIGTAKVMAVVAEVQADGELRLAGLGVATSHGL
FT                   KRGVVVNIDATVQSIQQALKEAEMMADCKIGRVYTGITGSHVRGQNSTGMVIVRDKEVT
FT                   PLDVARVVETAKAINIPNDQRLLLVEPQEFVIDGHEVKEPVGMSGGRLEVKVHIVTGSQ
FT                   SAAENIIKCVRRCGLEVDALVLNPSASSLAVLTADERDLGVALVDIGAGTTDVAIFTDG
FT                   SIRHTAVIPIAGDLITSDIAMALRTPTKDAEEIKVEYGVAKQLLADPSEQLEVPGLGDR
FT                   APRLLSRQALAGVIEPRVEEIFSLVHQVIRESGYEELLSSGIVLTGGSAVMPGMVELAE
FT                   DIFLKPVRKGLPLYGGALYDMVANPRSATAMGLLEEARVARNRGMKAAQSGSGVGLIGR
FT                   AKDWFLKSF"
FT   gene            573889..575106
FT                   /locus_tag="Lcho_0527"
FT   CDS_pept        573889..575106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0527"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   mpt:Mpe_A0467 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32802"
FT                   /db_xref="GOA:B1XYR8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR8"
FT                   /protein_id="ACB32802.1"
FT                   /translation="MGIEMIEEFDMGTQIKVIGVGGGGGNAVDHMIGQGVQGVEFICAN
FT                   TDAQALNRSQAHSLLQLGHTGLGAGSRPDAGKAAAEEAQDRIKQSLQGAHMVFITAGMG
FT                   GGTGTGAAPVIARIAKEMGILTVGVVTKPFEFEGNRRMKQADAGLAELEANVDSLIVVL
FT                   NEKLLDVLGDDVTQEEAFAEANDVLKNAVGGISDIIHIPGLVNVDFEDVKTVMSEPGKA
FT                   MMGTATASGPDRATKAAEAAVACPLLEGIDLSGARGVLVLIAANKQTFKLAESRNAMTT
FT                   IRRYAADDAHVIFGTAYDESLGDALRVTVIATGLAPARRAAAQIQMVQPPMVQQRTGTD
FT                   NIPVLTQPVSAPAHAVASPVGLGQDYTVPSVWRTNRTQAAAKVDALVNNGMEEIEIPAF
FT                   LRKQAD"
FT   gene            575241..576176
FT                   /locus_tag="Lcho_0528"
FT   CDS_pept        575241..576176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0528"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: mpt:Mpe_A0468 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32803"
FT                   /db_xref="GOA:B1XYR9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYR9"
FT                   /protein_id="ACB32803.1"
FT                   /translation="MLKQRTLKSLTRAVGVGLHSGKKVELTLRPAPPDTGIVFRRIDLP
FT                   QPVDIPVRAEAVCDARMATTLSPGGDPGAPKVNTVEHLMSACCGLGLDNLYIDITAEEV
FT                   PILDGSAASFVFLLQSAGIELQNAPKRFLRVLKPVEVRQGEGDRLVWSRLEPHHGYKLT
FT                   FEIDFAHPAVDQTGQRVVFDMGSGQYKRDIARARTFGFTKDLELMRSRGLTLGGSMDNA
FT                   IVVDDYRVLNAEGLRYDDEFVKHKILDAIGDLYLCGMPLLASYTAFKSGHAMNNRLLRA
FT                   LLADPTAWEIVTFEDEKLAPQGMAELAPAW"
FT   gene            576199..576372
FT                   /locus_tag="Lcho_0529"
FT   CDS_pept        576199..576372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32804"
FT                   /db_xref="GOA:B1XYS0"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS0"
FT                   /protein_id="ACB32804.1"
FT                   /translation="MLIFRALVLLLLVAALLCMGMYLGTGQVVWRRRSVAIIRWSVIAG
FT                   LAFIGVLLLERI"
FT   sig_peptide     576199..576273
FT                   /locus_tag="Lcho_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.667 at
FT                   residue 25"
FT   gene            complement(576416..578770)
FT                   /locus_tag="Lcho_0530"
FT   CDS_pept        complement(576416..578770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0530"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: xcv:XCV1929 putative C-di-GMP
FT                   phosphodiesterase or signal transduction protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32805"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS1"
FT                   /protein_id="ACB32805.1"
FT                   /translation="MPRPAEEIRSDAVPAMSHPPDDPPASGRTGSPTPRTDRSALLPAL
FT                   TRLFDDGPCAALVCGADGRITEVSDSCGRWLGLAAADLLGRRPEQVLAGPGATIPGWER
FT                   LQDQARRHGRAGTEALVHGHGGRPLWCTLVLDALPAAQGEPDTWLLTLADITQQRILTE
FT                   LQGPVLGALVRDRPLAEVMALVCTQVQILAPDVVATVLGVDDDGLIRPLAGPSIPAEVS
FT                   CQFDGAPIGPKAGSCGTAAWRGSPVVVTDIDTDPLWDDYRHVVQPLGLRACWSSPIKNG
FT                   EGRVLATFAFYFREPRAPHGLHEQLVEMSVHLCTLALERERSHAHIHQLAYYDGLTGLP
FT                   NRALLQANLARAITQAQQDGTTLALLFIDLDRFKDVNDSHGHAVGDELLREVAQRLAGE
FT                   VRDRSLVCRLAGDEFVVVLPHCGVEQARHTAERVQQALARPITVGDLDLTTGACLGVAM
FT                   YPDDGSDLDRLLRHADAAMYQAKKDGRGGLHFYRAEMNRAAEDRLRLAADLRAALHRGG
FT                   LQLHFQPQVCPPGKTPRSPAAGPASMSLFGVEALLRWRHPVLGDVSPERFIPVAEEAGL
FT                   MDELSNWVLEAACAQLAGWRADGIDVPRVAVNLSPRNFQDPGLPARVRQLLDRHGLRGD
FT                   QLTLELTESAWIDRRADSLDKLRALQALGVGLAMDDFGNGQSSLSHLHRLPLRQLKLDR
FT                   SFVHDIEHLAVAQTLAAAMLHIGESLGLIVVAEGIETAAQAAFLIEHGCPVLQGDRYAQ
FT                   SMAAEQIGPWLAGLASMAAADVGASRSDHGT"
FT   gene            complement(578838..579389)
FT                   /locus_tag="Lcho_0531"
FT   CDS_pept        complement(578838..579389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0531"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: mpt:Mpe_A0482 putative Holliday junction
FT                   endodeoxyribonuclease protein; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32806"
FT                   /db_xref="GOA:B1XYS2"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS2"
FT                   /protein_id="ACB32806.1"
FT                   /translation="MTRILGIDPGLATTGFGVIDVEGQALRYVASGTVHTREADIGDLP
FT                   GRIKLIFEGVREVMATYQPTCASIEIVFVNVNPQSTLLLGQARGAALAALVTGGLAVTE
FT                   YTALQMKKAVVGSGHARKEQVQEMVMRLLQLPGRPNQDASDALGLAITHAHAGGSFAAI
FT                   EQATTLQRRQHAHYRGGRIF"
FT   gene            complement(579463..581070)
FT                   /locus_tag="Lcho_0532"
FT   CDS_pept        complement(579463..581070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0532"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: mpt:Mpe_A0485 IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32807"
FT                   /db_xref="GOA:B1XYS3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS3"
FT                   /protein_id="ACB32807.1"
FT                   /translation="MPTALISVSDKTGIVELAQALHATGVKLLSTGGTAKLLADAGLPV
FT                   TEVAEHTGFPEMLDGRVKTLHPKIHGGLLARRDLPEHMAALAAHGIETIDLLIVNLYPF
FT                   EATVAKAGCTLDDAIENIDIGGPAMVRSAAKNWKDVAVLTDASQYAGVIAELQQAGTVS
FT                   RATRFALSVAAFNRISNYDAAISDYLSSITDGGAGDGDAAPARIEFPGQSNGRFVKLQD
FT                   LRYGENPHQAAAFYRDLYPAPGSLVSAVQLQGKELSYNNIADADAAWECVKSFDTPACV
FT                   IVKHANPCGVALGADAGAAYAKAFKTDPTSAFGGIIAFNTVVDKTAAEQVAKQFVEVLI
FT                   APAYTDEARAIFAAKANTRVLLIDLSQVQRDGASAWARGQNAHDIKRIGSGLLIQSADN
FT                   HVLKREDLKIVTKLAPTAQQIDDLMFAWSVAKFVKSNAIVFCSGGMTVGVGAGQMSRLD
FT                   SARIASIKAGHAGLTLAGSAVASDAFFPFRDGLDVVADAGATCVIQPGGSMRDQEVIDA
FT                   ANERGIAMVYTGVRHFRH"
FT   gene            complement(581142..581378)
FT                   /locus_tag="Lcho_0533"
FT   CDS_pept        complement(581142..581378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0533"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: pol:Bpro_1131
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32808"
FT                   /db_xref="GOA:B1XYS4"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS4"
FT                   /protein_id="ACB32808.1"
FT                   /translation="MSSPPIDASIRDNLEVYFQDLEGTEPHALYDMVLKAVERPLLDVV
FT                   MQKADGNQSRAAEWLGINRNTLRRKLLEHKLID"
FT   gene            complement(581375..582415)
FT                   /locus_tag="Lcho_0534"
FT   CDS_pept        complement(581375..582415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0534"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: mpt:Mpe_A0486 tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32809"
FT                   /db_xref="GOA:B1XYS5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS5"
FT                   /protein_id="ACB32809.1"
FT                   /translation="MQIGPHLLPNRLFVAPMAGVTDRPFRQLCKRLGAGYAVSEMVTSR
FT                   PELRDSLKTSRRLDHTGEVAPIAVQIAGTEPEMMAEAARYNIERGAQIIDINMGCPAKK
FT                   VCNVWAGSALMQNESLALRIIDAVVAASAPHGVPVTLKMRTGWCQEQKNALQIARAAQD
FT                   AGIAMVTVHGRTREQGYKGEAEYRTIAAVKAALQIPVVANGDIDSPEKAARVLRATGAD
FT                   AVMIGRAAQGRPWIFREIAHHLATGQAMDAPRTLQVRDWLLEHLQDHYSLYGERSGVRT
FT                   ARKHIGWAVHALPGGAHFRAEMNRIETTADQWRAVDDYLSDLADAHERWPQAAAEPTTI
FT                   EETLAA"
FT   gene            582521..583003
FT                   /locus_tag="Lcho_0535"
FT   CDS_pept        582521..583003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0535"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: mpt:Mpe_A0487 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32810"
FT                   /db_xref="GOA:B1XYS6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS6"
FT                   /protein_id="ACB32810.1"
FT                   /translation="MDAWISSLLAALALPEYGLSTLFMVATLSATLLPMGSEPVLFGLV
FT                   KLNPGLFWPAIAVATAGNTLGGAISWWMGYGAEKAYEKITHHSAEHRALAILRRFGPKA
FT                   CLLAWLPVVGDPLCAVAGWLQLPFWPCVAYMAIGKLLRYITMTAALLWVFPGQWPL"
FT   gene            583104..584618
FT                   /locus_tag="Lcho_0536"
FT   CDS_pept        583104..584618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0536"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: azo:azo3546 probable
FT                   carboxypeptidase TAQ"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32811"
FT                   /db_xref="GOA:B1XYS7"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS7"
FT                   /protein_id="ACB32811.1"
FT                   /translation="MTDPNRPAAGATPAYSELEQRHARIYRFEHLGSIVGWDQAANMPP
FT                   KGNEARAAAMAELDTLLHGLRTDAWLRDLLQRAEDEPLSDWQRANLREMRRDWRASNAL
FT                   PARLVEQRTLATARCEHAWRRQRPANDWAGFVENFRPVLRVAREEAQCLSQETGLAPYD
FT                   ALMDRYEPGMTSAEVERVFGDLKTWLPDLVRKVQERQRDEPVLLPQGPFARPAQKAISL
FT                   AMMQRLDFDFDAGRLDESTHPFSGGVPEDVRLTTRYLDHDLHQSLMGTVHETGHARYEQ
FT                   NLPRSWLGQPIARARSYGIHESQSLSFEMQLGAHPGFVRMLVPMLVDHFGAQPAFEVDN
FT                   LCRLMTRVKPGFIRVDADELTYPAHVILRFEIERALIEGGLEVEDIPALWDAKMADYLG
FT                   VDTRGNFADGPMQDVHWPSGAFGYFPCYTLGAMYAAQWFAAMRRATPDLDAQIEAGNLK
FT                   PVFDWLSQNIWQQASRWETPELALRASGERLNPAHYRAHLEQRYLG"
FT   gene            complement(584714..586636)
FT                   /locus_tag="Lcho_0537"
FT   CDS_pept        complement(584714..586636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_1046 protein of unknown function
FT                   DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32812"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS8"
FT                   /protein_id="ACB32812.1"
FT                   /translation="MKPAPTRLRPLCVLLVWLPLGPALAQEREKPREFLDSLADNALAP
FT                   DRNAIYRRDGKRREIDLGDGIEASLDEAKASFLSNPRGTPGGAGVVSRVIGISARKPSY
FT                   GYDLSYGRSALGRRAGLSGGWRLGERVVLYADVHENRSEIDDLPGTPSTRLRRRDSEFG
FT                   LRWRSADGSTSTWTTDLALHQSRLAPDPASALVPEATGEQLVWRGRLEPASWPGLSLMA
FT                   QLNHVLGREPAPSTELSGHRIGLGADWRLADGWGPLPAGSLLAWRESPRLGLLGDDEAL
FT                   TLPAAYRRSIGLELPDGSGRGHVYTQLRHRSLADRDDALGVLGWQRNWAPWPRWGLDTQ
FT                   LEQAVPLAGRYPIRATQAGGRLSTSRFPRLSFSTALDLVNASTSDSAYHEIKLTQRLAD
FT                   DWLGALRLSVSRSQPHGNSAAGSTDYKGALALGWREPQARALHLLSRMTWSGREVDAGV
FT                   PASTSADRRARIWLGHAGYLFDDHHTLTVRLSHRTARDETRLDGNGLVLPHRTQFWLTR
FT                   WIWEQDREGDQRWSLSAHVAGRSDNLDGAARAWGAELGYRVSSKAALTLGYNPRGFADN
FT                   EITVEERPRKGFTLRLRFTIEGALARWLDNGRSGTATPWSLPDNPPAGLAPSLDRAQEQ
FT                   SAAGF"
FT   sig_peptide     complement(586559..586636)
FT                   /locus_tag="Lcho_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(586655..586942)
FT                   /locus_tag="Lcho_0538"
FT   CDS_pept        complement(586655..586942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32813"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYS9"
FT                   /protein_id="ACB32813.1"
FT                   /translation="MKLHHRLGLLLCAAGFTLTAWAQGTPAEVVKVDKGQGKLTLKHGP
FT                   IQNLDMPAMSMVFRVQDQQWLDQLKAGDKIRFDAEKLNGQYTVTRLSVQR"
FT   sig_peptide     complement(586874..586942)
FT                   /locus_tag="Lcho_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            587111..588022
FT                   /locus_tag="Lcho_0539"
FT   CDS_pept        587111..588022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0539"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: mpt:Mpe_A0499 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32814"
FT                   /db_xref="GOA:B1XYT0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT0"
FT                   /protein_id="ACB32814.1"
FT                   /translation="MSAPTDTSPDLSHIAARDKAEILAQALPYIRKYHGKTLVIKYGGN
FT                   AMTDPALQADFAEDVVLLKLVGMNPIVVHGGGPQIDEALNRLGKKGTFIQGMRVTDEET
FT                   MEVVEWVLGGEVQQDIVGLINAAGGKAVGLTGRDGGLIRARKMKLLDRDDPNKEHDIGQ
FT                   VGEIESIDPSVVKALQDDAFIPVISPIGFGTHNESYNINADLVASKLAEVLKAEKLVML
FT                   TNIRGVLDKAGDLLTDLTAKRIDELFADGTISGGMLPKIAGALDAAKSGVNAVHIVDGR
FT                   VPHVLLLEILTDQAYGTMIRSH"
FT   gene            588092..588661
FT                   /locus_tag="Lcho_0540"
FT   CDS_pept        588092..588661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0540"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   hha:Hhal_1924 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32815"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT1"
FT                   /protein_id="ACB32815.1"
FT                   /translation="MGLPQPAPRFDRAEYFGWEEQQADKHEFIAGEVFAMVGARQEHVL
FT                   VAGALFARFREHLRGTRCRAYTSDMKLEVEAADAVFYPDVMVSCDEDDRQRAMALRAPL
FT                   LIVEVLSDSTAAFDRGAKFAAYRRLASLQEYLLVDVEARRLELFRREPVGWVLHEPEGE
FT                   GDAATLRLAGIGLDLTALDAFGDLQA"
FT   gene            588672..589373
FT                   /locus_tag="Lcho_0541"
FT   CDS_pept        588672..589373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0541"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: mpt:Mpe_A0500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32816"
FT                   /db_xref="GOA:B1XYT2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT2"
FT                   /protein_id="ACB32816.1"
FT                   /translation="MKSGTPVWLFDLDNTLHNASAGAFPMINRAMTEYIERELVVDRDE
FT                   AYRLRGHYWQRYGATMLGLMRHHGVKAPHFLHHTHLLPGLEAHLQVHPHDVAALTRLPG
FT                   AKYVLTNAPQAYAERVLGELGLARVFDGVIAIDQMRMFGHWRPKPDARMFKAIAVRLGV
FT                   APGRCVLVEDTLEHQKAARRIGMRTVWMQRWVRRHAHGPEVGVRLMRKPAYVCDRIRSL
FT                   LALQRLCRPPL"
FT   gene            589373..590017
FT                   /locus_tag="Lcho_0542"
FT   CDS_pept        589373..590017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0542"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mpt:Mpe_A0501
FT                   nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32817"
FT                   /db_xref="GOA:B1XYT3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT3"
FT                   /protein_id="ACB32817.1"
FT                   /translation="MTEHVSEATVPEPDTAVLAPVRKRPKPGERRVQILQTLAHMLEQP
FT                   GAERITTAALAAQLEVSEAALYRHFASKAQMFEGLIEFIETSVFTLINQISERETDPQV
FT                   QASRCLTVLLQFAEKNPGMTRVMVGDALVFENDRLLSRMNQFFERIESQLRQSLRALAE
FT                   LRGSVTPSVDATAQASVLTSFAVGRLQRYARSGFRRSPTEHLDAALHLLLA"
FT   gene            590059..590991
FT                   /locus_tag="Lcho_0543"
FT   CDS_pept        590059..590991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0543"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; KEGG:
FT                   ajs:Ajs_0798 protein of unknown function DUF815"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32818"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT4"
FT                   /protein_id="ACB32818.1"
FT                   /translation="MPDFDTLIGRAEALLARLETVLPHPLAAPDWSASIAFRYRRRSAG
FT                   FGSGGLLEPVRHIAPLRLDALKEIDGQKERLLRNTEQFVHGRTANNVLLTGAKGTGKSS
FT                   LIKACLNELAPQGLRLIEVDKADLIDLPDLVDLVAGRPERFIIYCDDLSFDEGEPGYKA
FT                   LKSILDGTVAQSGDNVLVYATSNRRHLLPERMADNLAATYTDEGEMHPGEAVEEKISLS
FT                   ERFGLWISFYPFSQREYLAIVAQWLGHFGLDQPAIDAARPLALVWALERGSRSGRVAYQ
FT                   FARDHAGRDVHAEAPTPIANYVRGTPNHG"
FT   gene            590984..591484
FT                   /locus_tag="Lcho_0544"
FT   CDS_pept        590984..591484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0544"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rfr:Rfer_2908 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32819"
FT                   /db_xref="GOA:B1XYT5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT5"
FT                   /protein_id="ACB32819.1"
FT                   /translation="MAEPTLVVPGAEGLATRRPVDVAVGVLIERDAAGVEGRFLLTSRP
FT                   ADKVYAGYWEFPGGKLEAGETVGEALRRELHEELGITIGAVQPWQQIEVDYPHARVRLH
FT                   FCKVYAWQGEFEMREQQSMAWQTLPVAVVPVLPGTVPVLRWLADERGHVGPTHADSPAE
FT                   VPA"
FT   gene            complement(591501..591707)
FT                   /locus_tag="Lcho_0545"
FT   CDS_pept        complement(591501..591707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0545"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   ajs:Ajs_0800 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32820"
FT                   /db_xref="GOA:B1XYT6"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT6"
FT                   /protein_id="ACB32820.1"
FT                   /translation="MNTPTPPAGERPAPTVPCPTCKRPTVYRRDNPWRPFCSERCKRID
FT                   IGAWASEDYRVAAPPPAPDDEPG"
FT   gene            complement(591740..592495)
FT                   /locus_tag="Lcho_0546"
FT   CDS_pept        complement(591740..592495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0546"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   mpt:Mpe_A0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32821"
FT                   /db_xref="GOA:B1XYT7"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT7"
FT                   /protein_id="ACB32821.1"
FT                   /translation="MIHYEYPLNETVRTLLRLEHLFARMGQLLARDAPLDHHYTLATLF
FT                   EIMDVTSRVDLKVDLLQELDRQRQQLAGYRGNPSISESALDMAIRRIELAHQRLNHVAG
FT                   KAGQALTANDWLMSIRSRMSIPGGTCEFDLPAYFAWQQESAAHRRTDLQRWISTLDPMA
FT                   QALAVCLSLLRESGTVQTVAVRGGQFQQSLVGSRNFQLARLRIARSHALVPEISGNRLL
FT                   LAVRMMRPDAEYRLKHAIVDFSMELTLCA"
FT   gene            complement(592576..593190)
FT                   /locus_tag="Lcho_0547"
FT   CDS_pept        complement(592576..593190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0547"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: mpt:Mpe_A0506 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32822"
FT                   /db_xref="GOA:B1XYT8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT8"
FT                   /protein_id="ACB32822.1"
FT                   /translation="MPEHRLRIGLTGGIGSGKSTVAAMLAALGAHVIDTDALAHGLTAP
FT                   GGAAIAAITARFGAGMITPDGALDRARMRERVFADPAAKSALEQILHPMIGHLTEARAS
FT                   AAAPGQVLVFDVPLLVESGRWRERVDRVLVVDCSPETQIARVTQRNGWPPEQVRAVIAA
FT                   QAGREVRRAAADAVILNDGIDLAELRRQVGEIWQRWVGSPG"
FT   gene            complement(593202..594149)
FT                   /locus_tag="Lcho_0548"
FT   CDS_pept        complement(593202..594149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0548"
FT                   /product="peptidase A24A domain protein"
FT                   /note="PFAM: peptidase A24A prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: mpt:Mpe_A0507 signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32823"
FT                   /db_xref="GOA:B1XYT9"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYT9"
FT                   /protein_id="ACB32823.1"
FT                   /translation="MDFVELSSLTFLLSVPALAVIGLCIGSFLNVVVHRLPLMLERQWL
FT                   GDVQAMLQDSAGLQRTLGAGIDAAAVQHLHDGGERLGSALASLPALSLSRPRSRCPACG
FT                   TQLGWHHNLPILSWLALRGRCAACRAPISRRYPLVEAGTALAFGLIGWVFGPTATSVVY
FT                   CVAAALLIAMALIDLDTTLLPDSLTYALLGLGLFSAWMGWTPLRLEDAALGVLFGYGSL
FT                   WALTTLYALLRGVRGMAEGDFKLLAALGALLGVAQLLPIVLLASLVGAAVGIFLVLARG
FT                   HQREVPIPFGPYLAGGGLAAMFFGPQLLRWWLPV"
FT   sig_peptide     complement(594090..594149)
FT                   /locus_tag="Lcho_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.864 at
FT                   residue 20"
FT   gene            complement(594158..595384)
FT                   /locus_tag="Lcho_0549"
FT   CDS_pept        complement(594158..595384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0549"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   mpt:Mpe_A0508 pilus tip-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32824"
FT                   /db_xref="GOA:B1XYU0"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU0"
FT                   /protein_id="ACB32824.1"
FT                   /translation="MATAAAVAAKKIKDFVFEWEGRDRNGKAVRGEMRAGGEAMVSASL
FT                   RRQGIMVVKVKKRRISGGKSIKGKDIAVFTRQLATMLKAGVPLLQAFDIVARGSSNPRL
FT                   TRMLTDIRGDVETGTSLSAAFRRHPLQFDALYCNLVEAGESAGILETLLDRLANYQEKT
FT                   IELQNKIRSALIYPVAVLVVAFIVVAVIMIFVIPSFKDIFKSFGADLPLPTLIVIAMSE
FT                   FFVQYWFAIFGGIGLAVYMTIQSWRRSERMQMALDRFMLKVPIFGQLVHKAAVARWART
FT                   LSTMFAAGVPLVEALDSVGGAAGNAVFAQATEQIQRDVSTGAALTSSMQATNIFPNMVL
FT                   QMSSIGEESGSLDQMLSKVADFYEQEVDEAVKGLSTLMEPIIIVVLGTIIGGIVVSMYL
FT                   PIFKLGQVV"
FT   gene            complement(595435..597159)
FT                   /locus_tag="Lcho_0550"
FT   CDS_pept        complement(595435..597159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0550"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="KEGG: mpt:Mpe_A0509 pilus biogenesis ATPase;
FT                   TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM: type
FT                   II secretion system protein E; General secretory system II
FT                   protein E domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32825"
FT                   /db_xref="GOA:B1XYU1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU1"
FT                   /protein_id="ACB32825.1"
FT                   /translation="MAAETLSDAPQSTLSGVARVLVHAGKLNARAAEELARLARDQRRN
FT                   FVAAAVGANLLSSADLAHTLSHALAVPLLDLDAVDVSKLPQNLVDARTLSQYQVLVLGK
FT                   RGNRLFIGGADPTDQEAVDRIKFATQLTPEWVIVEYDKLAKIVEAKSTSATEALESIVA
FT                   GDFEFDVEEQDPNAKPDEEVTTDVEDAPVVRFLQKMLIDAINMRASDLHFEPYEQTYRV
FT                   RFRIDGELREITQPPVAIKDKLASRIKVISRLDIAEKRVPQDGRMKLKFGNKAIDFRIS
FT                   TLPTLFGEKIVIRILDPSSAKLGVEALGYEREEKDRLLSAIKRPYGMILVTGPTGSGKT
FT                   VSLYTCLNILNQPGVNISTVEDPAEINLPGINQVNVNDKAGMNFAVALRAFLRQDPDVI
FT                   MVGEIRDIETADIAIKAAQTGHLVLSTLHTNDAPTTLTRLLNMGVPPFNIASSIILISA
FT                   QRLCRRLCENCKAPAEYPREALLRAGFKPDEVDGSWKPYKAVGCSACNNGYRGRVGVYQ
FT                   VMPITEAIQRVILAEGTALDIAEQAARDGVRDLRLSGLVKVRAGATTLEEVISVTNQ"
FT   gene            597526..599430
FT                   /locus_tag="Lcho_0551"
FT   CDS_pept        597526..599430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0551"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: mpt:Mpe_A3161 heat shock
FT                   protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32826"
FT                   /db_xref="GOA:B1XYU2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU2"
FT                   /protein_id="ACB32826.1"
FT                   /translation="MEKQTLSFQAEVKQLLHLVTHSLYSNKEIFLRELVSNASDACDKL
FT                   RFEALNNNALFEDAPNLEVRISYDRAARRIVISDNGIGLSAAEAIEHLGTIAKSGTKEF
FT                   MSRLEGEQAKDANLIGQFGVGFYSGYIVADRITVESRRAGLAISEGVRWSSEGTGDFEV
FT                   ETITREARGTDVILHLREDEDEFLSTWKLKSIISKYSDHISLPVLMRKETWDAEKGENV
FT                   ISDEWEPVNKAAALWSRSKSEITDAEYKSFYEQLTYDQTPPLAYTHNRVEGRNEYTQLL
FT                   YIPAKAPMDMWNRDKRGGVKLYVKRVFIMDDAEALMPVYLRFVKGVIDSADLPLNVSRE
FT                   LLQESRGVKAIREGSTKRVLSMLESLADSQDETSAAADKAKYAEFYKEFGSVLKEGIGE
FT                   DHANQERLAKLLRFASTHADEGVSFADYVARMKEGQEVIYYITGDTLAAAKNSPQLEIF
FT                   KKKGIEVLLFTDRVDEWMLSHLYEFEGKNLQSVAKGAVDLGKLQDEEEKKHAEEAAVGF
FT                   KPTLDRLKKSLEGRAKDVRVTTRLVDSPACLVAEEGDMSGHLARLLKQAGHAAPASKPV
FT                   LEVNAEHPLVRKLAAIGDGEARFDDLAQVLFDNALLAEGGQLEDPAAHVKRIQALILG"
FT   gene            complement(599447..600529)
FT                   /locus_tag="Lcho_0552"
FT   CDS_pept        complement(599447..600529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0552"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mpt:Mpe_A3160 predicted kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32827"
FT                   /db_xref="GOA:B1XYU3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU3"
FT                   /protein_id="ACB32827.1"
FT                   /translation="MNDIAPDDLPPAYRLPAPQQATDEQPYAGLTPYAVLDALDAAGLR
FT                   GDGRILQLNSYENRVFQVHLEDERVVVAKFYRAARWSDAQILEEHQFALELAAAEVPAV
FT                   PPLVLAAGLGIEPAPRLLGTPPTLADWQGWRYAASPRCGGRAPELDDPAVLEWIGRFLA
FT                   RLHLVGQARPFEHRLRLDGSRIARAAVAWLCDQDLLPPDALAGWRQASLAALDQVDELF
FT                   TRAGNLQLLRVHGDCHAGNVLWTDAGPHFVDLDDAVTGPAVQDLWMLLGGERHEMQTQL
FT                   GALLDGYETLREFDRRELGLIEALRTLRIINHSAWIARRWRDPAFPIAFPSFESPSYWA
FT                   QQTTVLHEQIGAMQGPALVA"
FT   gene            complement(600561..601370)
FT                   /locus_tag="Lcho_0553"
FT   CDS_pept        complement(600561..601370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32828"
FT                   /db_xref="GOA:B1XYU4"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU4"
FT                   /protein_id="ACB32828.1"
FT                   /translation="MPNNVWIIAVVAIIAMLSLALLALQRSRQASPVRDELPTEWPLAQ
FT                   RPIFSPEERALYRQLRAALPHHTVLAKLPLVRFCQPQDRNELRYWFNLLGPLHVSFVVC
FT                   ADNGRVLAAIDIERPSRPASKRAATIKQSVLEACRVRYVKCRTDQLPSAAELQMLVPHQ
FT                   SESSRPMVPGTLRDSQERRSTLAHAMRGRSADSQTQWYESGFAQDSFFAPETQRDPFAD
FT                   DGPAATGATQRPAPRPSSSWAGGRGPIRRSEDFGPSGDAAGHIIGRV"
FT   sig_peptide     complement(601278..601370)
FT                   /locus_tag="Lcho_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.526 at
FT                   residue 31"
FT   gene            complement(601622..602323)
FT                   /locus_tag="Lcho_0554"
FT   CDS_pept        complement(601622..602323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0554"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mpt:Mpe_A3158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32829"
FT                   /db_xref="GOA:B1XYU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU5"
FT                   /protein_id="ACB32829.1"
FT                   /translation="MKLSPTPSSTGSAVNPRPRSRVWRWLPIRRLSQRHRMRVLRHLLS
FT                   LSERDRYLRFGYPASDERIEKYVETLDFQRSELFGIFDRRLELVAISQLAYAEPVEGDT
FT                   NGAMVEFAVSVRSHARGRGYGDRLFSHALRHARNRSIDRLMIHALSENTAMLRIARKAG
FT                   AEVRREGSESEAWLQLPPHSLASRVEELVADRVSALNYRVKLHARQVGWVLAVVNEIKH
FT                   QISRRRHVASQ"
FT   gene            complement(602524..603075)
FT                   /locus_tag="Lcho_0555"
FT   CDS_pept        complement(602524..603075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0555"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: mpt:Mpe_A0111 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32830"
FT                   /db_xref="GOA:B1XYU6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU6"
FT                   /protein_id="ACB32830.1"
FT                   /translation="MASVNKVILIGNLGRDPEVRYTPSGAAVCNVSVATTRNWKSKDGG
FT                   ERQEETEWHRVVFYDRLAEIAGEYLRKGRPVYVEGRLKTRKWQDKEGRDQYTTEIVADQ
FT                   MQLLGGRESGGGGGGEMGAEEEMGGGGGRGGSSGGGYRREAPEGRAAPAPRASAPRAPA
FT                   PAPAPKSSTGFDDMDDDIPF"
FT   gene            603234..605213
FT                   /locus_tag="Lcho_0556"
FT   CDS_pept        603234..605213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0556"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: mpt:Mpe_A0108 putative ATP-dependent DNA
FT                   helicase protein; TIGRFAM: ATP-dependent DNA helicase, RecQ
FT                   family; ATP-dependent DNA helicase RecQ; PFAM: helicase
FT                   domain protein; HRDC domain protein; DEAD/DEAH box helicase
FT                   domain protein; Helicase superfamily 1 and 2 ATP-binding;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32831"
FT                   /db_xref="GOA:B1XYU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU7"
FT                   /protein_id="ACB32831.1"
FT                   /translation="MTPPIPHDASPALQVLGEVFGYSAFRGQQQAIIEHVVAGGDALVL
FT                   MPTGGGKSLCYQVPAIVRQRAGQGVAVVVSPLIALMHDQVGALEEVGVHASFLNSTLDN
FT                   AQAQAIERELLSGRLTMLYVAPERLLTPRLQGMLASLHERGRLSLFAIDEAHCVSQWGH
FT                   DFREDYLQLSVLHEQFPGVPRIALTATADDHTRADIVERLQLQDARLFVSSFDRPNIRY
FT                   TLVEKVKPRDQLLRFIRDEHEGEAGIVYCGSRKKVEETASWLAEQGVDALPYHAGLDAE
FT                   VRRRHQDRFLREDGLVMVATIAFGMGIDKPDVRFVAHLDLPKNIEGYYQETGRAGRDGE
FT                   AADAWMTYGLADVVNQRRMIDESPAAEEFKRVQRGKLDALLALAEAHDCRRVRLLSYFG
FT                   EQYREPPDVGPPQGGRSPLGGQGVPEGLTVGARCGNCDNCLNPPSIWDATESARKLLSC
FT                   IYRFQQHGQQNHGARSFGAGHLIDVLRGKASDKVAQYGHERLSTWAVGADMSEQQWRAV
FT                   LRQLVSLGHVVAEGEYNTLALTDSARAVLKGDVSLRMKTPAEPTTKRGRTVRGAGHGGA
FT                   REVAPPIELSASAQRRYDALREWRAEVAREHNLPSYVVFNNATLAEMARREPTNLAEMG
FT                   EISGVGAKKLEAYGTEILRVLAHS"
FT   gene            605340..606557
FT                   /locus_tag="Lcho_0557"
FT   CDS_pept        605340..606557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0557"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: mpt:Mpe_A0078 alpha-beta
FT                   hydrolase superfamily esterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32832"
FT                   /db_xref="GOA:B1XYU8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU8"
FT                   /protein_id="ACB32832.1"
FT                   /translation="MNRPKSAPSRKPKAPPRRAAPAVSEVAVPPVAAQPPAERIEPVEI
FT                   AEPRGPATIDLALQGGGSHGAFTWGVLDALLEDGRLGFDGVSGTSAGAMNAAVLACGFA
FT                   RGGRDGARAALRAFWNDIGSAPGCLGAAPSSAPFASPFAQAPQIAWPAWLFNTDIWPMY
FT                   GVLDAMWRSLSPYQFNPLNLNPLRRILDKHVDPALLRDGPLKLFVTATAVSTGQPKVFS
FT                   GAELSIDALLASACLPQMVQAIEIDGESYWDGGFAGNPAIWPLIYGTGSLDVLLVQINP
FT                   LVRPGVPTRAVDIADRVNEITFNASLVAEMRAIAFVQKLVRQHKVSSDEYKLLRLHRVA
FT                   DEDGLAPYDASSKLNTDPRLLQALFDLGRAAAGRWLAEHAGDVGVRGTTAIEPVFLAPR
FT                   PAPAGT"
FT   gene            complement(606559..607404)
FT                   /locus_tag="Lcho_0558"
FT   CDS_pept        complement(606559..607404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32833"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYU9"
FT                   /protein_id="ACB32833.1"
FT                   /translation="MSHPIRTACSLTLWAACASLALPTLAATEPLANPGQTPAELEVVD
FT                   LSQPAPAGSVLPAIGVEAPVISVDLGGTFSLSRGAYTTRRFAGDGEVEYRYTRSEVISE
FT                   FHFDREYVQEAGTSSSVSSDEYDANIKWKTWLTDNPYYVFWSPRARFNRFGFFRSSQAL
FT                   RVGLGRRFQPGSDLALTLEVGPGIRSARPQTGPSVIEGMYTVTGKIDLSLSDTLTFKFN
FT                   LSDERSTRENYRTVTAGLRNKITERIWFKYEMAYRKAFPFDSAPSNAESSFDAGLSYRY
FT                   "
FT   sig_peptide     complement(607324..607404)
FT                   /locus_tag="Lcho_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            complement(607453..607950)
FT                   /locus_tag="Lcho_0559"
FT   CDS_pept        complement(607453..607950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32834"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV0"
FT                   /protein_id="ACB32834.1"
FT                   /translation="MNIAPAAAPDATTHPTHPTHPTHPTHTSRRPASFWRHTAGIACLG
FT                   LAGALAGCGGGIYIGIDGSDDDPPQVSLSVSPSAQFERGTIDLFANASDDYAVRRVDFY
FT                   RFDSLSPGGRPEWIGSDSAFPYELRTTQPDTPDGGVSYSARAIDDVGQVTDSAWVVVDV
FT                   LP"
FT   gene            complement(607993..609234)
FT                   /locus_tag="Lcho_0560"
FT   CDS_pept        complement(607993..609234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0560"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: rfr:Rfer_2975 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32835"
FT                   /db_xref="GOA:B1XYV1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV1"
FT                   /protein_id="ACB32835.1"
FT                   /translation="MSDAAALNTVLVVNSGSSSLKFALYPRSTGDEPPQALARGQVDGL
FT                   QPGGTLQLRLPGQAAQALAPAGADGNRHGAALAALQAHVDRAAPWARVQAVAHRIVHGG
FT                   PHYRAPVALDDAVLALLATLEPMAPLHQPYNLAGVRALRAAYPNCLQVACFDTSFHSTL
FT                   PRLEQRYALPTALHEQGLRRYGFHGLSYQSVMGALKRRSDKALGRVLMAHLGSGASACA
FT                   AQGGLSIATSMGFSALDGLVMGSRCGQLDPGIVLHLWRQGWTVAEVEKLLYRESGLVGV
FT                   SGLSADLRELRAAARAGHTQAQTAIDLFDYRLRREAGSLGAVLGGLDLLAFTGGIGEHD
FT                   HATRAELVHGLAYLGVRLDAAANRAATGEAIAPIHAADSSAEVWVVPTDEGRVAADAAW
FT                   HLLDSLPVGRTALL"
FT   gene            609487..610506
FT                   /locus_tag="Lcho_0561"
FT   CDS_pept        609487..610506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0561"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: aha:AHA_0219
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32836"
FT                   /db_xref="GOA:B1XYV2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV2"
FT                   /protein_id="ACB32836.1"
FT                   /translation="MKLLPTRRVVLAVAATLGAVTGLPAVALAQTAQPAVVYDAGGKFD
FT                   KSFNEAAYVGIERYKKETGGAYLDFEIQNDTQREQAFRRMAQKGANPIIGVGFTQASAI
FT                   EKVAKEFPQLKFAIVDMVVNLPNVQSVVFKEQEGSFLAGMAAVLVSKSGKVGFVGGMDV
FT                   PLIRRFQCGYEQGAKYANPKAELLSNMTGTTPAAWSDPTRGGELARNQFSRGVDVIFAA
FT                   AGGTGVGVYQAAKDAGKLAIGVDSNQNHLHPGTMLTSMTKGVDVAVYNIARSVKDGTFK
FT                   PGIQALGLKENGVGLAMDVHNAKLVSADVRKKLDAAQADIIGGKIKVADYMADNACKY"
FT   sig_peptide     609487..609576
FT                   /locus_tag="Lcho_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.927 at
FT                   residue 30"
FT   gene            610517..612157
FT                   /locus_tag="Lcho_0562"
FT   CDS_pept        610517..612157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0562"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmw:Mmwyl1_0633 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32837"
FT                   /db_xref="GOA:B1XYV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV3"
FT                   /protein_id="ACB32837.1"
FT                   /translation="MSAPAVRLIGIHKRFGAVLANRDVTFDVAGGSIHGLIGENGAGKS
FT                   TLMGVLYGLHPPDAGRIEIDGRALALGSAHDAIAAGIGMVHQHFMLVERFTVLENIVLG
FT                   AEGGWQLDLSLARARRAVLRLAQEFGLVVDPDARVRDLPVGVLQRVEILKALYRGARVL
FT                   ILDEPTGVLTPQETEQLMRMLRALKARGTTVLLITHKLKEVLAITDRVTVMRAGQVIAT
FT                   RETAACSEAELAELMVGRQVRLGEAHRPVERGEPVLDVASLGWRDALGVARLDGIDLRL
FT                   HAREIVGIAGVSGNGQSELLGLLGGLLPLQQGRLQITGARELEPVHRFDAHHPADPHTL
FT                   RALGVAHVPEDRHRLGLVLRFAAWESAALGYQDDPQIALGPRWSGFMDHRLMRSRCRQM
FT                   MEAFDVRPRDVELASAKFSGGNQQKLIIAREFERAPRVLLIGQPTRGVDIGAIETIHRA
FT                   ILALRDAGCAVLLVSTELDEILALADRIVVMCQGRITGEFERADADEARIGICMGQSET
FT                   SAFDSTVSAGDDVSAPDLPPVEGHAEDRR"
FT   gene            612154..613257
FT                   /locus_tag="Lcho_0563"
FT   CDS_pept        612154..613257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0563"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mes:Meso_3653 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32838"
FT                   /db_xref="GOA:B1XYV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV4"
FT                   /protein_id="ACB32838.1"
FT                   /translation="MSVVPLPRWVDVGLLPLLNVGVAMLAAGVLVAALGHSPWAALKLL
FT                   ADGAFGSPLAWGYTLYYSTNFIFTGLAVAVAAQAGHFNIGGEGQATLGGVGVALLLLAL
FT                   DPYLSTWLLLPLVVVAGAAAGAAWAAVPAWLQARRGSHIVITTIMFNFLASTLIVWLLV
FT                   NVIKAPGTPSVETRLFAPAGQLPSAQQLATLMGFAMPDTPLNLSLLFALLAALGVWLLL
FT                   WHTRLGYALRALGDAPDAAHYAGFKPQRLTVIALMLSGALAGGVGVNEVSGVHHRLLLD
FT                   FVAGAGFTGIAVALMGRNHPGGIVLAALLFGALAQGGSELAFEIPAFTRDMVTAVQGLV
FT                   VLFCGALALMLRPLLQRIWGWLGPRHG"
FT   gene            613250..614224
FT                   /locus_tag="Lcho_0564"
FT   CDS_pept        613250..614224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0564"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   atc:AGR_C_207 sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32839"
FT                   /db_xref="GOA:B1XYV5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV5"
FT                   /protein_id="ACB32839.1"
FT                   /translation="MDDIVLILASVLGATLRISVPLILCAMAGVLSERAGVIDIGLEGK
FT                   LLASAFAAAAAGALGAPAWAALAVAMAVSVSLALVHGLACITFKGDQIVSGVALNIIAL
FT                   GLTAVLGLHWFQRGGRTPDVPPEGRFTTLFPDAARAAQELPFIGPFIAEGLLNHNLLTW
FT                   FAFGSVPLVWWGLYRTRFGLRLRAVGENPAMVDAAGISVVWLRYRAVMLAGLLCGIGGT
FT                   FLTLAQNASFTPGMSAGRGFMALAAMVFGHWHPVRAFWACLLFGLLDATAIRLQGIELP
FT                   GIGAVPVELIQALPYLLTVVLLAGFFGRAESPAALGRAFSKER"
FT   gene            complement(614257..615777)
FT                   /locus_tag="Lcho_0565"
FT   CDS_pept        complement(614257..615777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0565"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   rsh:Rsph17029_2952 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32840"
FT                   /db_xref="GOA:B1XYV6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV6"
FT                   /protein_id="ACB32840.1"
FT                   /translation="MRAHPIAPPSDLLDRCGLRADECTGGTLRVTSPIDGSELARLHET
FT                   PLAELPGLLDRAQAAFKIWREVPAPARGELVRLWADELRAARNDIGALITLEVGKIVEE
FT                   GRGEVQEGIDICEFALGLSRQLYGRTIVSERPGHRIVEQYHPLGPVAVITAFNFPSAVF
FT                   AWNAALALVCGDPVIFKPSEKAPLSGLATFKALQRAVARFGERAPDGLAQIVIGGAAHG
FT                   EALVDSRAVALVSATGSTRMGRAVGPRVAARFGRRILELGGNNAMIVTPAADLDLALRA
FT                   ILFSAVGTAGQRCTSLRRLIVHRSVKQALLDRLLPAWASLQIGDPRAADTRVGPLIDRA
FT                   AGQAMQQAITEAQAQGGRLLTGGEPMLAERFPTACYMRPAIVEMPAQTEVVQRETFAPL
FT                   LYLMDYEQLDDAIALHNAVPQGLSSCIFSNDLREVERFIGASGSDCGMANVNIGPSGAE
FT                   IGGAFGGEKETGGDRESGSDAWKQYMRRSTSTINHSRELPLAQGIRFD"
FT   gene            complement(615808..616965)
FT                   /locus_tag="Lcho_0566"
FT   CDS_pept        complement(615808..616965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0566"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   pol:Bpro_4331 saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32841"
FT                   /db_xref="GOA:B1XYV7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV7"
FT                   /protein_id="ACB32841.1"
FT                   /translation="MDTSGLRKVLVLGAGKVGSTIADMLIDASGPDQGLAVTLADRLDP
FT                   AVAPDDAPIKPIHLDVEDSYALTAALRAHQVVINALPFYLATRVALAAAQAQVHYFDLT
FT                   EDIAATTTIRQIAATAPSLLMPQCGLAPGVIGMLGGHLAARFDELYDLRLRVGALTRNA
FT                   TNSLRYNFTWSIDGVINEYCNPCQAIVHGELTTVQPLEGHETFTLDAEAFEAFNTSGGL
FT                   GTLCETLRGRVRNLDYKTIRYPGHRDAMAFLLHDLRLIERRDLLRQVLEHAVPHSREDV
FT                   VIVFASAAGRRQGRFEQETRLARIFGAPLRGVDRTAIELSTAAGVVGLFELLRAGKLPR
FT                   AGFVGQEQVGLGDFLHTRVGHYYAALADPGSRAANDPIGFTPVQA"
FT   gene            617211..617726
FT                   /locus_tag="Lcho_0567"
FT   CDS_pept        617211..617726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0266 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32842"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV8"
FT                   /protein_id="ACB32842.1"
FT                   /translation="MVYIRVAFMLLALVLGGWLGYRWGSGDLEKVRAEIAAINQTGQIA
FT                   QSDSEATQKRIDEQLKLLADEHAARLKELTAGFEAQKRELSGSLGRANARIAALGGERQ
FT                   NIAAQLDQTRKEMATATGAQREALRLKEQQLAEMDARLQSRQEGIRCEAVAVPESHLLT
FT                   LNSVLGQP"
FT   gene            617723..618043
FT                   /locus_tag="Lcho_0568"
FT   CDS_pept        617723..618043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32843"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYV9"
FT                   /protein_id="ACB32843.1"
FT                   /translation="MKTNMLWLAALAPLAACTTTHVPVVPDAVQCEVPAALLQACDAPQ
FT                   RLKDGTTYGELLQVHLADRQALVRCAADHDSLMKAVTLCRSEVERHNARLKELDAALKA
FT                   RQ"
FT   sig_peptide     617723..617785
FT                   /locus_tag="Lcho_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.400 at
FT                   residue 21"
FT   gene            complement(618054..618806)
FT                   /locus_tag="Lcho_0569"
FT   CDS_pept        complement(618054..618806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32844"
FT                   /db_xref="GOA:B1XYW0"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW0"
FT                   /protein_id="ACB32844.1"
FT                   /translation="MSQPVSRDFVMMLALPDSGPAFESAVTEIAYSDQREAVAVGAQIA
FT                   EFGPTVTPELRAAVADSLLLAQLAANKAAGDQGDVIAWYRKYVEVLQGVGWLVHDMEFQ
FT                   SQELAQIDGDMHTAIIPVITAMLGPAAAAASVVIAVLKGLQEMDKDNPWITVFDRASQH
FT                   ASGAKFQLGFVDADAQGNPEIKLMALAIDAQRSVTQVLFFKFSDQSTTLRRAESTLKSQ
FT                   RARLDSIKGAVSQRVQPFLTDYISKIEI"
FT   gene            618937..619554
FT                   /locus_tag="Lcho_0570"
FT   CDS_pept        618937..619554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0570"
FT                   /product="protein of unknown function DUF847"
FT                   /note="PFAM: protein of unknown function DUF847; KEGG:
FT                   xau:Xaut_3175 protein of unknown function DUF847"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32845"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW1"
FT                   /protein_id="ACB32845.1"
FT                   /translation="MPSAAYLQSLPFILRWEGGYVNHPADPGGATNKGVTQKVYDAWRA
FT                   RQGLAARDVRQLADAEMQAIYEAGYWLPPRCDVLPTALDQVQFDTAVNMGVGRSVRFLQ
FT                   QAVGAGVDGDFGPGTLGRVQRADLGTALAAYCDIRESYYRTLVARNAKLAVFQKGWMNR
FT                   LNALRKQIGLPGFEADVPLDFGDAGYVAKVPDFGEDPDYDLP"
FT   gene            619586..621280
FT                   /locus_tag="Lcho_0571"
FT   CDS_pept        619586..621280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32846"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025136"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW2"
FT                   /protein_id="ACB32846.1"
FT                   /translation="MSTSTADSPDLDRLREQATASLRRLAQRPDADELAQAKHQVEALR
FT                   NVRELDLMGRLAEAVSRVDPKDARNRRLYAQYLIDSGKASAAIDLLKPLAARLAKDHPE
FT                   HAEATGLLGRAYKQIFFDAGDTSSAGAREALKQAIAAYRRPYEENRRANAWQGVNLLAL
FT                   LSRARSVGLRVAPDLQPAELAAELVATLEAVPVAERDKWYLSTLTEARLGLGLDAGHMD
FT                   ELERQLHAYVSAPGTAAFQIASTLRQFTQVWGLDDARPAARGFDPAANRARNLPQILRA
FT                   RLLQLPGGGLEMSSGQLQSLRSAPPPEAGQLEAVLGTQGPQTFAWWRAGLESARSVAVI
FT                   RQKLGRRLGTGFLVRAADFGLTPGEELLVLTNFHVVNANGASPGIKPAAAEVVFEAADP
FT                   GRVYTVSELLWSSPPDQHDASLLRLSTPVADIAPLVIASELPPRPVAVADASAAGASAD
FT                   APQVYVVGYPGGRELSFSFQDNELLDHEGPDGGQPQIPGVCRVHYRAPTEGGSSGSPVF
FT                   NATAWEVIALHHKGGKFGMPRLNGQPGTYAANEGLAINTLIAAMHAR"
FT   gene            621378..621643
FT                   /locus_tag="Lcho_R0006"
FT   ncRNA           621378..621643
FT                   /locus_tag="Lcho_R0006"
FT                   /product="RNA component of RNaseP"
FT                   /note="RNaseP_RNA; Bacterial RNase P class A as predicted
FT                   by Rfam (RF00010), score 121.63"
FT                   /ncRNA_class="other"
FT   gene            621758..622732
FT                   /locus_tag="Lcho_0572"
FT   CDS_pept        621758..622732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0572"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mpt:Mpe_A0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32847"
FT                   /db_xref="GOA:B1XYW3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW3"
FT                   /protein_id="ACB32847.1"
FT                   /translation="MSQDLSHQATVASGVLPSAGPITAEATERVRASHLDGRAVLLLLL
FT                   CCVLWGLNQVAIKAAMPEVPSLAQLSVRSIVAFLLVLAWMRMRGVGWSPRDGTLWPGLL
FT                   CGLLFALEFGCVFVGLQFTTAARAVVFINTSPFIVAIVLAAMLPAERLRPLQIAGLVLA
FT                   FASIALAFGDAGSGGSWLGDALILLGAVLWGLTTVVIRLSSLRSARSELTLAYQLGVAA
FT                   LLSPLAAMVAGHTDAFAQSGQWSLLAWGSLFYQAVIVTFASYLLWFWLLTRYAATKVQA
FT                   FVFLSPVFGTLFAGGLLGEPVTAALLLGLGGVGVGLSLLNRRS"
FT   gene            complement(622738..623349)
FT                   /locus_tag="Lcho_0573"
FT   CDS_pept        complement(622738..623349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0573"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mpt:Mpe_A0516
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32848"
FT                   /db_xref="GOA:B1XYW4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYW4"
FT                   /protein_id="ACB32848.1"
FT                   /translation="MLDREGFRPNVGIILLNQRSEVFWGKRIRTHSWQFPQGGIKHGES
FT                   PEQAMFRELHEEVGLFPDHVRIIARTRDWLRYEVPDHFIRRDARGHYKGQKQIWFLLQL
FT                   TGRDSDMNLRATDHPEFDAWRWHDYWVPLEVVIEFKRNVYQMALTELARYVPRPNHHNR
FT                   YLRSGMRAHRRDEGSEHNDHLDPTGPHDAGASVSEPKQAE"
FT   gene            623452..625197
FT                   /locus_tag="Lcho_0574"
FT   CDS_pept        623452..625197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0574"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: mpt:Mpe_A0517 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32849"
FT                   /db_xref="GOA:B1XYW5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYW5"
FT                   /protein_id="ACB32849.1"
FT                   /translation="MKASQFFIATLKEAPADAEVKSHQLMMRAGMIKRLGAGIYNYMPM
FT                   GLRVIRKVEAIIREEMNRAGAVELLMPVVQPAELWQETGRFDKMGPELLRVKDRHDRDF
FT                   IIQPTSEEVVTDIARQELRSYKQLPKNFYHIQTKFRDERRPRFGIMRGREFTMKDAYSF
FT                   DRDAASAARSYDAMFAAYKRIFDRFGLQYRAVAADTGAIGGDLSHEFQVIADTGEDAIV
FT                   YCPTSDYAANIELAEAVSLIAERGAATESMAKTPTPGKSTCADVAQLLNLPLARTVKSL
FT                   VLATDELNEAGDVAKTTVWLLLVRGDHDMNEVKVGKVDGLKAGFRFATVAEIESHFGCK
FT                   PGYLGPIGLKKPVKVIADRTVAQMADFICGANEIDFHLTGINWGRDLPEPDAVADIRNV
FT                   VEGDPSPDGQGVLAIQRGIEVGHVFFLGTKYSKAMNATYLDENGKPQFMEMGCYGIGVT
FT                   RILGAAIEQKHDARGILWPDAIAPFTVVVCPIGYDRSAEVKAAADALHDELQAAGIDVM
FT                   LDDRGERPGAMFADWELIGVPHRVVISDRGLKAGQVEYQGRCDEAASTVPAAEVAAFVK
FT                   GRLRS"
FT   gene            625278..625949
FT                   /locus_tag="Lcho_0575"
FT   CDS_pept        625278..625949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0575"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   aav:Aave_3669 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32850"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW6"
FT                   /protein_id="ACB32850.1"
FT                   /translation="MSAASSARLLAGGAAGLGLWPALAQAGRQAEEPLADAVRSALSAA
FT                   VADSAPPRLEFAQIEQRLAYLRWLGTTGQRLVRRKPDFDVRREFLETLWYESRRAGLDP
FT                   SLVLGVVEVESGFRKYAISSAGARGYMQVMPFWARLIGDGDASRLFHLQTNLRFGCVIL
FT                   RHYLDRERGDLFMALGRYNGSRGQAPYPTMVLGARKRWMHPDDGLRTAGTAAADTANAA
FT                   R"
FT   sig_peptide     625278..625358
FT                   /locus_tag="Lcho_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.620 at
FT                   residue 27"
FT   gene            complement(625975..626553)
FT                   /locus_tag="Lcho_0576"
FT   CDS_pept        complement(625975..626553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0576"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: mpt:Mpe_A0519
FT                   putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32851"
FT                   /db_xref="GOA:B1XYW7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW7"
FT                   /protein_id="ACB32851.1"
FT                   /translation="MSAATSRPRLVVGITGASGAIYGVRLLDRARALGVETHLVVTSAG
FT                   VLNVHHEMGLGRAELEARADHHHSPGEVGACIASGSFSTEAMVIAPCSMKTLAAVAHGF
FT                   GDNLLSRAADVTLKERRRLVLMVRETPFNLAHLRNMVAATEMGAIVFPPLPAFYHRPQS
FT                   IDELVDETVERVLQISGIGQASPKAWAGL"
FT   gene            complement(626558..626869)
FT                   /locus_tag="Lcho_0577"
FT   CDS_pept        complement(626558..626869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0577"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: rso:RSc2904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32852"
FT                   /db_xref="GOA:B1XYW8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW8"
FT                   /protein_id="ACB32852.1"
FT                   /translation="MTTAQTRIDELVKSHPVVLFMKGTAQFPMCGFSGRAIQILKACGV
FT                   SDLTTVNVLEDDGIRQGIKEYANWPTIPQLYVKGEFVGGSDIMMEMYQAGELQELLKA"
FT   gene            complement(626993..627673)
FT                   /locus_tag="Lcho_0578"
FT   CDS_pept        complement(626993..627673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32853"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYW9"
FT                   /protein_id="ACB32853.1"
FT                   /translation="MAVFSVFSNLARVRCGNPTAQAASARSGAPTAVMVTATLMACIGA
FT                   AHASDNDRLRLSSAGPGSLRVEGSLWGARFDLRPPASSDDGTTLRRSGWQLLGDYHFRT
FT                   IGGLRATGGLLGSSTRPAALTPSLPGASRLQMRHGTPPGLGEMAASGRLWQGESEASTA
FT                   TYLGLGYSIGNPAQGWGLSADLGLRASRETADVRLGQSDNTGADWPQTLRLRPMLQFGV
FT                   SYSF"
FT   sig_peptide     complement(627527..627673)
FT                   /locus_tag="Lcho_0578"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.663 at
FT                   residue 49"
FT   gene            complement(627834..628676)
FT                   /locus_tag="Lcho_0579"
FT   CDS_pept        complement(627834..628676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0579"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   vei:Veis_1555 modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32854"
FT                   /db_xref="GOA:B1XYX0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYX0"
FT                   /protein_id="ACB32854.1"
FT                   /translation="MTSPAPTIGQALAQARDAGLARLDAQLLLGHVCGLSRTGLLTNDD
FT                   QVLPAAQLARWQQLLARRLAGEPVAYLTGRHEFHGLTLHITSDVLDPRPDTETLVDWGL
FT                   ELLARLGRPARVLDLGTGSGAIALAIKHRCPSAQVSAVDFSAAALAVARANGARLNLDV
FT                   DWQPGNWFENLAGQRFDLILSNPPYIAEDDPHMPALRHEPRQALVSGADGLDDIRSLVR
FT                   QAPQHLVAGGWLLLEHGHDQGVAVQDLLRSTGYREVDRRLDLADHVRCSGGQWPAAGN"
FT   gene            complement(628673..629755)
FT                   /locus_tag="Lcho_0580"
FT   CDS_pept        complement(628673..629755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0580"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   mpt:Mpe_A0523 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32855"
FT                   /db_xref="GOA:B1XYX1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYX1"
FT                   /protein_id="ACB32855.1"
FT                   /translation="MTPFLRQQLSRQALRLAEIDAALADPKVCSQIGTLRSLNREHARV
FT                   SALVDRWQRYEQREQDLAGAQELLDEPEMAELARAEIGAAQADLDRLDSELLTALMPRD
FT                   ADDDRNAFVEIRAGTGGEESALFAADLARMYLRHAERRGWKTELMSESVSDLGGYKDVV
FT                   LHIIGDAVFEALKYESGGHRVQRVPATEAQGRIHTSACTVAVLAEADEAEEVSLNPAEL
FT                   RIDTYRASGAGGQHINKTDSAVRVTHLPTGLVAECQDDRSQHRNKARALAVLAARLRDR
FT                   VRQEQAAKDAAARKSLIGSGDRSDRIRTYNFPQGRLTDHRINLTLYKLGAVLEGDLDEV
FT                   IGALQAAHAAEQLAELETQA"
FT   gene            complement(629854..631161)
FT                   /locus_tag="Lcho_0581"
FT   CDS_pept        complement(629854..631161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0581"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: mpt:Mpe_A0524 glutamyl-tRNA reductase;
FT                   TIGRFAM: glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32856"
FT                   /db_xref="GOA:B1XYX2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYX2"
FT                   /protein_id="ACB32856.1"
FT                   /translation="MSVFTLSLNHHTAPVDLRGRFAFTLEQIPTALQGLRAGLDRAAPE
FT                   AAILSTCNRTELYIAADPARTSQLVVPALDWLAAHGGVSTDDLRRHTHVMERQEAARHA
FT                   FRVASGLDSMVLGEPQILGQMKQAVREADTAGTLGTTLHQLFQRSFSVAKEVRTSTEIG
FT                   AHSISMAAASVRLAGQLFEDLHKIRVLFVGAGEMIELVATHFVAKAPRHVTIANRTLER
FT                   GEKLASHFGAEAMRLADLPARLHEFDAVISCTASTLPLIGLGAVERAIKARRRRPMFMV
FT                   DLAVPRDIEPEVGQLDDVYLYTVDDLSALVQSAGEKRQAAVAQAEAIIESGVQNFVHWL
FT                   SQRSTVPLIQSLQAQADVWRNTEMARARKLLARGADVDEVLEALSRGLTQKMLHGALAE
FT                   LHNADTQQRAHTAEVVSRLFLRGESRRGKAEPAGEI"
FT   gene            631292..631573
FT                   /locus_tag="Lcho_0582"
FT   CDS_pept        631292..631573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32857"
FT                   /db_xref="GOA:B1XYX3"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYX3"
FT                   /protein_id="ACB32857.1"
FT                   /translation="MGFFDALGHLFNLFLPALGVAALAALLAKALWRRELKGVPLQRLA
FT                   AHAAVAGVVATLAGLIVTGRDGRIGSYFALVLANALGLWWAAFGPGRR"
FT   sig_peptide     631292..631378
FT                   /locus_tag="Lcho_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.228 at
FT                   residue 29"
FT   gene            complement(631600..632523)
FT                   /locus_tag="Lcho_0583"
FT   CDS_pept        complement(631600..632523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0583"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ajs:Ajs_0515 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32858"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYX4"
FT                   /protein_id="ACB32858.1"
FT                   /translation="MPVDAPLQGLTVLERGWLSSNNILLHGAPGEGAVLVDSGHCVHAA
FT                   QTLALVDHARQGETLRLLVNTHLHSDHCGGNARLQQAHAVPVRVPPGQAEAARAWDETA
FT                   LSYQPTGQRCERFAVHGVLQPGTALTVGSAIWQVIAAPGHDPHSVMLFEPEQGVLLSAD
FT                   ALWENGFGVVFPELEGESAFDDVAAVLDLIERLPVRRVVPGHGAAFGDVKTALQRARQR
FT                   LAAFRADPARHARHAAKVLVKYHLMEVGRQRHADLLRWAEATPLMASTQQTARDRGSLP
FT                   DWSEQLVAELLASGALRQVDDWVLDA"
FT   gene            complement(632534..633943)
FT                   /locus_tag="Lcho_0584"
FT   CDS_pept        complement(632534..633943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0584"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: mpt:Mpe_A0532 bifunctional enzyme involved in
FT                   thiolation and methylation of tRNA; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32859"
FT                   /db_xref="GOA:B1XYX5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYX5"
FT                   /protein_id="ACB32859.1"
FT                   /translation="MHTPTLTSTPTTATSVVDDTAPAASGKKVYIRTFGCQMNEYDSDK
FT                   MSDVMAAAEGYTPTDDPEQADLILFNTCSVREKAQEKVFSDLGRVKHLKARGVLIGVGG
FT                   CVASQEGAAIIERAPYVDVVFGPQTLHRLPQMLAQRARQGRPQVDISFPEIEKFDHLPP
FT                   AKVDGAAAFVSIMEGCSKYCSYCVVPYTRGEEFSRPFDEVLTEVAGLADQGVKEVTLLG
FT                   QNVNAYRGRMGDTSDIADFATLLEYVHEIPGIERIRYTTSHPNEFTPALIEAYARLPKL
FT                   VNHLHLPVQHGSDRILSGMKRGYTVLEYKSTIRKLRAIRPDISLSTDFIVGFPGETDDD
FT                   HARTMKLIDDIGFDASFSFIFSPRPGTPAAALHDDTSYEVKLARLQQLQATIEDNVRRI
FT                   SERRVGTVQRVLVEGPSRRDPNELMGRTECNRIVNFDGGPNAARLVGRMIDIRITLAYP
FT                   HSLRGEPVLRD"
FT   gene            complement(634061..634137)
FT                   /locus_tag="Lcho_R0007"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(634061..634137)
FT                   /locus_tag="Lcho_R0007"
FT                   /product="tRNA-Met"
FT   gene            634347..634991
FT                   /locus_tag="Lcho_0585"
FT   CDS_pept        634347..634991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0585"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: mpt:Mpe_A0663
FT                   urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32860"
FT                   /db_xref="GOA:B1XYX6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XYX6"
FT                   /protein_id="ACB32860.1"
FT                   /translation="MSQLHAVPGRTKKLPPLRVGVGGPVGSGKTTLVEMLCKTMRERWD
FT                   LVVVTNDIYTKEDQRLLTVAGALEPERIIGVETGGCPHTAIREDASINLEAVDRMLEKF
FT                   PNADIVFIESGGDNLAATFSPELSDLTIYVIDVAAGEKIPRKGGPGITKSDLFVINKTD
FT                   LAPHVGADLSVMEADTRRMRPNRPFVMSNLKTRQGLDEVIRFIETKGLLVG"
FT   gene            complement(634998..635207)
FT                   /locus_tag="Lcho_0586"
FT   CDS_pept        complement(634998..635207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0586"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: rso:RSc0349 putative
FT                   bacterioferritin-associated ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32861"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B1XYX7"
FT                   /protein_id="ACB32861.1"
FT                   /translation="MIVCLCNRVSDRDIRHAVQVHGVRDFEVLKDQTSAASCCGCCHDC
FT                   AREVFDAACQTADGKLGSTAPAHG"
FT   gene            complement(635341..635817)
FT                   /locus_tag="Lcho_0587"
FT   CDS_pept        complement(635341..635817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lcho_0587"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: pol:Bpro_3046 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Lcho_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB32862"
FT                   /db_xref="GOA:B1XZ