(data stored in ACNUC7421 zone)

EMBL: CP001016

ID   CP001016; SV 1; circular; genomic DNA; STD; PRO; 4170153 BP.
XX
AC   CP001016;
XX
PR   Project:PRJNA20841;
XX
DT   13-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Beijerinckia indica subsp. indica ATCC 9039, complete genome.
XX
KW   .
XX
OS   Beijerinckia indica subsp. indica ATCC 9039
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Beijerinckiaceae; Beijerinckia.
XX
RN   [1]
RP   1-4170153
RX   DOI; 10.1128/JB.00656-10.
RX   PUBMED; 20601475.
RA   Tamas I., Dedysh S.N., Liesack W., Stott M.B., Alam M., Murrell J.C.,
RA   Dunfield P.F.;
RT   "Complete genome sequence of Beijerinckia indica subsp. indica";
RL   J. Bacteriol. 192(17):4532-4533(2010).
XX
RN   [2]
RP   1-4170153
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., LaButti K., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Dunfield P.F., Dedysh S.N.,
RA   Liesack W., Saw J.H., Alam M., Chen Y., Murrell J.C., Richardson P.;
RT   ;
RL   Submitted (26-MAR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7fc8221985466e98ecca85f39c7ad968.
DR   BioSample; SAMN02598441.
DR   EnsemblGenomes-Gn; Bind_R0001.
DR   EnsemblGenomes-Gn; Bind_R0002.
DR   EnsemblGenomes-Gn; Bind_R0003.
DR   EnsemblGenomes-Gn; Bind_R0004.
DR   EnsemblGenomes-Gn; Bind_R0005.
DR   EnsemblGenomes-Gn; Bind_R0006.
DR   EnsemblGenomes-Gn; Bind_R0007.
DR   EnsemblGenomes-Gn; Bind_R0008.
DR   EnsemblGenomes-Gn; Bind_R0009.
DR   EnsemblGenomes-Gn; Bind_R0010.
DR   EnsemblGenomes-Gn; Bind_R0011.
DR   EnsemblGenomes-Gn; Bind_R0012.
DR   EnsemblGenomes-Gn; Bind_R0013.
DR   EnsemblGenomes-Gn; Bind_R0014.
DR   EnsemblGenomes-Gn; Bind_R0016.
DR   EnsemblGenomes-Gn; Bind_R0017.
DR   EnsemblGenomes-Gn; Bind_R0019.
DR   EnsemblGenomes-Gn; Bind_R0020.
DR   EnsemblGenomes-Gn; Bind_R0021.
DR   EnsemblGenomes-Gn; Bind_R0022.
DR   EnsemblGenomes-Gn; Bind_R0023.
DR   EnsemblGenomes-Gn; Bind_R0024.
DR   EnsemblGenomes-Gn; Bind_R0025.
DR   EnsemblGenomes-Gn; Bind_R0026.
DR   EnsemblGenomes-Gn; Bind_R0027.
DR   EnsemblGenomes-Gn; Bind_R0028.
DR   EnsemblGenomes-Gn; Bind_R0029.
DR   EnsemblGenomes-Gn; Bind_R0030.
DR   EnsemblGenomes-Gn; Bind_R0031.
DR   EnsemblGenomes-Gn; Bind_R0032.
DR   EnsemblGenomes-Gn; Bind_R0033.
DR   EnsemblGenomes-Gn; Bind_R0034.
DR   EnsemblGenomes-Gn; Bind_R0035.
DR   EnsemblGenomes-Gn; Bind_R0036.
DR   EnsemblGenomes-Gn; Bind_R0037.
DR   EnsemblGenomes-Gn; Bind_R0038.
DR   EnsemblGenomes-Gn; Bind_R0039.
DR   EnsemblGenomes-Gn; Bind_R0040.
DR   EnsemblGenomes-Gn; Bind_R0041.
DR   EnsemblGenomes-Gn; Bind_R0042.
DR   EnsemblGenomes-Gn; Bind_R0043.
DR   EnsemblGenomes-Gn; Bind_R0044.
DR   EnsemblGenomes-Gn; Bind_R0045.
DR   EnsemblGenomes-Gn; Bind_R0046.
DR   EnsemblGenomes-Gn; Bind_R0047.
DR   EnsemblGenomes-Gn; Bind_R0048.
DR   EnsemblGenomes-Gn; Bind_R0049.
DR   EnsemblGenomes-Gn; Bind_R0050.
DR   EnsemblGenomes-Gn; Bind_R0051.
DR   EnsemblGenomes-Gn; Bind_R0052.
DR   EnsemblGenomes-Gn; Bind_R0053.
DR   EnsemblGenomes-Gn; Bind_R0054.
DR   EnsemblGenomes-Gn; Bind_R0055.
DR   EnsemblGenomes-Gn; Bind_R0056.
DR   EnsemblGenomes-Gn; Bind_R0057.
DR   EnsemblGenomes-Gn; Bind_R0058.
DR   EnsemblGenomes-Gn; Bind_R0059.
DR   EnsemblGenomes-Gn; Bind_R0060.
DR   EnsemblGenomes-Gn; Bind_R0061.
DR   EnsemblGenomes-Gn; Bind_R0062.
DR   EnsemblGenomes-Gn; Bind_R0063.
DR   EnsemblGenomes-Gn; Bind_R0064.
DR   EnsemblGenomes-Gn; Bind_R0065.
DR   EnsemblGenomes-Gn; Bind_R0066.
DR   EnsemblGenomes-Gn; EBG00001060452.
DR   EnsemblGenomes-Gn; EBG00001060453.
DR   EnsemblGenomes-Gn; EBG00001060454.
DR   EnsemblGenomes-Gn; EBG00001060455.
DR   EnsemblGenomes-Gn; EBG00001060456.
DR   EnsemblGenomes-Gn; EBG00001060457.
DR   EnsemblGenomes-Gn; EBG00001060458.
DR   EnsemblGenomes-Gn; EBG00001060459.
DR   EnsemblGenomes-Gn; EBG00001060460.
DR   EnsemblGenomes-Gn; EBG00001060461.
DR   EnsemblGenomes-Gn; EBG00001060462.
DR   EnsemblGenomes-Gn; EBG00001060463.
DR   EnsemblGenomes-Gn; EBG00001060465.
DR   EnsemblGenomes-Gn; EBG00001060467.
DR   EnsemblGenomes-Gn; EBG00001060469.
DR   EnsemblGenomes-Gn; EBG00001060471.
DR   EnsemblGenomes-Gn; EBG00001060473.
DR   EnsemblGenomes-Gn; EBG00001060475.
DR   EnsemblGenomes-Gn; EBG00001060477.
DR   EnsemblGenomes-Gn; EBG00001060478.
DR   EnsemblGenomes-Gn; EBG00001060480.
DR   EnsemblGenomes-Gn; EBG00001060482.
DR   EnsemblGenomes-Gn; EBG00001060484.
DR   EnsemblGenomes-Gn; EBG00001060485.
DR   EnsemblGenomes-Gn; EBG00001060487.
DR   EnsemblGenomes-Gn; EBG00001060489.
DR   EnsemblGenomes-Gn; EBG00001060490.
DR   EnsemblGenomes-Gn; EBG00001060492.
DR   EnsemblGenomes-Gn; EBG00001060494.
DR   EnsemblGenomes-Gn; EBG00001060496.
DR   EnsemblGenomes-Gn; EBG00001060498.
DR   EnsemblGenomes-Gn; EBG00001060500.
DR   EnsemblGenomes-Gn; EBG00001060502.
DR   EnsemblGenomes-Gn; EBG00001060507.
DR   EnsemblGenomes-Gn; EBG00001060509.
DR   EnsemblGenomes-Gn; EBG00001060511.
DR   EnsemblGenomes-Gn; EBG00001060513.
DR   EnsemblGenomes-Gn; EBG00001060515.
DR   EnsemblGenomes-Gn; EBG00001060517.
DR   EnsemblGenomes-Gn; EBG00001060519.
DR   EnsemblGenomes-Gn; EBG00001060521.
DR   EnsemblGenomes-Gn; EBG00001060523.
DR   EnsemblGenomes-Gn; EBG00001060525.
DR   EnsemblGenomes-Gn; EBG00001060527.
DR   EnsemblGenomes-Gn; EBG00001060529.
DR   EnsemblGenomes-Gn; EBG00001060531.
DR   EnsemblGenomes-Gn; EBG00001060533.
DR   EnsemblGenomes-Gn; EBG00001060535.
DR   EnsemblGenomes-Gn; EBG00001060537.
DR   EnsemblGenomes-Gn; EBG00001060539.
DR   EnsemblGenomes-Gn; EBG00001060541.
DR   EnsemblGenomes-Gn; EBG00001060543.
DR   EnsemblGenomes-Gn; EBG00001060545.
DR   EnsemblGenomes-Gn; EBG00001060547.
DR   EnsemblGenomes-Gn; EBG00001060549.
DR   EnsemblGenomes-Gn; EBG00001060551.
DR   EnsemblGenomes-Gn; EBG00001060553.
DR   EnsemblGenomes-Gn; EBG00001060555.
DR   EnsemblGenomes-Gn; EBG00001060557.
DR   EnsemblGenomes-Gn; EBG00001060559.
DR   EnsemblGenomes-Gn; EBG00001060561.
DR   EnsemblGenomes-Gn; EBG00001060563.
DR   EnsemblGenomes-Gn; EBG00001060565.
DR   EnsemblGenomes-Gn; EBG00001060567.
DR   EnsemblGenomes-Gn; EBG00001060569.
DR   EnsemblGenomes-Gn; EBG00001060571.
DR   EnsemblGenomes-Gn; EBG00001060573.
DR   EnsemblGenomes-Gn; EBG00001060575.
DR   EnsemblGenomes-Gn; EBG00001060576.
DR   EnsemblGenomes-Gn; EBG00001060578.
DR   EnsemblGenomes-Gn; EBG00001060580.
DR   EnsemblGenomes-Gn; EBG00001060582.
DR   EnsemblGenomes-Gn; EBG00001060584.
DR   EnsemblGenomes-Gn; EBG00001060586.
DR   EnsemblGenomes-Gn; EBG00001060588.
DR   EnsemblGenomes-Gn; EBG00001060590.
DR   EnsemblGenomes-Gn; EBG00001060592.
DR   EnsemblGenomes-Gn; EBG00001060594.
DR   EnsemblGenomes-Gn; EBG00001060596.
DR   EnsemblGenomes-Tr; Bind_R0001-1.
DR   EnsemblGenomes-Tr; Bind_R0002-1.
DR   EnsemblGenomes-Tr; Bind_R0003-1.
DR   EnsemblGenomes-Tr; Bind_R0004-1.
DR   EnsemblGenomes-Tr; Bind_R0005-1.
DR   EnsemblGenomes-Tr; Bind_R0006-1.
DR   EnsemblGenomes-Tr; Bind_R0007-1.
DR   EnsemblGenomes-Tr; Bind_R0008-1.
DR   EnsemblGenomes-Tr; Bind_R0009-1.
DR   EnsemblGenomes-Tr; Bind_R0010-1.
DR   EnsemblGenomes-Tr; Bind_R0011-1.
DR   EnsemblGenomes-Tr; Bind_R0012-1.
DR   EnsemblGenomes-Tr; Bind_R0013-1.
DR   EnsemblGenomes-Tr; Bind_R0014-1.
DR   EnsemblGenomes-Tr; Bind_R0016-1.
DR   EnsemblGenomes-Tr; Bind_R0017-1.
DR   EnsemblGenomes-Tr; Bind_R0019-1.
DR   EnsemblGenomes-Tr; Bind_R0020-1.
DR   EnsemblGenomes-Tr; Bind_R0021-1.
DR   EnsemblGenomes-Tr; Bind_R0022-1.
DR   EnsemblGenomes-Tr; Bind_R0023-1.
DR   EnsemblGenomes-Tr; Bind_R0024-1.
DR   EnsemblGenomes-Tr; Bind_R0025-1.
DR   EnsemblGenomes-Tr; Bind_R0026-1.
DR   EnsemblGenomes-Tr; Bind_R0027-1.
DR   EnsemblGenomes-Tr; Bind_R0028-1.
DR   EnsemblGenomes-Tr; Bind_R0029-1.
DR   EnsemblGenomes-Tr; Bind_R0030-1.
DR   EnsemblGenomes-Tr; Bind_R0031-1.
DR   EnsemblGenomes-Tr; Bind_R0032-1.
DR   EnsemblGenomes-Tr; Bind_R0033-1.
DR   EnsemblGenomes-Tr; Bind_R0034-1.
DR   EnsemblGenomes-Tr; Bind_R0035-1.
DR   EnsemblGenomes-Tr; Bind_R0036-1.
DR   EnsemblGenomes-Tr; Bind_R0037-1.
DR   EnsemblGenomes-Tr; Bind_R0038-1.
DR   EnsemblGenomes-Tr; Bind_R0039-1.
DR   EnsemblGenomes-Tr; Bind_R0040-1.
DR   EnsemblGenomes-Tr; Bind_R0041-1.
DR   EnsemblGenomes-Tr; Bind_R0042-1.
DR   EnsemblGenomes-Tr; Bind_R0043-1.
DR   EnsemblGenomes-Tr; Bind_R0044-1.
DR   EnsemblGenomes-Tr; Bind_R0045-1.
DR   EnsemblGenomes-Tr; Bind_R0046-1.
DR   EnsemblGenomes-Tr; Bind_R0047-1.
DR   EnsemblGenomes-Tr; Bind_R0048-1.
DR   EnsemblGenomes-Tr; Bind_R0049-1.
DR   EnsemblGenomes-Tr; Bind_R0050-1.
DR   EnsemblGenomes-Tr; Bind_R0051-1.
DR   EnsemblGenomes-Tr; Bind_R0052-1.
DR   EnsemblGenomes-Tr; Bind_R0053-1.
DR   EnsemblGenomes-Tr; Bind_R0054-1.
DR   EnsemblGenomes-Tr; Bind_R0055-1.
DR   EnsemblGenomes-Tr; Bind_R0056-1.
DR   EnsemblGenomes-Tr; Bind_R0057-1.
DR   EnsemblGenomes-Tr; Bind_R0058-1.
DR   EnsemblGenomes-Tr; Bind_R0059-1.
DR   EnsemblGenomes-Tr; Bind_R0060-1.
DR   EnsemblGenomes-Tr; Bind_R0061-1.
DR   EnsemblGenomes-Tr; Bind_R0062-1.
DR   EnsemblGenomes-Tr; Bind_R0063-1.
DR   EnsemblGenomes-Tr; Bind_R0064-1.
DR   EnsemblGenomes-Tr; Bind_R0065-1.
DR   EnsemblGenomes-Tr; Bind_R0066-1.
DR   EnsemblGenomes-Tr; EBT00001662440.
DR   EnsemblGenomes-Tr; EBT00001662441.
DR   EnsemblGenomes-Tr; EBT00001662442.
DR   EnsemblGenomes-Tr; EBT00001662443.
DR   EnsemblGenomes-Tr; EBT00001662444.
DR   EnsemblGenomes-Tr; EBT00001662445.
DR   EnsemblGenomes-Tr; EBT00001662446.
DR   EnsemblGenomes-Tr; EBT00001662447.
DR   EnsemblGenomes-Tr; EBT00001662448.
DR   EnsemblGenomes-Tr; EBT00001662449.
DR   EnsemblGenomes-Tr; EBT00001662450.
DR   EnsemblGenomes-Tr; EBT00001662451.
DR   EnsemblGenomes-Tr; EBT00001662452.
DR   EnsemblGenomes-Tr; EBT00001662453.
DR   EnsemblGenomes-Tr; EBT00001662454.
DR   EnsemblGenomes-Tr; EBT00001662455.
DR   EnsemblGenomes-Tr; EBT00001662456.
DR   EnsemblGenomes-Tr; EBT00001662457.
DR   EnsemblGenomes-Tr; EBT00001662458.
DR   EnsemblGenomes-Tr; EBT00001662459.
DR   EnsemblGenomes-Tr; EBT00001662460.
DR   EnsemblGenomes-Tr; EBT00001662461.
DR   EnsemblGenomes-Tr; EBT00001662462.
DR   EnsemblGenomes-Tr; EBT00001662463.
DR   EnsemblGenomes-Tr; EBT00001662464.
DR   EnsemblGenomes-Tr; EBT00001662465.
DR   EnsemblGenomes-Tr; EBT00001662466.
DR   EnsemblGenomes-Tr; EBT00001662467.
DR   EnsemblGenomes-Tr; EBT00001662468.
DR   EnsemblGenomes-Tr; EBT00001662469.
DR   EnsemblGenomes-Tr; EBT00001662470.
DR   EnsemblGenomes-Tr; EBT00001662471.
DR   EnsemblGenomes-Tr; EBT00001662472.
DR   EnsemblGenomes-Tr; EBT00001662473.
DR   EnsemblGenomes-Tr; EBT00001662474.
DR   EnsemblGenomes-Tr; EBT00001662475.
DR   EnsemblGenomes-Tr; EBT00001662476.
DR   EnsemblGenomes-Tr; EBT00001662477.
DR   EnsemblGenomes-Tr; EBT00001662478.
DR   EnsemblGenomes-Tr; EBT00001662479.
DR   EnsemblGenomes-Tr; EBT00001662480.
DR   EnsemblGenomes-Tr; EBT00001662481.
DR   EnsemblGenomes-Tr; EBT00001662482.
DR   EnsemblGenomes-Tr; EBT00001662483.
DR   EnsemblGenomes-Tr; EBT00001662484.
DR   EnsemblGenomes-Tr; EBT00001662485.
DR   EnsemblGenomes-Tr; EBT00001662486.
DR   EnsemblGenomes-Tr; EBT00001662487.
DR   EnsemblGenomes-Tr; EBT00001662488.
DR   EnsemblGenomes-Tr; EBT00001662489.
DR   EnsemblGenomes-Tr; EBT00001662490.
DR   EnsemblGenomes-Tr; EBT00001662491.
DR   EnsemblGenomes-Tr; EBT00001662492.
DR   EnsemblGenomes-Tr; EBT00001662493.
DR   EnsemblGenomes-Tr; EBT00001662494.
DR   EnsemblGenomes-Tr; EBT00001662495.
DR   EnsemblGenomes-Tr; EBT00001662496.
DR   EnsemblGenomes-Tr; EBT00001662497.
DR   EnsemblGenomes-Tr; EBT00001662498.
DR   EnsemblGenomes-Tr; EBT00001662499.
DR   EnsemblGenomes-Tr; EBT00001662500.
DR   EnsemblGenomes-Tr; EBT00001662501.
DR   EnsemblGenomes-Tr; EBT00001662502.
DR   EnsemblGenomes-Tr; EBT00001662503.
DR   EnsemblGenomes-Tr; EBT00001662504.
DR   EnsemblGenomes-Tr; EBT00001662505.
DR   EnsemblGenomes-Tr; EBT00001662506.
DR   EnsemblGenomes-Tr; EBT00001662507.
DR   EnsemblGenomes-Tr; EBT00001662508.
DR   EnsemblGenomes-Tr; EBT00001662509.
DR   EnsemblGenomes-Tr; EBT00001662510.
DR   EnsemblGenomes-Tr; EBT00001662511.
DR   EnsemblGenomes-Tr; EBT00001662512.
DR   EnsemblGenomes-Tr; EBT00001662513.
DR   EnsemblGenomes-Tr; EBT00001662514.
DR   EnsemblGenomes-Tr; EBT00001662515.
DR   EnsemblGenomes-Tr; EBT00001662516.
DR   EnsemblGenomes-Tr; EBT00001662517.
DR   EnsemblGenomes-Tr; EBT00001662518.
DR   EuropePMC; PMC2937395; 20601475.
DR   EuropePMC; PMC3906808; 23985741.
DR   EuropePMC; PMC4500991; 26236289.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001016.
DR   SILVA-SSU; CP001016.
DR   StrainInfo; 5269; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082525
CC   Source DNA available from Peter Dunfield (pfdunfie@ucalgary.ca)
CC   Bacteria available from ATCC: ATCC 9039
CC   Contacts: Peter Dunfield (pfdunfie@ucalgary.ca)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4170153
FT                   /organism="Beijerinckia indica subsp. indica ATCC 9039"
FT                   /sub_species="indica"
FT                   /strain="ATCC 9039"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Beijerinckia indica subsp. indica"
FT                   /db_xref="taxon:395963"
FT   gene            8..271
FT                   /locus_tag="Bind_0001"
FT   CDS_pept        8..271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0001"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: xau:Xaut_1690
FT                   ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93660"
FT                   /db_xref="GOA:B2IAW0"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IAW0"
FT                   /protein_id="ACB93660.1"
FT                   /translation="MANTPSAKKAVRKIERRTAINKSRRSQMRTYIRKVEEAIASGDAA
FT                   AATSALQSAAPLVMRAAQKGIVHKNTASRKVSRLSKRVKALA"
FT   gene            413..748
FT                   /locus_tag="Bind_0002"
FT   CDS_pept        413..748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93661"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW1"
FT                   /protein_id="ACB93661.1"
FT                   /translation="MTHRIPFIDAISRVAKEGMEAFHSAALAVEKGPEALQKSPNFFSS
FT                   HGYAAQIKLSLINGLNGKHGGASSMGWVDSGSGAIRFGPTVTFTIGPQPNPAVFGSIRE
FT                   VGNQTLR"
FT   gene            1509..3041
FT                   /locus_tag="Bind_0003"
FT   CDS_pept        1509..3041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0003"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mex:Mext_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93662"
FT                   /db_xref="GOA:B2IAW2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW2"
FT                   /protein_id="ACB93662.1"
FT                   /translation="MPDARGLMALPQQIEDDNETGRRVNLGVNKDEAWERICRRLRAEL
FT                   GEDVFASWFGRLELDQVADGTAFLSVPTKFLKSWIQSHYTDKILAILADEFGNAKRISI
FT                   GVRPTSRVGRSFPADAERDNSPENAEPAARPARSPVGAEVKFFTGPDKKTVREISDAEA
FT                   LNGSPLDRRLSFANFLVGRSNQLAFAAAKGIAAADPNDPLLSNPLYLHASVGLGKTHLL
FT                   QAIAHDAMIMKRRVIYLTAEKFMYGFVAALKAQTAIAFKEKLRTIDILVIDDVQFLQGK
FT                   SIQQEFCHTLNALIDAGRQIVIAADRPPADLESLDERVRSRLAGGLCVEMGALDEALRI
FT                   KILETRIGAAKLVHPYFDVPQPVIAYVASVIQTNGRDLDGAVNRLLAHASLTSVPLTIE
FT                   IAETAIRDLVRTKEPKRVKIEEIQKLVASHFNVSRADILSSRRTANVVRPRQIAMYLSK
FT                   IMTLRSLPEIGRRFGGRDHTTVLHAVRKIENLASTDNHLSEELELLKRMLME"
FT   gene            3144..3671
FT                   /locus_tag="Bind_0004"
FT   CDS_pept        3144..3671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0004"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: mex:Mext_0962 crossover junction
FT                   endodeoxyribonuclease RuvC; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93663"
FT                   /db_xref="GOA:B2IAW3"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IAW3"
FT                   /protein_id="ACB93663.1"
FT                   /translation="MMPPRLRILGIDPGLRNMGWGIVELLGSNLTYVASGVVHSDGKGE
FT                   LAHRLKDLHVGLAGVIDAYTPHEAAIEETFVNRDPQSTLKLGQARGIALVVPALADLAV
FT                   AEYAANLIKKTVTGNGHAEKQQVAMMVKILLPKSDAGSADAVDALAVAITHAQLRRNPA
FT                   ALKSQAMIGQGR"
FT   gene            3668..4285
FT                   /locus_tag="Bind_0005"
FT   CDS_pept        3668..4285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0005"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; KEGG: rpa:RPA1100 Holliday junction DNA helicase motor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93664"
FT                   /db_xref="GOA:B2IAW4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IAW4"
FT                   /protein_id="ACB93664.1"
FT                   /translation="MIGKLTGLVDSQGEDHVILDVQGVGYIVFCSSRTLRLLPKPGAST
FT                   ALLIEMQVREDAIRLFGFPSEVERDWFRLLQSVQGVGAKVALALQGLLSATELAQAIAL
FT                   QDKASLGRAPGVGPKLAARLITELKDKMPALGPVDSLTAKLTIAEAEGTAPVAAQDAIT
FT                   ALVNLGYGRPQAAAAVATSLEALGETAPLADLIRRGLKELAR"
FT   gene            complement(4319..5377)
FT                   /locus_tag="Bind_0006"
FT   CDS_pept        complement(4319..5377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0006"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mex:Mext_0732 metalloendopeptidase,
FT                   glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93665"
FT                   /db_xref="GOA:B2IAW5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW5"
FT                   /protein_id="ACB93665.1"
FT                   /translation="MLVLGIETTCDETAAAIVRLTPEGAGEILSNEVMSQIAEHAAYGG
FT                   VVPEIAARAHLDVLDRLVERALERAHVSLNDLDGIAAAAGPGLIGGVMVGLTFGKALAL
FT                   AARKPFIAVNHLEAHALTARLTDHIAFPYLLLLVSGGHTQLIAVRGVGDYLRLGSTVDD
FT                   AIGEAFDKVAKMLGLPYPGGPQVEKMAEDGNPTRFDLPRPMLGRAKPDFSLSGLKTAIR
FT                   IEAERIAPLTKADVADLCASFQAAIVDTIIDRSRAGLRLFREQVGASNAMVVAGGVAAN
FT                   GAIRRSLMRFCGETGLRLVLPPPALCTDNGAMIAWAGVERLNLGLVDDMTFAARPRWPL
FT                   DANAEAVHHGKA"
FT   gene            5533..6546
FT                   /locus_tag="Bind_0007"
FT   CDS_pept        5533..6546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0007"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: nwi:Nwi_0471 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93666"
FT                   /db_xref="GOA:B2IAW6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW6"
FT                   /protein_id="ACB93666.1"
FT                   /translation="MSRNSTIANPPIDQPLPRLRLGTRGSPLALAQAHELADRLARAHG
FT                   FAKEAVAITIIRTSGDMIQDRPLSLAGGKGLFTKELDQALIEGMVDLAVHSAKDLPTIL
FT                   PEDLIIAGYLPREDVRDVWISPKAGHPRDLPPGSVVGTASLRRGALLKRLRPDLEVRLL
FT                   RGNVETRLAKLAAGEVDATLLALAGLRRLGLADKATQVLAIEDFLPAAGQGAIGITTRR
FT                   DDAATLALLAPILDPATHVALAAERGFLTVLDGSCKTPIGAHATVEHDQVTLRGIVLRP
FT                   DGSEWFEACESGPLESGSLEAARELGETAARAILARLPEGFFQESAQENAQKNAKE"
FT   gene            6552..7292
FT                   /locus_tag="Bind_0008"
FT   CDS_pept        6552..7292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0008"
FT                   /product="uroporphyrinogen III synthase HEM4"
FT                   /note="KEGG: xau:Xaut_1159 uroporphyrinogen III synthase
FT                   HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93667"
FT                   /db_xref="GOA:B2IAW7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW7"
FT                   /protein_id="ACB93667.1"
FT                   /translation="MLVLITRPFEEALRSAAKLEGAGYSALLSPVLTMRATGASWPEGV
FT                   VDGVIATSAQAFDLLVLRPEWPLPEALRLMPLWLVGDRTGDAAHRKGFDGPVRLAPHAK
FT                   LLAQEITAALSPPARLIYLAGQDRKPDLEKKLSKAGLTVEAQEIYAAEAVDQLSDIALE
FT                   SLRRNDVGAAMHYSRRSAEIFLGLMRKAELDPATFVHICMSEDVAVPLKDAGCATQVAA
FT                   TSNEEGMLDALKAIAAARESSRES"
FT   gene            7307..8101
FT                   /locus_tag="Bind_0009"
FT   CDS_pept        7307..8101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0009"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:blr6190 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93668"
FT                   /db_xref="GOA:B2IAW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW8"
FT                   /protein_id="ACB93668.1"
FT                   /translation="MVSMIDVAALQSSSVHMPMHRDSALAVEAVSHAYGKRRALDEVSF
FT                   TVAPGHFTVLLGLNGAGKSTLFSLITRLYATQSGAISLFGFNIAHDPGEALRRLGVVFQ
FT                   ARTLDLDLSVAQNLAYHAALHGLSPHEAKQRAAQVLRQVAMGDRADDKVRDLSGGQMRR
FT                   VEIARALLHHPRLLLLDEPTVGLDVKARAEILSHVRALVAKDGVAVLWATHLLDEVDPG
FT                   DDVVILHQGHVLDQGKACEISMRSGIQNIAEVFTRLTGSGGR"
FT   gene            8098..8931
FT                   /locus_tag="Bind_0010"
FT   CDS_pept        8098..8931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0010"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bja:blr6191 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93669"
FT                   /db_xref="GOA:B2IAW9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR022403"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAW9"
FT                   /protein_id="ACB93669.1"
FT                   /translation="MSNGSTAAHGFSLRQYWICLKGIIWRETLRYLHQRERFISALVRP
FT                   LVWLFIFAAGFRAGAGLPSMPPYAGPVPYEIYIAPGLMAVIQLFNGMQSSLSMVYDREM
FT                   GNMRILLVSPFPRWFLLSAKLLAGTMVSLLQVYAFLAIAFFWDIGPPDVWGYVAVLPAL
FT                   ILSGLMLGALGMLLSSLVKQLENFAGVMNFVIFPMFFASTALYPLARVQEGSPKLAFIS
FT                   ALNPFTHAVELIRFAFYEQFEPLALAVVLGATLIFMGGAILAYDPARGMLARRGE"
FT   gene            complement(8947..9345)
FT                   /locus_tag="Bind_0011"
FT   CDS_pept        complement(8947..9345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0011"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: nwi:Nwi_2582
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93670"
FT                   /db_xref="GOA:B2IAX0"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX0"
FT                   /protein_id="ACB93670.1"
FT                   /translation="MIKTVSFSLAAFLSLAGATAVLAAGDPEAGEKIFTTKCKVCHQIG
FT                   PGAKNFVGPELNGLIGRKAGTSEGYTYSDAMKNSGLTWDEATFKDYIKNPKAKLPGIKM
FT                   IFAGLPKESDQDNLTAYLATFDATGAKK"
FT   sig_peptide     complement(9274..9345)
FT                   /locus_tag="Bind_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            complement(9744..10217)
FT                   /locus_tag="Bind_0012"
FT   CDS_pept        complement(9744..10217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0012"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bbk:BARBAKC583_0805 thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93671"
FT                   /db_xref="GOA:B2IAX1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX1"
FT                   /protein_id="ACB93671.1"
FT                   /translation="MSKKLEAGDTAPEFHLPDDRGGTLSLADFAGKKLVLYFYPKDDTS
FT                   GCTKEAIDLNGLKGDFDKAGTNILGVSPDSVASHVKFKTKHKLDLALGSDETKAMLETY
FT                   GVWVEKSMYGRKYMGVERTTFLIGPDGKIAKIWRKVKVPGHAEAVLEAARALA"
FT   gene            10660..14382
FT                   /locus_tag="Bind_0013"
FT   CDS_pept        10660..14382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2985 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93672"
FT                   /db_xref="GOA:B2IAX2"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX2"
FT                   /protein_id="ACB93672.1"
FT                   /translation="MVDHFEDMPKRHASQIAQRSQGLPFHGASPGSDQEAAREPCHDAV
FT                   SPAVPLTHAVPPAHGARKRRFGRKSLFGRRGLARRAVTLCGVLTGLAFITILVGGLFYL
FT                   RIGQRPVLIESLGPRIASALDDRFGHGYRFFLGPTTLTRHGLRPTLSLDGFSLREATGD
FT                   KEDGHDESRETSGNLLLSAPRAEVSIDSWPLLLGKVVPKRLEIFDVVLHLSVTPEGTLA
FT                   LASETHPDAPVVITPTAPPSTADVKNVPPQSGTAGAAARPVLVKQMGSAIRLLVDTLTN
FT                   PESPIAAIDKVGITNGRLIVDDRTSNQTLTFENVTLAFNKKGEKTTFELSVEGPNGRWS
FT                   AGGVASGTPNAPRRLEFQLDHLSLDEILLATGVRLIGADFDTPIAAGFTLALGADDKLL
FT                   EASGHVDLSPGFVRLDDPDAEPMLVDRLDSRFHWDQTTRRVLIDEARLDAGPSHFSFGG
FT                   AMALPRIESEPWTLFLKNLAPVIYGPERPKEQPIVLDDAQFTGRLMPSEKKFILDRFAI
FT                   NSANNGGLAMAGTLDWIDGPHLRLGASINPTPVHTALRLWPSFITAPIRAWSLAHMTEG
FT                   TVQSGTMQLDYDADTLKALRAEQPIPDSAALLDFTITKAAMEFLPGVPALRNIEGTGHI
FT                   TGRTALITLGGGFIETANGQRLLVSDGSFKVEDFAIKPVPAVVAAKISGPAEVVGDLLS
FT                   REALKAYATLPLDPTTIRGQIDGKMQLDMKIGPETGPGDTVLHVNAMVNNFSVDRLLGK
FT                   EKLENATLAVIVEPEGLKATGQGHLFGAQATLDMTRAPGKPAEINASLALDEAARAKMG
FT                   MSMQGLTGTIGAHLATTLANGEKLKGQVELDLTKAGIDGLLPGVSKPLGKPAKINLLAI
FT                   INDEGLTLDQIVVDAGPLQAKGSIDLNADMGLIGGKFGLLRVSPGDDMKAELLRTGDTL
FT                   KVIMRATTLDARPFLKNIVSSPPESGPLAAPSLSHDAAKDMSASIKTVDIDLKADVLTG
FT                   YNKQVLSGADLHLVKQGDDLKQFSCAGRFGRDTIAGNLTPGNANPGSGAPQLSLSTQNA
FT                   GALLSFIDLYKHMERGRLGVTLRFNGETLAGALMIDNFLLRDEPAMRRLVSEAVDQEKG
FT                   ANQRNIDANAVSFHKLQVRFQRSGTRLDLQEGTMYGDAIGLTVDGWLDYVHDRVDMHGT
FT                   FVPAFAVNNLFSQIPVFGILLGGGANEGLFGINYRISGAASAPTLSVNPLSAIAPGFLR
FT                   QMFGVGDQMPAIGQP"
FT   gene            14538..16481
FT                   /locus_tag="Bind_0014"
FT   CDS_pept        14538..16481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0014"
FT                   /product="phosphoesterase"
FT                   /note="PFAM: phosphoesterase; KEGG: aba:Acid345_2127
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93673"
FT                   /db_xref="GOA:B2IAX3"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX3"
FT                   /protein_id="ACB93673.1"
FT                   /translation="MSFMTRILAASKRITASTTALAIALMSAGFSSPSLSAEGPTPSGT
FT                   VTPIKHVIIIVGENRSFDHVFGAYQPPKGETVYNLLSQGIIKADGTPGPNFALAKQYQG
FT                   SLQAPAKYSLVPTSKTPYQVLPAPNTGGTHTAPSDANPPPFASLALATQAESAALLPED
FT                   LQLLTTGASGLPKGVVDTRIANATNLPSGPFQLTPSLPYDAYAAGAVHRFYQNWQQLDC
FT                   SIAHATKKNPSGCLGDLFAWVEVTIGAGSNGKSQPTGFNDETTHEGASALGFYNTNNGD
FT                   MPYFTALAQTYALSDNYHQPVSGGTGANSIMLGTADAIYYTDGQGHVATPPANQIENPD
FT                   PAPSTNNWYTQDGYSGGSYSNCSDPTQPGVGAIISYLRSLPHKPRANCAPGAYYLLNNY
FT                   DPGYNGDGSLHTSNPFTIPPSPVHTIANRLNEKDISWKYYGEGWNSFVANSPLSVYCNI
FT                   CNPFLYQTAVMTNPSARAKNLKDTTDLYSDIASGELPAVSYVKPGGLLDGHPTSSKFDL
FT                   FEAFTKKIILAVQNNPKLWADTAIFVTVDEGGGYYDSGYVQPLDFFGDGPRIPLIVVSP
FT                   YSTGGHVVHTYYDHASLLKFIERNWSLQPITHRSRDNLPNPVAEDENPYVPVNSPAIGD
FT                   LFEMFDFGKKGH"
FT   sig_peptide     14538..14648
FT                   /locus_tag="Bind_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 37"
FT   gene            16797..18278
FT                   /locus_tag="Bind_0015"
FT   CDS_pept        16797..18278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93674"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX4"
FT                   /protein_id="ACB93674.1"
FT                   /translation="MYAPFKKLALWSLILVGVSLVTFLGVRIYDTQRGDPLEPWHEFVP
FT                   HEMTSDALDHASFSAYLDAEKKIFGEIRHHVTEALPERDRVPFNRYFENSPVFPEHFQT
FT                   DWNRSYVLEPEGTPLGAVVLLHGLTDSPYSLRHIARFYRDHGFVAVAIRLPAHGTVPAA
FT                   LTDVTWTDWLAATRLAVREADLRVGPSKPLHLVGFSNGGALALKYALDAIEDPKLRRPD
FT                   RLVLLTPMIGITRFARFAGMAGWPALLPAFAKAAWLGIVPEFNPFKYNSFPVNGARQSF
FT                   QFTQAIQRQIDRMASEGRLTDLAPVLTFQSIVDSTVSTRAIISSFYARLPANGSELVLF
FT                   DINRNAKFGQLLSTASETALTRLLPPAPRPFRTVVISNVDPDSSEAAAVVTEAGATETQ
FT                   SIPLGLSFPQGVFSLSHVALPFPVTDALYGLQPDNSEDFGVHLGAIPPRGERGALIVSL
FT                   DNLLRMSSNPFYPFMIDRIAKGLPAGSETRAKAAP"
FT   gene            complement(18360..19787)
FT                   /locus_tag="Bind_0016"
FT   CDS_pept        complement(18360..19787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0016"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG:
FT                   bur:Bcep18194_C7472 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93675"
FT                   /db_xref="GOA:B2IAX5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX5"
FT                   /protein_id="ACB93675.1"
FT                   /translation="MNTIAATKTKSQPSEILALQRAAFLRDGPPSLDQRRADLKTLKTA
FT                   ILARRSEIERAIESDFGHRPRQETAIMEIMTLIQGIDYLSRNLRRFMRPLRRHVAPQMR
FT                   FASARIEYQPLGVIGIMAPWNYPLSLALMPLATAIAAGNRAMLKPSEFTPAMSSLLAAM
FT                   LTDIFPEEQVAVVTGDAIVGAAFSALPFDHLVFTGSTKVGHAVMRAASDNLVPVTLELG
FT                   GKSPVVVGKDYPLDQAASGIAYGKLANAGQTCIAPDYAMMPADAIEPFVTAYDKAVTAL
FT                   YPEGPAGKDYTSIINEHHSARLKGLLEDARAKGARVIEVGKQPDEAHNRPHTLAPTVVL
FT                   GVNDSMRIMQEEIFGPILPILSYHDIDDVIASINARPRPLALYYFGGNDEDRRKMLMRT
FT                   TSGNVTINNTMMHYAQDDLPFGGIGPSGMGAYHGIEGFRSLSHAKGIFEQGRWNAASLL
FT                   RPPFGKLADTILKVMLG"
FT   gene            19888..20514
FT                   /locus_tag="Bind_0017"
FT   CDS_pept        19888..20514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0017"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_C7473 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93676"
FT                   /db_xref="GOA:B2IAX6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX6"
FT                   /protein_id="ACB93676.1"
FT                   /translation="MQDKTDRPYHHGDLRRVVIETAMAMLHDEKNWQFTLREVARRAGV
FT                   SHAAPYKHFADKAALLAELAMLGFDQLREAMAAAKPLPCPSIQAEFFAVAQAYLRFGVS
FT                   HSALYRLMFSADAGHAGDVHLGERALAAFGLLIDLLERGQREGVFRKRPVRSQAAACWA
FT                   QVHGLTLLTIDGLLLPEKVGPDAPEAALVTLLEGIEISRDEPTGV"
FT   gene            complement(20652..21485)
FT                   /locus_tag="Bind_0018"
FT   CDS_pept        complement(20652..21485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93677"
FT                   /db_xref="GOA:B2IAX7"
FT                   /db_xref="InterPro:IPR007637"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX7"
FT                   /protein_id="ACB93677.1"
FT                   /translation="MQQKDQTLDEVVESLSPLTVDWMDETAANAIARLTDLPKKESYSH
FT                   DDMAALLDGNFDEGLLCARLFLALSKDTMEAELKRELGTGGTGVKRYKAEPDAFLEALE
FT                   RLRLPEAMATAINYKPVWSDILVERLRSGRGSAISGQKRGRGLEDFAEAMVKEVFGDHY
FT                   ETRCTFTGADNKSAKCDVAVPDRYRPRIVIEVKGYGATGSKMTDIIGDLDAIIAAMRRD
FT                   TWLLFVTDGMTWKSRLSDLKKIVERQNQGKIARIYTTKMREEFLADLKSLKQIIG"
FT   gene            complement(21485..22681)
FT                   /locus_tag="Bind_0019"
FT   CDS_pept        complement(21485..22681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0019"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: gme:Gmet_3140 DNA adenine
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93678"
FT                   /db_xref="GOA:B2IAX8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAX8"
FT                   /protein_id="ACB93678.1"
FT                   /translation="MSLARIAQRRPLHASSYFHFGVPFGRHLRHNEAMKPIALTQAENV
FT                   YILQGRPPVGLELPTRAKLYPDLRYMGSKTRLLPWIFETLNLVDFESALDPFSGTGCVS
FT                   YLMKAMGRRVAASDFLNFTSTVARATVENNHVHLDDRAIKRLLDRSPAAHRFIERTFGG
FT                   VFYTPEDLRFLDRVSGNIRQLQNPHQQALAFAALFRSCLKRQPRGVFTISGDLSHYDDG
FT                   RRDLRLSIEEHFLEQIEVYNAAVFDNGRKNQALRSDVFELPRRKVDLVYLDPPYVPRSD
FT                   DNCYIKRYHFLEGLSCYWQGLPVDTSTKVRKIAKKYTPFSYRRTAVDAFDKIFNQFKAN
FT                   KIALSYSSNGYPDLDQLESLMRKYKSTVRIFEKPHRYHFGTHGGVERASVTEYLIVGS"
FT   gene            complement(22725..23990)
FT                   /locus_tag="Bind_0020"
FT   CDS_pept        complement(22725..23990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0020"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: mex:Mext_2987 tyrosyl-tRNA synthetase;
FT                   TIGRFAM: tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93679"
FT                   /db_xref="GOA:B2IAX9"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IAX9"
FT                   /protein_id="ACB93679.1"
FT                   /translation="MSKDIPPASDFLAILTERGFLHQCSDPAGLDEKAKSGGLIAYIGF
FT                   DCTAPSLHVGSLVQIMMLRWLQKTGGKPIVLMGGGTTRVGDPSGKDESRKILTLEEIEA
FT                   NKQGIKQVFSKFVHFGEGKTDALMADNAEWLTALHYIDFLRDVGRHFSVNRMLSMDSVK
FT                   LRLERDQELSFLEFNYMCCQAYDFVELHKRYGCQLQMGGSDQWGNIVTGIDLGRRMGTA
FT                   QLYALTSPLLTTASGAKMGKTAKGAVWLDEAMLPVFDYWQFWRNCEDRDVGRFLKLFTE
FT                   LPLDEIARLEALQDAEINEAKKILATEATAMVHGREAAERAADTARQTFEEGVVAASLP
FT                   SVILQTNEIPAEGLGILAAFAKAGLVNSTSEARRQIKGGGLRLNDQPITDEKAVITIEA
FT                   IEAGAKLSLGRKKHVLLRLADG"
FT   gene            24079..25302
FT                   /locus_tag="Bind_0021"
FT   CDS_pept        24079..25302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0021"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   rpb:RPB_2997 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93680"
FT                   /db_xref="GOA:B2IAY0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY0"
FT                   /protein_id="ACB93680.1"
FT                   /translation="MDAGSLSAELREGQRERLREKPGEKAWGTLVKAIGLMSGTSMDGI
FT                   DIAYVETDGQDVVKCGPSDFAPYSDAERALLRAAMADAAALIGPSSKREERPGCLAEAE
FT                   AMVTQRHAAVVAAFLERDDLADKPIDLIGFHGQTVLHRPEQGLTMQIGDGVALADTLGL
FT                   PVAYDFRAADVAAGGEGAPLVPIFHQALARASGFAGPVLIVNIGGVANVTYVAPGEPLM
FT                   ACDVGPGNAQIDDLMRARCGLAMDPQGAFAARGVVDERILADLLAHPFFRARPPKSLDR
FT                   NAFSSQAIENLSTEDAAATLTAFTAAGIASILPFLPKPPARAIVCGGGARNLVMMEVLR
FT                   QKLGCAVESAEAFGWSVEAMEAQAFAYLAVRRRADLPISFPLTTGVARPLPGGFLALPG
FT                   HDTNGHDR"
FT   gene            25411..25632
FT                   /locus_tag="Bind_0022"
FT   CDS_pept        25411..25632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93681"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY1"
FT                   /protein_id="ACB93681.1"
FT                   /translation="MKLELEFVPPEGEMRSTVRIVLNPVGESPMSGLPLVTMNCKSLEE
FT                   IENQVQAIEKQLGKIRKEAGKFFAIPTK"
FT   gene            complement(25723..26049)
FT                   /locus_tag="Bind_0023"
FT   CDS_pept        complement(25723..26049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93682"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY2"
FT                   /protein_id="ACB93682.1"
FT                   /translation="MSEDREALVKQALADQTRNLERLSDTIVRAAEGRRDLPASLEEVI
FT                   KQIATLTTECGEAVEEHLDDGLSEDTFELLQGALEAIRGGLDSLLVFKALEGSSYETRT
FT                   VAND"
FT   gene            26639..27619
FT                   /locus_tag="Bind_0024"
FT   CDS_pept        26639..27619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0024"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: mca:MCA1165 NAD-dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY3"
FT                   /protein_id="ACB93683.1"
FT                   /translation="MFAARKRILVTGGGGFLGSHLCRRLLGQGHEVLCVDNFFTGRRRN
FT                   IADLMGHDRFEMLRHDVTFPLFVEVDAIYNLACPASPIHYQFDPVQTTKTSVVGAINML
FT                   GLAKRLKIPILQSSTSEVYGDPTEHPQTETYWGHVNPVGSRSCYDEGKRCAETLFFDYH
FT                   RQHKLSIKVARIFNTYGPSMRPDDGRVVSNFICQALLGQDITVYGKGTQTRSFCYVSDL
FT                   IDGLDRLMNSPPEVTGPINIGNPNEFTIRELAEKVIAMTGAKSRIIEKPLPSDDPRQRQ
FT                   PDITLAKNVLGWRPTVELEEGLTHTIAYFDSLLTEEGKSSVSSEG"
FT   gene            complement(27769..28857)
FT                   /locus_tag="Bind_0025"
FT   CDS_pept        complement(27769..28857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0025"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ava:Ava_1119 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93684"
FT                   /db_xref="GOA:B2IAY4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY4"
FT                   /protein_id="ACB93684.1"
FT                   /translation="MDLKKFNLSFYKVTDQFDQPLVSIIISNYNYASYLERCVDSVLSQ
FT                   TYDLIECIIVDDKSTDDSANTLNRIQAAHKNITIIRRAENGGQSAAALDGLKQASGSYV
FT                   IFLDADDVLLPHAVACHVYAHVSMRIPVGFTCADMLQVGGNILMGTSSLPLTNFITTHA
FT                   DRKFQQRSATSEIIPLPPAVPSELLDRIYLVEPWDTGWVWSATSAMMFRRDALRFWENT
FT                   PDFVHLRYSIDAFFCYGINAICGSAIIDMPLAAYRIHGHNGFAARIPLNHVRSYELNSQ
FT                   GERSIDALKLLLKQAQEQKSYYRGLFWSEKQYHSLLKTLKTTLTIIQEANETEPPQSLS
FT                   TSWIIFTQKLYQDFRKWWQRFC"
FT   gene            29298..29627
FT                   /locus_tag="Bind_0026"
FT   CDS_pept        29298..29627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93685"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY5"
FT                   /protein_id="ACB93685.1"
FT                   /translation="MARDEGLEELLREDLQAEPGLTEKTMFGGRAWLLNGNLLCCARDD
FT                   GMLARLGKERDGWALEMPDIVPMKSGGRRMQGWVQAGPSAFGDDVLRRKLMDAALAFVR
FT                   SLPAK"
FT   gene            29947..30522
FT                   /locus_tag="Bind_0027"
FT   CDS_pept        29947..30522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0027"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce2153
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93686"
FT                   /db_xref="GOA:B2IAY6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY6"
FT                   /protein_id="ACB93686.1"
FT                   /translation="MDTRATLLIAALKVLEEEGEAQFSTRSVCAIANVTAPTLYHHYGS
FT                   ADGLLSAAIAEAFTQFLESKKVAVQSTDPVMALCEGWDDYVRFAAARPRLYAAMMSRVL
FT                   EGAQIPAAEQAFALLIERIAAIAAKGRLALAVEVAADLIWASANAASLLYVTAQLRKTA
FT                   PPASAVVENIRESAMQAILNIESKGQSQ"
FT   gene            30519..31511
FT                   /locus_tag="Bind_0028"
FT   CDS_pept        30519..31511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0028"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: pla:Plav_1506 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93687"
FT                   /db_xref="GOA:B2IAY7"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY7"
FT                   /protein_id="ACB93687.1"
FT                   /translation="MKILVTGGTGLLGGRLIPRLVKDGYQIFALTRSASSHDKLKALGA
FT                   SPVDADLESSAPLALPAIDAVVHAAALFRFAGPREPFFRTNVDGTVALLKATEKAGAQT
FT                   FVYISAAGIIMDDAGTPIRGADESAPIFPNHFSAYLASKARAEPLVLAANKPGFRTIAL
FT                   RPPAIWGPGDSFSRELPRVIKSGQFAFIDRGDYAFATCHVDNVVEAVQCALECGEGGRA
FT                   FFINDQERLTFRQFIASLASLQGLSIDKLRSMPYWLASAVGRMLDAIWAMTRREGNPPI
FT                   SRSMIRMIGREFSINDAAARRELGYVGRTSRADGLRSYGTPLRSADRFP"
FT   gene            31894..32730
FT                   /locus_tag="Bind_0029"
FT   CDS_pept        31894..32730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0029"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rme:Rmet_4288 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93688"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY8"
FT                   /protein_id="ACB93688.1"
FT                   /translation="MSNKVALVTGASSGIGEATALKLKDFGYTVYGAARRVDRMQHLTK
FT                   SGIQILAMDVTNDASMQAGIDVIVAEEGRIDVLVNNAGYGSYGAVEDVPIEEARAQFEV
FT                   NVFGAVRLIQLALPHMRAQRSGTIVNITSMGGKIHTPLGAWYHGTKFALEAISDCLRME
FT                   VQPFGIDVVVIEPGGIKTEWAGIAADKLRQTSGHGPYAAQANAMAQSMVGEASVKLQSP
FT                   PQLIADTIAKAVTASKPKTRYAIGFGAKPMIFMRGILSDRAFDGMMRTATGISKVI"
FT   gene            32743..33768
FT                   /locus_tag="Bind_0030"
FT   CDS_pept        32743..33768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0030"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS03889 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93689"
FT                   /db_xref="GOA:B2IAY9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAY9"
FT                   /protein_id="ACB93689.1"
FT                   /translation="MAQVDRCKVPQAFWRAVEHIGVPPVALLRQARLPATLHLGGQAFV
FT                   TTAQYFALMRGLEELSGDPALGLRMVREVDTAVHPPSSLAAFYARDYRDGLARLARFKR
FT                   LCMPEQLQIVEAGGNCTISVDWPFATEAEPAISVDITFASLVELGRRATGKAIMPRRVE
FT                   FARPGPASTAHADYFGCLIRTGTHDLLVLDAADLDRPFPGHNPEMLEMLTPALSAALGE
FT                   LEAQSSVAEQVKIVLKRCLASGQPGLSDIARQLGMSDRTLQRRITEEGSTFRGLLAEAR
FT                   RDLGRRLLTDPATDIDEVACLLGYHDTTSFYRAFREWEGMPPNRWREMHLPKGAAVIGL
FT                   Y"
FT   gene            33829..34503
FT                   /locus_tag="Bind_0031"
FT   CDS_pept        33829..34503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0031"
FT                   /product="Male sterility domain"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: nar:Saro_1849 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93690"
FT                   /db_xref="GOA:B2IAZ0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ0"
FT                   /protein_id="ACB93690.1"
FT                   /translation="MMQRILLAGSTGLVGALVGARLATRSDIDLVALVRRGSSAPGSGI
FT                   DFERLCDAPEAMLKPIVSDGIDVAISCLGTTIRTAGSQSAMFRVDHDYVLAAARGARAL
FT                   GARQFILVTAAGAGGPGFYLQTKGAIERAVIDLGFDRVDLIRPGFLLGSRSERRVWEAI
FT                   GQRLFAALTPVLLGPLSRYGAIPAETVAEAIVGLVGREETGRYIHHNADLRRIGRREHA
FT                   VP"
FT   sig_peptide     33829..33900
FT                   /locus_tag="Bind_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.552 at
FT                   residue 24"
FT   gene            complement(34593..35495)
FT                   /locus_tag="Bind_0032"
FT   CDS_pept        complement(34593..35495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0032"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   kra:Krad_2789 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93691"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ1"
FT                   /protein_id="ACB93691.1"
FT                   /translation="MSGNWTEQNISDQHGRIAIVTGGNTGLGFETARMLAAHGAKVVLA
FT                   VRDVEKGGQAAARIAGDVAVQALDLTSLDSIRSAAADLRAAYPRIDLLINNAGVMYTPR
FT                   QTTSDGFELQFGTNHLGHFALTGLLIDRLLPVPGSRVVTVSSTGHRIQAAIHFDDLQWE
FT                   RSYSRAGAYGQSKLANLMFTYELQRRLAPHGATIAVAAHPGVSNTELIRNLPAAFRGPI
FT                   RWLAPLLTQKPEMGALPTLRAATDPAVLGGQYYGPGGWGEVRGYPKLVTSSADSYDQAV
FT                   QRRLWTVSEELTGVTFPVR"
FT   gene            35593..36258
FT                   /locus_tag="Bind_0033"
FT   CDS_pept        35593..36258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0033"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_2790
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93692"
FT                   /db_xref="GOA:B2IAZ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041483"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ2"
FT                   /protein_id="ACB93692.1"
FT                   /translation="MTFQRARNEEQREARRRLILDTAVAMLDEMPLAEVSLNELSRRVG
FT                   LAKSNVLRYFESREAVLLELLDDFLGRWLVDLAAELAGGIDAQAAPELRAAQLAEILSS
FT                   SLADRPALCDLFGAQGGVLEHNVSVEVIKRHKRSSLGRLATMTELVRHHVPELGDGAQM
FT                   FCLMSLLSAGALSAYVPPPPSLLAAYADEPALGALHMELRDALRASFTSTLLGVLPRA"
FT   gene            complement(36650..37558)
FT                   /locus_tag="Bind_0034"
FT   CDS_pept        complement(36650..37558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0034"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   gbe:GbCGDNIH1_1155 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93693"
FT                   /db_xref="GOA:B2IAZ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ3"
FT                   /protein_id="ACB93693.1"
FT                   /translation="MTRTKANDIELAWDSFGNSTDETILLISGLGAQMLRWTVPFCEAL
FT                   AAMGYRVIRFDNRDAGCSTHFSASAPPDFGALAVALMAGRRPDVPYTLHDMAADATGLL
FT                   DALGIARVHAVGRSMGGMIAQVLASEHADRVLSLTSIMSSTGNPALPQAAPDMMAMMMR
FT                   PAPDPAVDPDGFLAVRLAFARRIAGTAYPFDEDVHRALLLEEAGRCYDPAGIARQIAAM
FT                   AVAGDRRARLATITAPALVIHGTVDPLIPLACGHDTALSIPNAIHRPIEGMGHDLPPEL
FT                   DQTVINAICDVAKKGSHHPGA"
FT   gene            complement(37555..38016)
FT                   /locus_tag="Bind_0035"
FT   CDS_pept        complement(37555..38016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0035"
FT                   /product="conserved hypothetical secreted protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1154 hypothetical secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93694"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ4"
FT                   /protein_id="ACB93694.1"
FT                   /translation="MSRSEPLSYIEPTQEAGRLFMQRGLTGPIAMLNLLKFRDAADYSA
FT                   HPELAPAMPISGAEAFNRYVRHTLPYLRETGGDVLFLGAGGGFLIGPADERWDMAMLVR
FT                   QASVASFLSFAGNEGYLVGLGHRAAAIEDSRLLPLSELRLPLSPNGTSS"
FT   gene            complement(38013..38675)
FT                   /locus_tag="Bind_0036"
FT   CDS_pept        complement(38013..38675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0036"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1153 hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93695"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ5"
FT                   /protein_id="ACB93695.1"
FT                   /translation="MSDSLTKPCTAFTGRQLLFSGPLADVAIAVARSAGTADAVLVFDD
FT                   ATGCVVDLDLRGSDAEILERLSEPPKPHAGRYRPKADATSGNGEPEDGQRGRGRPKLGV
FT                   VAREVTLLPRQWEWLATQPGGASATLRRLVDDARKALHPRQQRRAAQEAAYRFMQAIAG
FT                   DLHGYEEATRALFADNRSALEERIAAWPEDIRAYAMRLAFGSSTHPDQDRTTGEKRQ"
FT   gene            39217..40068
FT                   /locus_tag="Bind_0037"
FT   CDS_pept        39217..40068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0037"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: msm:MSMEG_1114 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93696"
FT                   /db_xref="GOA:B2IAZ6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ6"
FT                   /protein_id="ACB93696.1"
FT                   /translation="MSEKIWFITGASRGFGRIWAEAALERGDKVAATARNTESLSELAS
FT                   RFGDKVLPLQLDVTDADGVRRAVADAHRHFGRLDVVLNNAGYALVGAIEEVDEKDLRAE
FT                   LDTNVFGMLRVIQASLPYLRAQGSGHIVSVSSVAGIVANPIAGAYNMSKWAVEAMHEAL
FT                   AQEVEGFGIKVTLIEPGAYATDFASATSLKISEGLEAYAPLREQAFTAGAKMEFGDPRA
FT                   TAAAILKLVDVETPPLRFFLGTEGLPVARAAYSARLSAWEAWEAESNAAQGNGKQHTIA
FT                   TL"
FT   gene            40125..40589
FT                   /locus_tag="Bind_0038"
FT   CDS_pept        40125..40589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0038"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS03893 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93697"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ7"
FT                   /protein_id="ACB93697.1"
FT                   /translation="MHTLTASRRSLLFGALAMTTLAIAGPAFAQQTSQDAILGKWAADD
FT                   GSVKLEMFKSGAEFWAHLLFGNQIMEADNTTFKKDTKNPDPTLRSHSLENIVFIHGLHW
FT                   DNGEWTGGSLYDASSGSTYKCKVEMKGNKMLLRGYLGISLLGQTREFHRF"
FT   sig_peptide     40125..40214
FT                   /locus_tag="Bind_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            40669..40974
FT                   /locus_tag="Bind_0039"
FT   CDS_pept        40669..40974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_0915 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93698"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ8"
FT                   /protein_id="ACB93698.1"
FT                   /translation="MPAARTAYAARLVKWKAWAQSSVAILAGSFWHLRTGGSFYQFTYG
FT                   PRCPVPRPIPDRLGLKASFVGKTMQNVPPAAVYRIVHRPPFSAPAPLAASDDGKTG"
FT   gene            41211..42062
FT                   /locus_tag="Bind_0040"
FT   CDS_pept        41211..42062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0040"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rme:Rmet_4288 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93699"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IAZ9"
FT                   /protein_id="ACB93699.1"
FT                   /translation="MTTKVALVTGASSGIGESTALKLKELGCTVYGAARRVDRMQHLTK
FT                   SDIRILAMDVTDDASMQAGIDKIIAEEGRIDVLVNNAGYGSYGAVEDVPIEEARAQFEV
FT                   NVFGAVRLIQLALPHMRAQRSGTIVNITSMGGKIHTPLGAWYHGTKFALEAISDCLRME
FT                   VQPFGIDVVVIEPGGIKTEWAGIAADKLRQTSGHGLYAAQANAMAQSMIGDASVKRQSP
FT                   PQIIADTIAKAVTASKPKTRYAIGFGAKPMIFMRGILSDRAFDGMMRTATGISKALKGQ
FT                   KV"
FT   gene            42077..43486
FT                   /locus_tag="Bind_0041"
FT   CDS_pept        42077..43486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0041"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: cak:Caul_4341
FT                   aldehyde dehydrogenase_"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93700"
FT                   /db_xref="GOA:B2IB00"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB00"
FT                   /protein_id="ACB93700.1"
FT                   /translation="MRDILKNYIDGAWVASAGVDTRDIINPATGQVSGRMALSTAEDVK
FT                   RAVAVARQAFAGYSRTSVEERATLLNRIAEVHEARAEDMAQAVTLDIGMPIAFARMTVG
FT                   AGTGQFRFLAKAIGDYPFALVQGGTRIVKEPIGVAGLIPPWNYPSLQSAEKIAPALAAG
FT                   CTMILKPGTPYTNQVLAEILDEAGVPKGVFNLVNGRGSVIGMAFSRHPDVDMIAFTGST
FT                   GVGIQVQKDAAETVKRVSLELGGKSPHIILPDADFEAAAKGAVAKVMSNSGQTCAAPTR
FT                   TLVPRAHKAELEAMIRTAAEAIRVGDPLTDVDMGPVANEAQWHTVQRYIQSGIDEGATL
FT                   LAGGPGHPEVADEGWFARPTVFADVRNDMTVAREEIFGPVMSLIAYDTVDEAVEIANDT
FT                   PYGLAAYVDGSDDKTVQDVASRLRAGQVILNGAQPDLQAPFGGYKQSGNGRIWGLAGLE
FT                   EYLETKAIVGV"
FT   gene            43489..44523
FT                   /locus_tag="Bind_0042"
FT   CDS_pept        43489..44523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0042"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS03889 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93701"
FT                   /db_xref="GOA:B2IB01"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB01"
FT                   /protein_id="ACB93701.1"
FT                   /translation="MAQVDKCKIPQAFWRAAEQFDIPSAALLRQARLPATLHLGTQVFV
FT                   TTAQYFSLMQAMADLSGDSALGIRMVQSVDTAVHPPSSLAAFYARDYRDGLTRLARFKR
FT                   LCTPEQLQVVEAGGDCTISTEWPFAAAAEPSISVDITFATLVELGRRATGRTIVPRRLE
FT                   LTRPGPIDAIHAEYFGCPIRTKAPRNLLVLDAADLDRPFPGHNPEMLEMLTPALGAALG
FT                   ELEAQSSIAEQVKIVVKRSLASGQPGLSDVAKQLGMSDRTLQRRITEEGSTFRDLLSEA
FT                   RRDLGRHLLTDPATDIDEVACLLGYQDTTSFYRAFREWEGMPPNRWRETNMNRPRALET
FT                   AGLH"
FT   gene            44583..45068
FT                   /locus_tag="Bind_0043"
FT   CDS_pept        44583..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0043"
FT                   /product="male sterility domain protein"
FT                   /note="KEGG: pla:Plav_0855 male sterility domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93702"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB02"
FT                   /protein_id="ACB93702.1"
FT                   /translation="MTRRILLAGSTGLVGGLVGTRLAGTPEVDLIRLVRNGASGYGHAI
FT                   NFERLCQEPAGHWSRSHPTASISLSPAWGRPIATAGSQAAMFRVDHDYVLAVAQGARAL
FT                   GARQFILVTAAGAGGPGFYLQTKGKIEQAVTALGFKRVDIIRPGFLLGTRGERRCGK"
FT   sig_peptide     44583..44654
FT                   /locus_tag="Bind_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            45089..45247
FT                   /locus_tag="Bind_0044"
FT   CDS_pept        45089..45247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93703"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB03"
FT                   /protein_id="ACB93703.1"
FT                   /translation="MLTPILVGPLSRYGAVPADTVADAIVTLIGQAAPGCNVHENNNLR
FT                   RLAAPAR"
FT   gene            complement(45447..45536)
FT                   /locus_tag="Bind_R0001"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(45447..45536)
FT                   /locus_tag="Bind_R0001"
FT                   /product="tRNA-Ser"
FT   gene            complement(45890..46147)
FT                   /locus_tag="Bind_0045"
FT   CDS_pept        complement(45890..46147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_1076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93704"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB04"
FT                   /protein_id="ACB93704.1"
FT                   /translation="MVMTQIANTGEFLPLHHDQSETDQEKALRRVADAVHRVNEAIIRA
FT                   VSAGVSVELVRTSRFHDGSGNWGDQMIPMIRATATAEDKH"
FT   gene            complement(46376..46528)
FT                   /locus_tag="Bind_0046"
FT   CDS_pept        complement(46376..46528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93705"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB05"
FT                   /protein_id="ACB93705.1"
FT                   /translation="MGEFRPVQETTETEQQKAIRRVADAVTVAVTGSTSTLAESTETAQ
FT                   FKAAE"
FT   gene            complement(46724..48316)
FT                   /locus_tag="Bind_0047"
FT   CDS_pept        complement(46724..48316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0047"
FT                   /product="isocitrate lyase and phosphorylmutase"
FT                   /note="PFAM: isocitrate lyase and phosphorylmutase; KEGG:
FT                   swi:Swit_2926 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93706"
FT                   /db_xref="GOA:B2IB06"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB06"
FT                   /protein_id="ACB93706.1"
FT                   /translation="MSYQDQITEVSQLIKSKNGTWDGINAEAVVRMRLQNRFKTGLDIA
FT                   KYTAAIMRRDMAAYDADTTKYTQSLGCWHGFIGQQKVISIKKHFGTTERRYLYLSGWMV
FT                   AALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADARELNDIFRAIDAARKAGDSAKA
FT                   KELLTQAENHQTHVIPIIADIDAGFGNAEATYLLAKKMIEAGAGALQIENQVSDEKQCG
FT                   HQDGKVTVPHEDFLAKVRACRYAFLELGVDDGIVVTRTDSLGAGLTKQIAVSHKPGDLG
FT                   DQYNSFLDVEEVPAGGGANGDVIINRDGKLFRPKRLPSNLFQFRKGTGEDRCVLDSITS
FT                   LQNGADLLWIETEKPHVEQIAGMMDRIRAVIPNAKLVYNNSPSFNWTINFRQQVYDAWK
FT                   EAGKDVSAYDRAGLMDVKYDGSDLAAEADEKIRTFQADASKRAGIFHHLITLPTYHTAA
FT                   LSTDNLAKEYFGEQGMLGYVLNVQRQEIRQKIACAKHQNMAGSDIGDDHKEYFAGEAAL
FT                   KAGGADNTMNQFG"
FT   gene            48563..50029
FT                   /locus_tag="Bind_0048"
FT   CDS_pept        48563..50029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0048"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: rpe:RPE_1394 transcriptional
FT                   regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93707"
FT                   /db_xref="GOA:B2IB07"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB07"
FT                   /protein_id="ACB93707.1"
FT                   /translation="MSQTLAHSAGQADASRKIFAGPRLKRLRRERQITQARMAEELNVS
FT                   PSYLNLMERNQRPITVQVLIRLTDVYGVDPRDFLSVEAEQSLGEMDQILADPLFREVPI
FT                   PRAEMQDAAEHAPAMLSALVRLYRAYSAAREAGEAGAFTGLDPDRAEPVLTDNPIDRVR
FT                   AILNEARNHFPEIEAAAETFAADLALTGHELFYGLSEYLRAHHNIRVRPLPLEVMGDRL
FT                   RWYDHHRRQLMISEVMDQPGRTFQAAYQLGLVKFGGLLDEIAGRLETSDETSRRLLRVT
FT                   LANYFAGALMMPYGRFHDAAELLGYDIDVLAARFGASIEQVAHRLTTLSRPTLRGIPFF
FT                   MVRVDMAGNVSKRFSSGRFPFAHSGGTCPLWNVHAAFSDPGRILTQIIELTDGSQWFSI
FT                   ARTVRRSVTPWGAIEPRFAIGLGCEIKYARRLIYAKGHDLETVDATPVGVNCRLCDRQA
FT                   CPQRSAPPALRHLRVDENMRNVSPITFNEL"
FT   gene            50242..50538
FT                   /locus_tag="Bind_0049"
FT   CDS_pept        50242..50538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3894 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93708"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB08"
FT                   /protein_id="ACB93708.1"
FT                   /translation="MVLAGLCLLGLGVAGCGRRGPPEPPPGALSAPSEQAVQEANPYSG
FT                   SRYGGVEQSDGGSATIGGVGGPAIGQALDQPNQPVQSKSQGKPKKSFFLDPLL"
FT   gene            50754..52025
FT                   /locus_tag="Bind_0050"
FT   CDS_pept        50754..52025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0050"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: atc:AGR_L_2454
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93709"
FT                   /db_xref="GOA:B2IB09"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB09"
FT                   /protein_id="ACB93709.1"
FT                   /translation="MHHFALRNGVMHAEDVDLERLAETIGTPFYCYSTATITRHYEVFK
FT                   AAFAGQDSLVCYAMKANSNQAVLQTLARLGAGMDVVSEGELRRARAAGVPADRVTFSGV
FT                   GKTEREIALALDEGIFCFNVESEPELAAISALAVARNKTAHIALRVNPDVDAKTHAKIA
FT                   TGKSENKFGIPISRAREVYRMAKNLPGIAITGVDLHIGSQITDLTPFDHAFARAAEFVA
FT                   LLRADGHAIDHVDLGGGLGIPYHSGDDPETYHPDLYAGIIKKRLGGLGLKLVLEPGRLI
FT                   VGNAGVLVTRVLYVKQGENKTFVIVDAAMNDLVRPTLYEAHHEIAPLRPPLQDAPGVVA
FT                   DIVGPVCETGDYLALARRMPEPRPGDYLAILSAGAYGAVQACTYNTRLLVPEVLVKGAA
FT                   YAVVRPRGTYEELIGLDKIPAWLE"
FT   gene            52060..54639
FT                   /locus_tag="Bind_0051"
FT   CDS_pept        52060..54639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93710"
FT                   /db_xref="GOA:B2IB10"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB10"
FT                   /protein_id="ACB93710.1"
FT                   /translation="MAITQAPGTDPRPAETAAATTRLDELVRRARANLVWELVWRGFMP
FT                   PLLVLGAFVLVSFAGVWLVLPPRGRLLGCIAFALIFLSACLPMLKWRWPTRRQALERIE
FT                   QVSGLDHHPALVLEDRLANPGQDPATEVLWALHRRRAATAIAAMRTGWPAPRLVERDPY
FT                   ALRALVLVGLVATGFIAGPQKYARVAAAFDWGLAAPSAIPSRLDAWIDPPPYTGRAPIL
FT                   LTAGDPRPGPKLEVPVGSTLIIRSAGWGAAFELKGAAVEVSEPDKANLGETERLAPHEA
FT                   SAGDEREKRFTLNGDATLSLQHGGLSRGTFQLIALPDKPPRITLAEVPRVNARGSLTLG
FT                   YRISDDYGVASAEAEFTEPRLDGEHGPIRSLVDPPKMPLLLPTAPGGLGDAETTGDLSD
FT                   HPWAGARVKMVLKAHDEGGNEGQSPPLELILPQKPFLNPLAAALVEQRRDLVLMPSERA
FT                   KVMTALESLMIAPDAFGMPPAPYLGLRVAIDWLQGARTDADLLEVADYLWEMALRIENG
FT                   DLNDAERDLRAAEQQLREALERHAPPEEIEKRTEALRRAMETFLGELARLQQSEEGGQQ
FT                   AKVDPRAQKIAPKDLQAMLDHMREAARSGDQAEAQKMLDRLRNILDNLRMGRRAKPDPH
FT                   AAEANRSIDALNKMSREQQDLRDDTYRGNDEMSLQDFENFDEKNKKGRNAGEEELQRRQ
FT                   QQLRQRLDEVQKRLKQTGQGEKSLDDAEQAMKEAEDALGQGPDGREDAADAQGRALQSM
FT                   RQGAEKLAESLQRRQGEQGSGEGEAEGQAEGEEEGPSNQGRRGSSDPLGRPTAGNPVFN
FT                   PGAKFDPLGVPAAQRAQQVLEELRRRLSDPHRPREETDYLERLLRPF"
FT   gene            complement(54725..55258)
FT                   /locus_tag="Bind_0052"
FT   CDS_pept        complement(54725..55258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0052"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mex:Mext_2002 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93711"
FT                   /db_xref="GOA:B2IB11"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB11"
FT                   /protein_id="ACB93711.1"
FT                   /translation="MNQKQKHCLRLFSIALSLCGLVPTGSASPSAREIVKFSPDYPAGM
FT                   IVIKQSERKLYLITGDGTAIRYPIAIGKTGKAWKGEAFVAGKFVQPAWSPPEVVRHDHP
FT                   NFPDVIPGGAPNNPMGAAAITLNLSEVAIHGTTDTMRKSVGTAASYGCIRMYNEDVLDL
FT                   FERVDVGTRVVAVP"
FT   sig_peptide     complement(55163..55258)
FT                   /locus_tag="Bind_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.626 at
FT                   residue 32"
FT   gene            complement(55508..57445)
FT                   /locus_tag="Bind_0053"
FT   CDS_pept        complement(55508..57445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0053"
FT                   /product="acetate--CoA ligase"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: xau:Xaut_1479 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93712"
FT                   /db_xref="GOA:B2IB12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IB12"
FT                   /protein_id="ACB93712.1"
FT                   /translation="MSDKTYPVSAYWNERAYINAAKYKDMYKRSIEEPDLFWGEEGKRI
FT                   DWIKPYTKVKNTSFDPANVDIRWFEDGITNVAYNCIDRHLATRGDQTAILFEGDDPADS
FT                   RAITYKELHDSVCRLANVLKAHGVGKGDTVSLYLPMIPEAAFAMLACARIGAIHSVIFG
FT                   GFSPDSLAGRIEGCRSKVLITADEGLRGGRKVPLKANADLAIAKTGDIVQTMIVVTRTG
FT                   GAVDWVEGRDVRYEEAIAAASPECPLTEVEAEHPLFILYTSGSTGAPKGVVHCTGGYLV
FT                   YASMTHQYVFDYHDGDVYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSVSRF
FT                   WEVIDKHKVTIFYTAPTAIRALMGSGEAPVKKTSRASLRLLGSVGEPINPEAWEWYHRV
FT                   VGEERCPIVDTWWQTETGGILITPLPGATPEKPGSATLPFFGVKPQVVDATGAVLEGVC
FT                   EGNLVIADSWPGQMRTIFGDHDRFVQSYFSTYPGKYFTGDGCRRDADGYYWITGRVDDV
FT                   INVSGHRLGTAEVESSLVAHELVSEAAVVGYPHDIKGQGIYAYVTLMNGIEPSDRLRTE
FT                   LVTWVRKDIGPIATPDVVHFATGLPKTRSGKIMRRILRKIAEKEFSALGDVSTLADPTI
FT                   VDDLIRNRLG"
FT   gene            complement(57445..57657)
FT                   /locus_tag="Bind_0054"
FT   CDS_pept        complement(57445..57657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93713"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB13"
FT                   /protein_id="ACB93713.1"
FT                   /translation="MVAKKGFPGLEKTLRLDLQRGLETYRGNDNDTVKRLYNSTLHAFQ
FT                   CVHWKRFPLKLLTSGEADNTLGEDA"
FT   gene            complement(58350..59234)
FT                   /locus_tag="Bind_0055"
FT   CDS_pept        complement(58350..59234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: azc:AZC_1149 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93714"
FT                   /db_xref="GOA:B2IB14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB14"
FT                   /protein_id="ACB93714.1"
FT                   /translation="MDWDKLRIFHAAAKVGSFTHAGSMLGLSQSAVSRQVGALEGDLQV
FT                   PLFHRHARGLILTEQGEVLYRTVQDVMAKLDQARTRLNESRERPNGDLRITTNVAIGTG
FT                   WLTPRLGEFLDLYPDIRLHLILTDEELDLGMRAADVALRLREPVQPDLIRRRLFTVHYH
FT                   LYASVDYVKYHGQPQRIEDLDDHRLISYDAAAASYLDDLNAPLHIGRNAKHPRLSALSV
FT                   TNIIALQKAVEQGVGIGVLPDYLKTSQVVQIMTDAVTPELECYLVYPEELKSVARIQVF
FT                   RDFLVSSAQRWNF"
FT   gene            complement(59373..60353)
FT                   /locus_tag="Bind_0056"
FT   CDS_pept        complement(59373..60353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0056"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   mex:Mext_1092 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93715"
FT                   /db_xref="GOA:B2IB15"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB15"
FT                   /protein_id="ACB93715.1"
FT                   /translation="MSAASLSPLHARLIIIGSGPAGYTTAIYAARAMLEPVLISGIETG
FT                   GQLMITTDVENYPGFAEPIQGPWLMEQMRTQAEHVGTKLIADHVIKVELGQRPFRLIGD
FT                   SGQIYTADSLVIATGAKAKWLGLPSENTFKGYGVSACATCDGFFYRGKDVFVVGGGNTA
FT                   VEEALYLSNLASKVTIIHRGERFRAERILQERLFKQDNVEVLFNQAIEEICGTDQPLNV
FT                   THVRLKNTKTGAIETRETHGVFVAIGHQPASELFAGQLTMKANGYLWTAPDSTATNIPG
FT                   VFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLLAEGELRHAAAE"
FT   gene            complement(60563..61072)
FT                   /locus_tag="Bind_0057"
FT   CDS_pept        complement(60563..61072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0057"
FT                   /product="protein of unknown function DUF992"
FT                   /note="PFAM: protein of unknown function DUF992; KEGG:
FT                   azc:AZC_3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93716"
FT                   /db_xref="InterPro:IPR009333"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB16"
FT                   /protein_id="ACB93716.1"
FT                   /translation="MNRKIFSKASLIMAMGLGTIAPALAQQPQAGLLEVGVLECNISPG
FT                   VGFVITSNRALSCSFRPHRRHLPVENYTGTIQHFGLDIGATGPGKLIWTVVSTGGPIKQ
FT                   RYPLAGVFTGAVSSFAIGGGIGANALIGGNARSFTLQPVSLTAQSGLNLAAGVGTLTLE
FT                   PVPSVK"
FT   sig_peptide     complement(60995..61072)
FT                   /locus_tag="Bind_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            61410..61811
FT                   /locus_tag="Bind_0058"
FT   CDS_pept        61410..61811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0058"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: azc:AZC_1144
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93717"
FT                   /db_xref="GOA:B2IB17"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB17"
FT                   /protein_id="ACB93717.1"
FT                   /translation="MVISLRQFSTFAGVGLCAAVVHYGLLIVLVEAMGVDVIIATLVGY
FT                   CGGGICSYWLNRRHTFQSERRHREAIWRFILVAAVGFGLTWLCMLGLVRGLKIPYLLAQ
FT                   ALTTGIVMVWSYGAHKVWTFGLPKPQEGA"
FT   gene            complement(61823..62071)
FT                   /locus_tag="Bind_0059"
FT   CDS_pept        complement(61823..62071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93718"
FT                   /db_xref="InterPro:IPR019226"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB18"
FT                   /protein_id="ACB93718.1"
FT                   /translation="MSFEAGDIVQLKSGGPAMTVSGSSAEGIHCLWFAEISGEVKSAVI
FT                   PPICLELIVLDDDEDLDDEEIEDDEPLPISSGRRRRQ"
FT   gene            complement(62473..63378)
FT                   /locus_tag="Bind_0060"
FT   CDS_pept        complement(62473..63378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0060"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   mex:Mext_0673 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93719"
FT                   /db_xref="GOA:B2IB19"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB19"
FT                   /protein_id="ACB93719.1"
FT                   /translation="MTPSILEACKAKAKPWFESLQDAIIAAFEKIEAEAPGPFLDDQTP
FT                   AAGRFTKQPWTRKNPDGEDGGGGFMGLLKGRVFEKAGIHASTVFGRFAPEFASQIPGAE
FT                   ADPRFWASGLSLIAHPVNPNVPTVHMNTRFVVTSKGWFGGGADLTPMLDRRRMQNDKDA
FT                   IDFHAAMREACDKHKDVADYPRLKDWCDEYFYLKHRNEPRGIGGVFFDYFDCPDETIFD
FT                   ANFAFAQEIGRAFLAIYPEIVRRNWAQPWTEADRDEQLVRRGRYVEFNLLYDRGTIFGL
FT                   KTGGNVEAILSSLPPVVKWR"
FT   gene            complement(63730..64293)
FT                   /locus_tag="Bind_0061"
FT   CDS_pept        complement(63730..64293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0061"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr7984
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93720"
FT                   /db_xref="GOA:B2IB20"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB20"
FT                   /protein_id="ACB93720.1"
FT                   /translation="MSSSSREAILAAAKRTAQAHGYAGLNFRDLADEVGIKAASIYYHF
FT                   PSKADLGAAVARRYWEDTASALESMLAETSDPVRCLRRYPEVFRKALATGNRMCLCSFM
FT                   AAEYDDLPEAVKQEVQAFADVNVAWLSRLLSAAALVSDGESEQRARAIFAAVAGAQLIA
FT                   RSRSDIALYDSLIDSYRAVALLPA"
FT   gene            64407..65102
FT                   /locus_tag="Bind_0062"
FT   CDS_pept        64407..65102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0062"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:bll7983 glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93721"
FT                   /db_xref="GOA:B2IB21"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR034346"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB21"
FT                   /protein_id="ACB93721.1"
FT                   /translation="MSSDITPFDVIKLPRMKIYDFPTGPYPARVRIALAEKNLQSRVRF
FT                   EMVDLYKGEHKKPAFIATKNYSGTLPVLELDDGTLIAECTAITEYLDALDGAPTLTGRT
FT                   PREKGLIHMMSKRAELELLDAISVYFHHATPGLGPDVEIYQNAEWGLRQRDKAVRGMHY
FT                   FDGVLRTQPFVAGEIFSMADITVIGGLIFAEIVKLPVPAECEALQAWYARMQERPSVKN
FT                   RVTMSEPAT"
FT   misc_binding    65287..65391
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 52.49"
FT   gene            65496..67340
FT                   /locus_tag="Bind_0063"
FT   CDS_pept        65496..67340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0063"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   acr:Acry_0965 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93722"
FT                   /db_xref="GOA:B2IB22"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB22"
FT                   /protein_id="ACB93722.1"
FT                   /translation="MNIQHKRSSLVPETVTCGPLPGSRKVYHHPQSHPELSVPFREIAL
FT                   DPASGEPPVRVYDASGPYSEENFKPDLAKGLPRTRAVWLEKRAGHESYAGRAVKPEDNG
FT                   SVSADRLVPPCPANAAPLRGRTGALVTQYEFAKAGIITEEMIYAAARENLGREQAVEGA
FT                   AARLKDGESFGASIPEFVTPEFVRDEIARGRAIIPANINHPELEPMVIGRNFLVKVNAN
FT                   IGNSAVTSSVAEEVEKLVWAIRWGADTVMDLSTGRNIHNIRDWIMRNAPVPIGTVPIYQ
FT                   ALEKVDGDPIKLTWEIFRDTLIEQAEQGVDYFTIHAGVRLAHVPLTAKRTTGIVSRGGS
FT                   IMARWCLAHHKESFLYEHFDEICDIMRAYDVSFSLGDGLRPGSIADANDAAQFAELETL
FT                   GELTKIAWAKGCQVMIEGPGHVPIHKIKINMEKQLKECDEAPFYTLGPLTTDIAPGYDH
FT                   ITSGIGAAMIGWFGCAMLCYVTPKEHLGLPDRDDVKVGVITYRIAAHAGDLAKGHPAAQ
FT                   IRDDAVSRARFDFRWQDQFNLGLDPETAAHFHDETLPKDAHKVAHFCSMCGPQFCSMKI
FT                   TQDLRVEAAAMAEEEAKREQGMAEKSAEFLEKGGKLYV"
FT   gene            67663..67932
FT                   /locus_tag="Bind_0064"
FT   CDS_pept        67663..67932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93723"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB23"
FT                   /protein_id="ACB93723.1"
FT                   /translation="MATQEIALLWVPEGLEPLTSCDKYDPTKREYFSTLHEAVGKAVSE
FT                   RVHQKTERLLPWLRAGSGEGAVVFNIQGILLLKAAYEEGLDAKS"
FT   gene            68109..69485
FT                   /locus_tag="Bind_0065"
FT   CDS_pept        68109..69485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0065"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: rme:Rmet_5902 ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93724"
FT                   /db_xref="GOA:B2IB24"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB24"
FT                   /protein_id="ACB93724.1"
FT                   /translation="MPYSSTIAGTHYCFPDLRTLLARASPLRAGDRLAGLTADTDAERV
FT                   AARMTLADLPLKTFLNEPLIPYEQDEVTRLIVDTHDAEAFAPVAAMTVGEFRDFLLSDA
FT                   TTTESLAKLAPGLTPEMAAAVSKLMRNQDLIAVARKISVITHFRTTIGLPGRLSVRLQP
FT                   NHPSDDLAGIGASILDGLLYGCGDACIGINPATDSAAQALTLLQRIEELRLRFDIPIQA
FT                   CVLAHVTTTLDVIAQGGPVDLVFQSIAGSEAANRAFGVDLPLLDEAHAAVRGLNRADAS
FT                   ANLLYFETGQGSALSSDAHYDVDQQTMEARAYAVARRYSPLLVNTVVGFIGPEYLYDGK
FT                   EIIRAGLEDHFCGKLLGLPMGVDVCYTNHAEADSDDMDNLMTLLGVAGCTYIMGVPGAD
FT                   DIMLGYQSTSYHDALYLRSVLGLKPAPEFEAWLLKMGIMDSQSRIRPALQAQKLLAAFP
FT                   "
FT   gene            69482..70237
FT                   /locus_tag="Bind_0066"
FT   CDS_pept        69482..70237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0066"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   sma:SAV4545 ethanolamine ammonia-lyase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93725"
FT                   /db_xref="GOA:B2IB25"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB25"
FT                   /protein_id="ACB93725.1"
FT                   /translation="MSDPYADPWVFLREKTPARIALGRCGDGLPTARLLEFQRDHARAR
FT                   DAVHAALDSEKLCSELDPLKPIIVQSQARDRALYLQRPDLGRRLDEASREKLREGFYDI
FT                   SLVLADGLSALAVQSQAARLGALIEKRLPLRFAPPVIALQARVALGDEIASALGARLVI
FT                   VLIGERPGLSAADSLGAYITFAPVPGKTTDAQRNCISNIRPGGLSLEEAARRIGAIASY
FT                   ALHLQGTGTMLKEDAALNALAPPEAMKER"
FT   gene            70335..70622
FT                   /locus_tag="Bind_0067"
FT   CDS_pept        70335..70622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_3988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93726"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB26"
FT                   /protein_id="ACB93726.1"
FT                   /translation="MKSNPWLRASFSALTLSVEASSVIALRMMKLVAGGKAAEREARRM
FT                   VNEKIKANLNLGVKAMTGKLGSTPQSVIEKTSKHYNRKVRANKRRLSSGQ"
FT   sig_peptide     70335..70397
FT                   /locus_tag="Bind_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.616 at
FT                   residue 21"
FT   gene            complement(70630..71103)
FT                   /locus_tag="Bind_0068"
FT   CDS_pept        complement(70630..71103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0068"
FT                   /product="protein of unknown function DUF1052"
FT                   /note="PFAM: protein of unknown function DUF1052; KEGG:
FT                   rpa:RPA0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93727"
FT                   /db_xref="GOA:B2IB27"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB27"
FT                   /protein_id="ACB93727.1"
FT                   /translation="MLNSTQSLILPPDGRQSETALRVARGTRRLLRALQFSTVTELPLL
FT                   SGRRADLVALGESGAIHIIEIKSSIADFRADHKWQDYRAHCDRLYFAIPQDMPVEIMPE
FT                   EAGLIIADSYGAMIVREAPDHKMPPATRRAMLLRFAHAAAHRLHGLSDPEMAL"
FT   gene            complement(71133..71771)
FT                   /locus_tag="Bind_0069"
FT   CDS_pept        complement(71133..71771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93728"
FT                   /db_xref="GOA:B2IB28"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB28"
FT                   /protein_id="ACB93728.1"
FT                   /translation="MIKEYKTSGLAILAGWALVTIMAAFLVTAGWDWYHYGHLRLCLPE
FT                   DSLGAPYGRYDPPANPQELRTPRYWCAYSTLIAAQRGDRYHDIEHLKRRTPSLLEGIQL
FT                   DTGKAPPVDLTASPSNNMIGNFFHVVATRIIRLASKVLGSWFNNKFVPVWNSFVADDAD
FT                   PSSAGIRFVLAAGALALFVAMLAMTIKMTWEWAQTVWSAKDASRASSPH"
FT   sig_peptide     complement(71682..71771)
FT                   /locus_tag="Bind_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.942 at
FT                   residue 30"
FT   gene            complement(71849..73807)
FT                   /locus_tag="Bind_0070"
FT   CDS_pept        complement(71849..73807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0070"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: mmr:Mmar10_2450 sulfate adenylyltransferase,
FT                   large subunit; TIGRFAM: sulfate adenylyltransferase, large
FT                   subunit; PFAM: protein synthesis factor GTP-binding;
FT                   adenylylsulfate kinase; elongation factor Tu domain 2
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93729"
FT                   /db_xref="GOA:B2IB29"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB29"
FT                   /protein_id="ACB93729.1"
FT                   /translation="MAEVAIQLVSATPASAGVETTQQEHTQFDRLTRQTLRFLTCGSVD
FT                   DGKSTLIGRLLYDQSLILDDQLAALERDSKKHGTDGANIDFALLVDGLEAEREQGITID
FT                   VAYRYFTTPRRSFIVADTPGHEQYTRNMVTGASGADLAILLIDARKGLLTQTCRHAAIV
FT                   SLTGIKHIVLAVNKIDLVDYDEARFNEIVADFKKFAAPLGFESLQPIPLSARHGDNMSE
FT                   RSALTPWYKGPSLISYLEDVNVEQDRRSEPFRMPVQWVNRPHLDFRGFSGTLASGRVSV
FT                   GDAVIVAASGRTSTIARIVTANGDLDSAEAGDSITLTLNDEVDIARGDILCTPKDRPEV
FT                   SDQFAAHLIWMSDEKLLPGRSYLLKAGTRSVPVTVTELKYRLDVNNLGELAAKTLSLNE
FT                   VGFCNLATTTPLAFDPYQANHTTGAFILIDRTTHATVAAGLIAHGLRRATHIHRQGLNI
FT                   SKADRARIKHHKPAVLWFTGLSGSGKSTIANLVESRLYAHNVHTILLDGDNIRHGLNKD
FT                   LGFSDVDRVENIRRIGEVAKLMTEAGLIAICSFISPFRAERDLARSLLDEGEFIEIFVD
FT                   TPIEDCIARDPKGLYKKAIAGEIKNFTGIDQPYEPPLNPELVLGRESAQQGAAKVIAKL
FT                   IELGFIDEIENLDDWSI"
FT   gene            complement(73807..74715)
FT                   /locus_tag="Bind_0071"
FT   CDS_pept        complement(73807..74715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0071"
FT                   /product="sulfate adenylyltransferase, small subunit"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, small subunit;
FT                   PFAM: phosphoadenosine phosphosulfate reductase; KEGG:
FT                   bur:Bcep18194_A5495 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93730"
FT                   /db_xref="GOA:B2IB30"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB30"
FT                   /protein_id="ACB93730.1"
FT                   /translation="MKKPLPPHLRRLEAESIFIMREVVAEFERPVMLYSIGKDSSVMLH
FT                   IAQKAFFPSKPPFPLLHVDTTWKFREMISFRDEAAKRVGMELLVHINQDGVKRGISPFA
FT                   SGSSVHTQVMKTEGLRQALDQWKFDAAFGGARRDEEKSRAKERVFSHRSAAHAWDPRNQ
FT                   RPELWSLFNTKIRPGESMRVFPLSNWTELDVWDYIEAEDIPVVPLYFAKERPVVDRQGA
FT                   LIMVDDDRLPLNPGEKPRLEKVRFRTLGCYPLTGAVRSEAESLSEIIAEMRASHTSERE
FT                   GRLIDHDETGSMEKKKREGYF"
FT   gene            complement(74925..76265)
FT                   /locus_tag="Bind_0072"
FT   CDS_pept        complement(74925..76265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0072"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: xau:Xaut_2720 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93731"
FT                   /db_xref="GOA:B2IB31"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB31"
FT                   /protein_id="ACB93731.1"
FT                   /translation="MKTFLDWSAYDTYGIGDAYSGIPATGGNYAKAVAVCMHSRDCQNT
FT                   GKGVMCPSYRITGDRAHSTEARVAAFKAALNGEYGDKSFDDPRLAESMDLCVSCKACKK
FT                   ECPSSVDMTLIKTEYLAQKHAILGVPKRAMLFGAIPRWAAHYRKLLRLGTILRNRSKTL
FT                   AWLGERWFGIAAERALPVLAAKPFAGIETKDAGERGEVILFVDTFCHHFDPEIAEAATT
FT                   VLESAGYKVRHAKPAASDAEPDRPLCCGRTYLTTGLVEEARAEGKRVLEAFRPEIAKGT
FT                   PIIGLEPSCLLSLRDELYSLGLGAEVGDLGKNLYLLEEFLVREHQRGMRLSLKKLDMPK
FT                   ALVHGHCHQKAFGVMKATRKALSFIPGFTFDIVESSCCGMAGSFGLEAEHYKASLDMAE
FT                   ISLLPAVREASSDAPIIANGFSCRHQIQHGSGRNSMHIAVLLRDALA"
FT   gene            complement(76589..79420)
FT                   /locus_tag="Bind_0073"
FT   CDS_pept        complement(76589..79420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0073"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; KEGG: rpd:RPD_1013 outer membrane
FT                   autotransporter barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93732"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB32"
FT                   /protein_id="ACB93732.1"
FT                   /translation="MKPNVPSALRREPALIAWFLGSTALSRVTSDTITSLSLVSALTAV
FT                   IPGHAAAQTHDIDRAAAYYLASEVGLSVRPVFVGGTLRTDLTKGVYGQNFTLDGSPTNT
FT                   IDQFGKDSTFTGVFSDGTAGIAGNLVFTNSGSDGSIPNSNIIGLLEEVGQNYALNGSPT
FT                   NAIDQLIRVAAFTNLSGGTAGITGNLTPSNSSNSGSVTLTGTNIYTGMTTIMPGAHLII
FT                   GSGGSITHSNIIANSGFLEVAPQGAVAVSGISSNRFGLILNEGSWTGNVANSIALAINT
FT                   GTWNGNVANYIGVAGNAGTWNGNVTNYTGLAINAGAWNGNVANYTGLAINVRTWNGNVA
FT                   NYAGQVTNLGTWNGTATNYAGQVINSGNWNGTAANYTGQTTNLGTWNGNVSNYAGQTTN
FT                   LGTWNGNISNYAGETINVRNWNGSLLSNTGGILNNGTWNSPFLTNDRGSVTTTGTVNVA
FT                   STLTNGGTFYAKGTVNASLIENTGSFNVIGPLTGTIGTFNNAGTLNLANGNVTDVFRVG
FT                   AYQGQGGRLIVDVNLLNNTNAVRGDVLQADTTSGTTYVSIDNVAHGRSYFATPIPIIQS
FT                   SGGGTTFDLVDTPSAGLVDYNLAEVSRHNWSLVSSINPRSSSFSASTVASALALNTGFF
FT                   QNASSFVSLPESPEPNKWAGGPWIRIADGRNDVNAIGTTPNGNGGARSAPSLVRTRFNG
FT                   FQTGVDLGYYNIENSGFSAVLGMTAGRATLNSSELSGYNSTNAIQVPFIGIYGLFAGHG
FT                   FFADFQVREDFYQMNLSYPEAYVHGNSLTGTSLGANGSIGYHWNITKDFFVEPTAALIY
FT                   SDLHVNGLQVGIDPANDVYGTVTFQPIESLLGRFGGRIGANYVLEDIDLVMQPFLIANV
FT                   WREFAGDAKSTFNANGSAVPISLTRVGTFGQVGLGFSSSVLNTGLVGFFHGDYRLGDQF
FT                   RGYALNAGLRYQF"
FT   gene            80216..83644
FT                   /locus_tag="Bind_0074"
FT   CDS_pept        80216..83644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0074"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: mex:Mext_4394
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93733"
FT                   /db_xref="GOA:B2IB33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB33"
FT                   /protein_id="ACB93733.1"
FT                   /translation="MTLLFPATRLHRQERAKGVSILLGPTNTGKTHHAIERMLAHPSGM
FT                   IGLPLRLLAREVYHRVVEKAGLGAVALITGEEKIKPATARYWISTVEAMPRDLDLSFVA
FT                   IDEIQLASDLDRGHVFTDRLLNRRGRDETLLIGAATMQRALAELLPGAHFLARPRLSKL
FT                   SFAGEKKMARLPRRSAIVAFSAEEVYAIAEWIRRQRGGAAVVLGALSPRTRNAQVEMYQ
FT                   NGEVDYIVATDAIGMGLNLDVDHIAFAADRKFDGWHYRRLTPAEFGQIAGRAGRHLRDG
FT                   TFGTTGRCAPFDEDLIEALEEHRFDSVNMLQWRNTDLDFSSLADLAGSLDMLPKEPRLT
FT                   RAPLAVDQLVLDVAARDATVQRTATNRGDIARLWECCQIPDYRKLSPAAHSELVLAIYG
FT                   FVVRAGRIPEDWLARQIEAVARVDGDIDALSARIAQCRTWTFVANRSDWLADPRHWQGV
FT                   TRQVEDTLSDALHERLAQRFVDRRTSVLMRRLRENAIMEAEITTNGEVMVEGQHVGQLN
FT                   GFRFTADPQAEGEAAKALAAAAQKALASEIESRANRVHEAVDEAFVLANDGIIRWLGEP
FT                   VGKIIAGEHVLEPRVRVIADEHLTGPSLEQVQRRLELWLAQHVKKYLGPLAELERSEGL
FT                   EGIARGIAFQVAEALGVLERAKVADEVKNLAQETRAALRKFGIRFGAYHLYLPALLKPA
FT                   PRALAAQLWALKNGGVEELKGLDEVPHLAASGRTSFVADKDVPKGFYRAAGFRVCGDRA
FT                   VRVDILERLADLIRPAVSYRPGTTPGEPPAGTADGDGFVVTVAMTSLAGCSGESFGSIL
FT                   RSLGYQSEQRKGPPITHKLVPLAATEPVQPTLAGEAASAETVQADATSEDSAQATQING
FT                   AQIDVTQTDSAQAEGAATVAVEEPGLTTVAESPAAASGEASAESAPENEPATETADASS
FT                   EASTEPATDEAKPAESETVETEAAGTSEPVVVEEVLIEVWRPHRQNHARRPDNRGRRPH
FT                   QEGASAEAGQHRPKGRGDHRQGPHQGAHRAPHQGAPAEISGLAGSPAGQEAGQGQEHAA
FT                   HAPVRDDQKRDDQKQQRRGHQNRPAGERSGQNRPNAQRPPQHRSHQPRTGENGERGQGR
FT                   GHFSTEKRSAERAIDPNSPFAKLAALKAQLEDKNK"
FT   gene            84000..84200
FT                   /locus_tag="Bind_0075"
FT   CDS_pept        84000..84200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93734"
FT                   /db_xref="GOA:B2IB34"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB34"
FT                   /protein_id="ACB93734.1"
FT                   /translation="MSPIWLLLILPYIGLLWVPFYNHADPEFLGFPFFYWYQLAWVPIT
FT                   SLLLFFVYRSLQRGGRISHED"
FT   sig_peptide     84000..84074
FT                   /locus_tag="Bind_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.639) with cleavage site probability 0.639 at
FT                   residue 25"
FT   gene            84190..85686
FT                   /locus_tag="Bind_0076"
FT   CDS_pept        84190..85686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0076"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bja:bll5890
FT                   monocarboxylic acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93735"
FT                   /db_xref="GOA:B2IB35"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB35"
FT                   /protein_id="ACB93735.1"
FT                   /translation="MKTEIDYAALGVFLFFFVLVTLLGFVAAYWRRPKTLAHIDEWGLG
FT                   GRQFGTWITWFLVGGDFYTAYTVIAVPALVYATGAFGFFALPYTIIVYPFVFAVMPILW
FT                   KVAKDNNYVTAADVVHGRYGSRGLELAVAATGVIATMPYIALQLVGMAAVIQALGLTGE
FT                   LPLIIAFLVLAFYTYSSGLRAPALIAFVKDVMIYIVVLVAIAIVPFKLGGYGAVFQAAQ
FT                   AAFEAKGSGGILLAPAQMVPYASLALVSALAAFMYPHTLTGIFASRSGDTIRKNAMLLP
FT                   AYTLLLGLLALLGYMGHAAGLKLSHNNDVVPALFQTLFPGWFAGFSFAAIAIGALVPAA
FT                   VMSIGAANLFTRNFWKAYVNPQVTPAGEAQVAKITSMLVKVGALLVIIYLPTQFALDLQ
FT                   LLGGLWILQTFPALIFGLFTRFFKAKALLIGWAVGFVVGTYLAWSDGLKPLHKLVYGDW
FT                   NVTLYVGLIALTLNILVAAILSLFLPADRPLEKDLQAPAT"
FT   gene            86073..86612
FT                   /locus_tag="Bind_0077"
FT   CDS_pept        86073..86612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93736"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB36"
FT                   /protein_id="ACB93736.1"
FT                   /translation="MTDVKDTPYAKLDAEGRLLKPTLKGDTHVDGRFGFRGDISYDDPE
FT                   TILKEVFTVSEAGKPAIGFLSGSIKEFETLPKLVETFGPALDANSVNIIYVSDLPRGAR
FT                   FYFTLNGIKFFTIFIDDTSVYNELIDITYVDKVKLKKYDTAAKLDALADVGLKYDAVSD
FT                   YQEVTWEDALKKKNAG"
FT   gene            complement(86726..86947)
FT                   /locus_tag="Bind_0078"
FT   CDS_pept        complement(86726..86947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93737"
FT                   /db_xref="GOA:B2IB37"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB37"
FT                   /protein_id="ACB93737.1"
FT                   /translation="MSIGDHKPSRLETGFLPAISPRLARRQFQISVALVVIIAVGVYAL
FT                   LASLNAPRHASDRPLSKRPAATPLLASQ"
FT   gene            87352..88554
FT                   /locus_tag="Bind_0079"
FT   CDS_pept        87352..88554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0079"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   oan:Oant_1672 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93738"
FT                   /db_xref="GOA:B2IB38"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB38"
FT                   /protein_id="ACB93738.1"
FT                   /translation="MSFIADALLRVKPSATIMVTQKARDLRNAGRDVISLSVGEPDFDT
FT                   PDNIKQAAIKAIERGDTKYTPVAGIVPLREAIVQKFKRENHLDYKPSQTIVATGGKHIL
FT                   FNAFLATVNPGDEVIIPAPFWVSYPDMVAIAGGTPVIVETRIEQGFKLQPEALERAITP
FT                   KTKWLLLNSPSNPSGAAYSRAEMKALTDVLLRHPQIYVLSDDIYEHLIYGDFTFVTPAE
FT                   VEPELIDRTLTMNGVSKSYAMTGWRIGYAAGPEKLIKAMDMLQGQQTSGACSIAQWAAV
FT                   EALTGPQDFIAERRKIFEERRDLVVSMVNQAKYLRCATPEGAFYVFPSCAEAIGKRTPD
FT                   GTLIETDEDFVSAFLETEGVAVVQGSAFGQGPNFRISYATATPILEEACTRLQRFCASL
FT                   V"
FT   gene            complement(88607..90139)
FT                   /locus_tag="Bind_0080"
FT   CDS_pept        complement(88607..90139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0080"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   ccr:CC_0428 methyl-accepting chemotaxis protein McpB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93739"
FT                   /db_xref="GOA:B2IB39"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB39"
FT                   /protein_id="ACB93739.1"
FT                   /translation="MSDSSALQERLDFMEIEAATKASLNALWPQVESAIGPILTRFYDK
FT                   ISRTPATSRFFTDKSHMGHARQRQLDHWKVLFNAEFGADYERAVLAIGRTHARLGLEPR
FT                   WYIGAYALIGEGLVETLIEQQWPKLLPSAHKQAAKVSSSLASVWKALLLDIELSISAYL
FT                   EAIETERRKAEAERLAIETEQKEAIHLLAGALARLAQGDLVSRLDGEIGAEFASLKEDF
FT                   NDTVGKVHRILTAVVQATDSIRGGTDEMARAADDMARRTEQQAARLQETAASLDKVTRG
FT                   IGEAATQAHQASKIAASTREEAMQSGQIVAEATTAMSAIEASSGQISRIIGVIDEIALQ
FT                   TNLLALNAGVEAARAGETGKGFAVIASEVRALAQRSAEAAKEIKSLIRTSEAQVGGGVA
FT                   LVGKAGEALERIITRVGEIDGFVAEIAHSSERQARGLSEINATIRQMDQITQQNAAMVE
FT                   ESTATTHLLAAETFDLAKLMDNFQLERRGPGTRPAKPDAGKPAQVLAFPARA"
FT   gene            complement(90246..91397)
FT                   /locus_tag="Bind_0081"
FT   CDS_pept        complement(90246..91397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0081"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   rpb:RPB_4543 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93740"
FT                   /db_xref="GOA:B2IB40"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB40"
FT                   /protein_id="ACB93740.1"
FT                   /translation="MPQRRMPSLRLASFGRPHRLLVLTGLILCGFAMSSGFAQGVHHPF
FT                   AVGVNEGAASTQGVFGFLLGEESRFYQRLTAALRASRTDGGAAATLIALSFAYGIFHAA
FT                   GPGHGKAVISAYLLANEKMVRRGLVLSFCAALLQAGVAIALVTIAAMMVHATARQMTDT
FT                   AHILEIASYAGMAILGASLTFNKSKKLVAMVLAARDQAARKMPAGLVFTPAGASSNFTA
FT                   APRASAFKAESVDPASPIGASTGAQAFACDDGCNHLLTLAPDASDKGIKSALLAVLAAG
FT                   TRPCSGAILVLIFALSQGIFLTGVSATLAMALGTAITTGALALLTVFAKTSALKLVAAK
FT                   TPLSGGPYGPVLLSLFEMGAALLVLLFGLVMLGGNYFGKTTIF"
FT   sig_peptide     complement(91281..91397)
FT                   /locus_tag="Bind_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 39"
FT   gene            complement(91491..92222)
FT                   /locus_tag="Bind_0082"
FT   CDS_pept        complement(91491..92222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0082"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="PFAM: protein of unknown function DUF1007; KEGG:
FT                   azc:AZC_0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93741"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB41"
FT                   /protein_id="ACB93741.1"
FT                   /translation="MRMTIGLRSHHACFSPIQMNLRCRPKRKSLFRNLPRLGLWLILMT
FT                   MSGQALAHPHVFVTARAQIIFDDQGKITAIRNAWVFDPLYSAFVTQGLGKDGGTATREE
FT                   LAPLAKSNVESLAEFDYFTHAKAGGAPLVFGPPQDYTLEEQADKSVVLRFTLPLQTPAS
FT                   ASRSFSFQIYDPTYFVAFTMAQQSPVLLDKAPSGCSTNQIDAKPLAADESKKLDEAFFS
FT                   GLSPGSDFGLKLASRIIIACP"
FT   sig_peptide     complement(92064..92222)
FT                   /locus_tag="Bind_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 53"
FT   gene            92599..96162
FT                   /locus_tag="Bind_0083"
FT   CDS_pept        92599..96162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0083"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: azc:AZC_0699 pyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93742"
FT                   /db_xref="GOA:B2IB42"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB42"
FT                   /protein_id="ACB93742.1"
FT                   /translation="MVKVAVNGETSRGNEPGSRTAWDPYDLTRERLLLGGAQAVVRLLL
FT                   MQKERDRRAGLKTAGFISGYRGSPLGGLDLQFVQAKKHFDAQDIHFQPGLNEDLAATAV
FT                   WGAQQAGLSGEGRFDGVFSLWYAKGPGVDRSGDALRHANLAGTASHGGVLALAGDDHTA
FT                   ESSSTAYQSEFAFIDAMIPVLAPANVQEILDYGLLGLAMSRFTGTWVAMKCVKEIVQAT
FT                   STVNASLDRIQPVLPTDYRLPPGGLGIRAGDIFLAQDERLQTAKQEALRAFLRANRLDR
FT                   LIFNGGEAPRIGLIASGKTYLDLRQGLVHLGIENEDAAAELGLRLYKVGCSWPLEPQGL
FT                   RAFANGLDLIIVIEEKRALIEMQARDILYGMADHPFILGKQDRHGNSLFPASGAYEASD
FT                   IALAIGDFLLDHGRRGPAKELLAHRLETLRQGSRLSARFTDVAQRLPGFCAGCPHNRST
FT                   QVPDGMRAYAGIGCHFMALGMDRSTQGFAHMGAEGANWIGEAPFSRRGHIIQNLGDGTY
FT                   THSGLLAIRFAVAAGVDITYKILFNDAVAMTGGQRLEGGPTVDRIARQLAAEGVAQIAV
FT                   VTDEPEKYTPGIAWPAGVTIEPRQELDAVQRRLATLPGVTVLLYDQTCATEKRRRGKRA
FT                   KAAAPSRRVFINELLCEGCGDCGLVSNCVAIQPKETEFGRKRTIDQSSCNQDFSCLEGF
FT                   CPALVSVEGVQPKRIADTVADLFPALPQPSLPVIGDRPFGIIVTGIGGTGVVTIGALLG
FT                   VAAHFEGKICGINDMAGLAQKGGAVFSHVRIAQAEDQIHAIRIGQGEADLVLGCDLVAT
FT                   ASRKILTAIVKGKTAVLVNDAEILPGDFARDADYHLPAQACRQALLEAAGDGVTFIEAT
FT                   NLATALFGQSLAANLFLLGHAWQQGLVPLAENSILAAIALNGQAVAMNEAAFLWGRRAA
FT                   AHPASVAAIIVKAQAKDGGRILPVSTTLDQIVSRRAAFLTAYQDEAYAERYLALVEQAI
FT                   ATERRIMPGCDDFSKAVARNYFKLLAIKDEYEVGRLYSDGSFARQIGQTFEGEPVFTFY
FT                   LRHPLWRRRVDEKGAEDKGKGTGNQPAKISLGPWMLPVFRLLARLKVVRGTAFDLFGYQ
FT                   RERREERQMLADYESTIADILSRLTPVNHSVAVALAALPEKIRGFGPVRERHRQAAQAE
FT                   EALLMRQLAASSAATTLAAAE"
FT   gene            complement(96172..96708)
FT                   /locus_tag="Bind_0084"
FT   CDS_pept        complement(96172..96708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0084"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: rpa:RPA3708 globin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93743"
FT                   /db_xref="GOA:B2IB43"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB43"
FT                   /protein_id="ACB93743.1"
FT                   /translation="MNNEQVEIVKRTIIRLLPPRPEGNSEIIIQRYEKQKRDANQAFGD
FT                   VFYPKLFELAPDTQELFKDLEGTKQKFPDMLTLLVRSMNRLHDTLNTMQELGVTHMKLG
FT                   VKVEHYQPFVKALLWTFHKQLGDEVFNGHVAEAFVAVLSRICGIMCNSAYPQIRGLPVD
FT                   APMPTTEGSSTPPTT"
FT   gene            97040..97165
FT                   /locus_tag="Bind_0085"
FT   CDS_pept        97040..97165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0085"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; KEGG: nwi:Nwi_0983
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93744"
FT                   /db_xref="GOA:B2IB44"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IB44"
FT                   /protein_id="ACB93744.1"
FT                   /translation="MKVRNSLKSLRTRHRDNRLVRRKGRVYIINKTQKRYKARQG"
FT   gene            97256..98179
FT                   /locus_tag="Bind_0086"
FT   CDS_pept        97256..98179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0086"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bja:bll7547
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93745"
FT                   /db_xref="GOA:B2IB47"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB47"
FT                   /protein_id="ACB93745.1"
FT                   /translation="MSSARARQPGPDSLSRRTGPFPAPRLWLWSVGTVSALIVLSSCWS
FT                   LALADPYPFPHPSPLGPDWRMQEDGANPPSYPLNPLQGWPFDQKGAGNSSREGNRARPG
FT                   RDPAWGDGQLQGRANPRLKPKPKPDPEEALKKALVPPPDPVVQRQKLLAKLFDHLQAAS
FT                   DEEEARGLAQAIEETWLRSTSVTATLLMNRALAAIQAQHYPLAEDILDKTILLRPDWAE
FT                   ARNQRAKVRFLAGNFQGAMTDVDETLKLEPRHFDALTTMGIILEQTGFDSQALTVLRKA
FT                   LALYPHQPAVEAIVKKLTLSVEGRDI"
FT   sig_peptide     97256..97405
FT                   /locus_tag="Bind_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.654) with cleavage site probability 0.652 at
FT                   residue 50"
FT   gene            98679..100817
FT                   /locus_tag="Bind_0087"
FT   CDS_pept        98679..100817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0087"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif"
FT                   /note="PFAM: glycosyltransferase sugar-binding region
FT                   containing DXD motif; KEGG: acr:Acry_0387
FT                   glycosyltransferase sugar-binding region containing DXD
FT                   motif"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93746"
FT                   /db_xref="GOA:B2IB48"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB48"
FT                   /protein_id="ACB93746.1"
FT                   /translation="MANPEGNNTILFLDYGDEETLSRLDTSLASPLTPSFDSSQLPKLI
FT                   HFVFGMQPDLGDKPFGFVHYMAIKSAHDLHPECRLIFWYAYEPCSAYWDAVKDLVEPAH
FT                   IYAPEMIFGRPIRHYAHKADVVRMAVLCRYGGIYLDLDTICVRPLTPLFRGKPVMGQEL
FT                   AGSHADRPIQGLCNAVMIAPPNSLFFKTWWEAYRSFDDSEWNRHSVLLPYVIAQTMPDD
FT                   ITILPPSAFFEPTWDEAGLKTLFHADQRFPDAYCHHLWESRSWTDISRFNEDSIRSEET
FT                   TYNHIARRYIDAKEYDRLKNIKAAHVASGKARLNLGSGPVYLAGWTNVDMFADAFPDIV
FT                   ANLERDPWPFADNSICEIRAHHILEHIGDGFEFFMREMYRVCRNGAKISISVPHPRHDW
FT                   FLTDPTHVRRFMPETFYMFDAEVCRHWVASRDSKTPIALYCNIDFKVDQVTQVVDRDMQ
FT                   AILQQYNIPVSEQTARLLSNLVCLINVQMTVRKSAVTPYCTEARADIFDSIYRHSVWGQ
FT                   AEDGFSSGPGSDPEHMSAYLDLVTNYIKANKIKVVHDIGCGDFRIGSRIAARCPDTAFI
FT                   GIDIVPMLIQRNRIRYANLPNCSFDVGDIVEKPIGVADLAIIRQVLQHLSNDSISKAIR
FT                   NLSTYPAVLIANHDALGNAAVNADISDGAEIRSGKLDLTVRPFNLDIEALERLDIPGCR
FT                   GFLDVGILRQPAMADPLL"
FT   gene            complement(101066..101818)
FT                   /locus_tag="Bind_0088"
FT   CDS_pept        complement(101066..101818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0088"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pmh:P9215_12991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93747"
FT                   /db_xref="GOA:B2IB49"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB49"
FT                   /protein_id="ACB93747.1"
FT                   /translation="MQFNHQKRYLVVTAYYKEDRSFLERCIRSVREQTMATDHLLVADG
FT                   FAQDWVQRAGLRHIQLDQSHNDYGNTPRGIGALLAISERYDGFCFCDADNWFEPNHIAS
FT                   CLQTAADAEQDCDYVVARRYLRRPDETIIPINDEPIESHVDTNCFFFLPGSYHLVHLFA
FT                   NMPQELSSIGDRVFYNALRRQKLNMAVVHEPTVNYHCLWKPVYQAIGEIPPLEGKPSID
FT                   NSSIQYWISNLNPRQKELLSRRTGLSFG"
FT   gene            102176..103288
FT                   /locus_tag="Bind_0089"
FT   CDS_pept        102176..103288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0089"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   reh:H16_B2164 NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93748"
FT                   /db_xref="GOA:B2IB50"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB50"
FT                   /protein_id="ACB93748.1"
FT                   /translation="MGRLFEPFRLGKYLLRNRVVMAPMTRARNPDGVPNDLNALYYRQR
FT                   ASAGLIVTEGVPISPSAEGFLFIPGLFRPDQIIGWRKVTDAVHAEGGTIFAQLWHVGRV
FT                   SHVSNQPGGIAPVSSTEHPALHSEAWGLRDDGTPGAVPVSTPRALSTAEVAGVIEDFAK
FT                   AAANAIAAGFDGVELHGANGYLIEQFLNPNVNDRTDAYRGDTLEGRTRFVIEAIDAVIA
FT                   RIGAERTAIRLSPYGGLFDMQPYPQIEETYLFLADAFSRRGLAYVHLMDQKSRGSTAIP
FT                   QNFLAEFRTCYKGALILAGGLTRDRAETLIAEGMIDLAAFGEPFIANPDLVARLEKGLP
FT                   LALADRSLHYGGGAHGYTDYSVYHGEGVRL"
FT   gene            103285..104181
FT                   /locus_tag="Bind_0090"
FT   CDS_pept        103285..104181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0090"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: gdi:GDI3479 putative
FT                   nucleoside-diphosphate-sugar epimerase dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93749"
FT                   /db_xref="GOA:B2IB45"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB45"
FT                   /protein_id="ACB93749.1"
FT                   /translation="MRIFVTGASGYIGGSVAAALAQKGHVVRGLVRNPAKAEAVSAKGI
FT                   TPVIFTLDDADLLRTEASAADAVINCADSDHQGAVEALLAGLSGSGKVFIHTSGTSLVG
FT                   DEAMGEPSDKIFIEETPVKPEPDKVHRVALNKLILEAAPGVRTIVLCNSLIYGHTLGVP
FT                   AQSVQIPPLVAQAKESGIPRYIGRGLNIWSNVHIADLVDLYALALEKAPAGRFYYVENG
FT                   EATFGDLVRVIGKTLGLGVAQSWSAEEAIAKWGRELAVFALGSNSRVRAGKARAELGWA
FT                   PRHDSVLDWVATSLNGG"
FT   sig_peptide     103285..103350
FT                   /locus_tag="Bind_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.646 at
FT                   residue 22"
FT   gene            complement(104195..104758)
FT                   /locus_tag="Bind_0091"
FT   CDS_pept        complement(104195..104758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcs:BCAN_A0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93750"
FT                   /db_xref="UniProtKB/TrEMBL:B2IB46"
FT                   /protein_id="ACB93750.1"
FT                   /translation="MSPSKPSSAPDFTSLLDKLDRNDGTIGQETQMHEGESVGASVDPS
FT                   LTPWKNWVNQLFGSFTRSVPFDAAWASAYQEAAAAQDARDAQDPLTTKGEDSRAHTEKQ
FT                   AKTRAQDRSYAHIQIQIQDEQEWVVRELGLRPDLPAADLHRIRRDFAKRHHPDRYPPME
FT                   RALATRRMALANLLIDRHLKQRHD"
FT   gene            complement(104888..105544)
FT                   /locus_tag="Bind_0092"
FT   CDS_pept        complement(104888..105544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0092"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: xau:Xaut_2494
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93751"
FT                   /db_xref="GOA:B2IBM9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBM9"
FT                   /protein_id="ACB93751.1"
FT                   /translation="MWFHKKVTMPTAAEALPGRAEPMATAQTHFVNGHPLHPPFPAGYE
FT                   TALFGLGCFWGAERKFWQIGDAVFTTAVGYAGGFTPNPTYEEVCTGKTGHNEVVLVVFD
FT                   PKRVTYSDLLRVFFENHDPTQGYRQGNDVGTQYRSGIYVFDEAQKQAAQTAKAAFEPAL
FT                   AAAGFGPITTEILDAPPFYYAEDYHQQYLAKNPDGYCGLGGTGVSCPIGTGVAAE"
FT   gene            105955..106665
FT                   /locus_tag="Bind_0093"
FT   CDS_pept        105955..106665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0093"
FT                   /product="protein of unknown function DUF1013"
FT                   /note="PFAM: protein of unknown function DUF1013; KEGG:
FT                   azc:AZC_1470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93752"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN0"
FT                   /protein_id="ACB93752.1"
FT                   /translation="MSNAPLMPKATAVWLVENTSLTFDQIADFCKLHPLEVKGIADGEV
FT                   AAGIKGHDPITSGQLTREEIAHSEKNPSRALQLAQSKVRLPETRRRGARYTPLSRRQDR
FT                   PNAILWLVRNHPELKDAQIMRLVGTTKTTLQAIRNRTHWNSAALTPTDPVTLGLCTQMD
FT                   LDFEVNRAAKDRPILEDRGQTLMPAEVTTQAYDEEGDEEDVFGTVDRHRPEAGEDAIDL
FT                   DSVFAKLKDLKPEE"
FT   gene            106869..107210
FT                   /locus_tag="Bind_0094"
FT   CDS_pept        106869..107210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93753"
FT                   /db_xref="GOA:B2IBN1"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN1"
FT                   /protein_id="ACB93753.1"
FT                   /translation="MSDAILPPHRSTSRRFCLFPGQALIVLALFLAVFGVVFLVEGVGA
FT                   LPAKAADLDRYKTPRMETTPHESAGPSLDPNCRLIPQPQLDLYGYVRFFRPTIVCFSSG
FT                   LLADSFHRW"
FT   gene            complement(107644..108300)
FT                   /locus_tag="Bind_0095"
FT   CDS_pept        complement(107644..108300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0095"
FT                   /product="Intracellular septation protein A"
FT                   /note="PFAM: Intracellular septation protein A; KEGG:
FT                   smd:Smed_3090 intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93754"
FT                   /db_xref="GOA:B2IBN2"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN2"
FT                   /protein_id="ACB93754.1"
FT                   /translation="MEKKPEAPLDPWLKLLLEMGPFLLFFFANAWPKVFAPLTAPWLPP
FT                   SLMAGENAGLFTATLVLIPAVLLSLAVSYGLTHRLPVMPVVTALLVLIFGALTLYLQDP
FT                   SFIKIKPTVLYVGFALALFGGLLFGKPLLPIMLDHALALSERGWRLLTIRWGLFFLGMA
FT                   VLNEIVWRTQSTNVWVTFKFPGTMILVFLFTLSQIPFLKRHEIAPDAASHSPDHF"
FT   gene            complement(108409..109101)
FT                   /locus_tag="Bind_0096"
FT   CDS_pept        complement(108409..109101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0096"
FT                   /product="conserved hypothetical protein; putative
FT                   alpha/beta hydrolase domain"
FT                   /note="KEGG: mex:Mext_3975 conserved hypothetical protein;
FT                   putative alpha/beta hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93755"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN3"
FT                   /protein_id="ACB93755.1"
FT                   /translation="MPEVIFNGPAGRLEGRFHPSTIRGAPIAIVLHPHPQFGGTMNNQI
FT                   VYNLYYAFAERGFSVLRFNFRGVGRSQGGFDHGQGELSDAAAALDWVQSINPEARACWI
FT                   AGISFGSWIGMQLLMRRPEIEGFISIAPPANRFDFSFLAPCPSSGLFVHGDQDRVAPLK
FT                   EVMGLIEKLKTQKGILIEHEVVAGANHFFENCVEDLVEKVGLYLDRRLGNPPRLPTPAR
FT                   SEPAERSS"
FT   gene            109805..110986
FT                   /locus_tag="Bind_0097"
FT   CDS_pept        109805..110986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0097"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: bja:blr4338
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93756"
FT                   /db_xref="GOA:B2IBN4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN4"
FT                   /protein_id="ACB93756.1"
FT                   /translation="MTARRVYLDHNATTPLRPAARAAMIAAMDLCGNASSIHAEGRAAR
FT                   ALIEGAREAMARFVKTLPRRVIFTSGATEALNAILTPRLERSNRPTAPFDVLLVNAGEH
FT                   ASVLFGHRFSADAVETIGMTPDGRLDLDALAKVLERYAGRRIMLALQAANNETGVVQPV
FT                   LQAEALLRAASSDTFFVCDAVQAAGKIACDFDALPADALIFSAHKFGGPAGIGALCLRE
FT                   DVLLGEPLLRGGGQEFRQRAGTQAVISIAGLAGALVDMRETFVQDSVRLAQLRDQLESF
FT                   LRTLAPAAVLFGTEVERLPNTLCFAVPGMEAQVLLMFLDVEGVAVSSGAACSSGKVKAS
FT                   HVLEAMRVDPSLAGAAIRLSLGWTSHLEECALFMQAFEKAFRTIKARQVKSAA"
FT   gene            111090..112610
FT                   /locus_tag="Bind_0098"
FT   CDS_pept        111090..112610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0098"
FT                   /product="FeS assembly protein SufB"
FT                   /note="TIGRFAM: FeS assembly protein SufB; PFAM: SufBD
FT                   protein; KEGG: azc:AZC_1044 FeS assembly SufB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93757"
FT                   /db_xref="GOA:B2IBN5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN5"
FT                   /protein_id="ACB93757.1"
FT                   /translation="MAAAKETVDQVKSIDVSEYKYGFFSEIEADKAPKGLNEDIVRFIS
FT                   AKKNEPAWLTEWRLEAYRRWLTMREPEWARVNFAKVDYQDLYYYSAPKSAAGPKSLDEV
FT                   DPELLKVYEKLGIPLKEQAALAGVVAGENEMIDDEGNVVPMPERKIAVDAVFDSVSVVT
FT                   TFREELAKAGVIFCPISEAVHTHPELVQKYLGSVVPTTDNFYATLNSAVFSDGSFVYIP
FT                   EGVRCPMELSTYFRINEQNTGQFERTLIIADKGSYVSYLEGCTAPKRDENQLHAAVVEL
FT                   IALDDAEIKYSTVQNWYPGDADGKGGIYNFVTKRGDCRGANSKISWTQVETGSAVTWKY
FT                   PSCVLRGDNSRGEFYSIAISNGHQQVDSGTKMIHLGKNTTSRVISKGISAGHSQNTYRG
FT                   QISSHRKATGARNFTNCDSLLIGNSCGAHTVPYLESRNPSTQFEHEATTSKISEDQLFY
FT                   CMQRGLSAEEATALIVNGFVRDVLQQLPMEFAVEAQKLIAVSLEGSVG"
FT   gene            112922..113677
FT                   /locus_tag="Bind_0099"
FT   CDS_pept        112922..113677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0099"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="KEGG: mex:Mext_3978 FeS assembly ATPase SufC;
FT                   TIGRFAM: FeS assembly ATPase SufC; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93758"
FT                   /db_xref="GOA:B2IBN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN6"
FT                   /protein_id="ACB93758.1"
FT                   /translation="MLEVKNLNVSIGDRKILNDFCITVKDGEVAAIMGPNGTGKSTLSY
FT                   VMSGRPGYTVESGEVLLNGVNLLDFEPNERAAKGLFLAFQYPLEIPGVATMTFLKAALN
FT                   AQRKYRGETELSTPELMKRVNAAASKLGIKSDMMKRALNVGFSGGEKKRMDILQMALLE
FT                   PSFGILDETDSGLDIDALRIVSEGVNALRSPTRGFLVITHYQRLLDYIVPDTVHVMAGG
FT                   RIVRTGGKELALELEKSGYAEYLGEEKAA"
FT   gene            113704..115038
FT                   /locus_tag="Bind_0100"
FT   CDS_pept        113704..115038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0100"
FT                   /product="FeS assembly protein SufD"
FT                   /note="TIGRFAM: FeS assembly protein SufD; PFAM: SufBD
FT                   protein; KEGG: bra:BRADO3543 SufD, needed for FhuF Fe-S
FT                   center production/stability"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93759"
FT                   /db_xref="GOA:B2IBN7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN7"
FT                   /protein_id="ACB93759.1"
FT                   /translation="MSAQIIPSRTPAETTLVESFGAVKATLPGTADVAKLREENFAAFV
FT                   EAGLPHRRVESWHYTDLRTIMREALPLAPVPTPAALEGLRKDVGALTLHGTKLVLVDGA
FT                   FVPELSDTVPAGVTVHSLASVLTKGPAELLTLLSGEGLGAGDAIVALNAAMMQDGIVVE
FT                   VAPGAVIAEPLNLIYATASAMPVARFSRSLVAVGAKASVTIAESSLGEGGRSGQTNGCL
FT                   IFSVGDEAKVNHTTQLTGSLANSIRIDTFMVSLGAKVKFDSFALVSGAGLTRRQIFLRF
FT                   NGEEAEAALRGASLLRGREYADTTLFVEHLAPSCVGRELFKYILDEESVGVFQGKIHVA
FT                   PEAQHTDGKMLSKALLLTDGVAMNNKPELEIFADDVACAHGATCGGLSEEQIFYLQARG
FT                   LPYKEAEALLLEAFAAELVDELEDEKAAENFRSEISTWLAGRTTA"
FT   gene            115208..116452
FT                   /locus_tag="Bind_0101"
FT   CDS_pept        115208..116452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0101"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; aminotransferase
FT                   class I and II; KEGG: bra:BRADO5444 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93760"
FT                   /db_xref="GOA:B2IBN8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN8"
FT                   /protein_id="ACB93760.1"
FT                   /translation="MNKHIAAQAPWDVNLIRQDFPILSLEVYGKPLVYLDNAASAQKPK
FT                   EVVDRMVHATYHEYANVHRGLHYLANAATDAFEVARESVRSFLNAESVNEIIFTKSATE
FT                   AINLVASSFGQAFINEGDEIVLSIMEHHANIVPWNFLRERKGAVLKWVDVDDDGNFLIE
FT                   EFEKALSPKTKIVAMTHMSNMLGTITPVKEIIKIAHDRGIPVLIDGSQGAVHLEVDVRD
FT                   LDADFYVVTGHKLYGPTGIGALYGKKEWLEKLPPFLGGGEMINEVTRDRVTYNEPPHRF
FT                   EAGTPPIIQAIGLGAAVDYMQKLGRNRIHAHEMALSDYAHERLSKINSLKIFGRAKGKG
FT                   AIISFEMKNAHAHDVATIIDRSGVAVRAGTHCAQPLLARFGVTSTCRASFAAYNTFEEV
FT                   DKLAEALIRAEGLFA"
FT   gene            116470..116862
FT                   /locus_tag="Bind_0102"
FT   CDS_pept        116470..116862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0102"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   hne:HNE_2613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93761"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBN9"
FT                   /protein_id="ACB93761.1"
FT                   /translation="MSESQTAEVQEVQPNEPAWIFDAGISQNERIRYTNDIVAAFKTVF
FT                   DPEIPCDVYELGLIYKVDIDENRLIRIEMTLTAPGCPVAGEITRSIETAIGTVPGTLGV
FT                   IVNIVFEPAWDQGRMSDEARISLDMF"
FT   gene            117065..117439
FT                   /locus_tag="Bind_0103"
FT   CDS_pept        117065..117439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0103"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   azc:AZC_3609 HesB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93762"
FT                   /db_xref="GOA:B2IBP0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP0"
FT                   /protein_id="ACB93762.1"
FT                   /translation="MANSAFSILSLTDNAAARTRELLAQAGNADKLLKIGIKNGGCAGM
FT                   SYTLDLIDELGPLDEIIEDKGVRLAVAPQDVMFLLGTQVDFVTDRLGSSFTFRNPNQTG
FT                   SCGCGESVSITPAQPETARS"
FT   gene            117724..118578
FT                   /locus_tag="Bind_0104"
FT   CDS_pept        117724..118578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0104"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: gdi:GDI0015 putative shikimate dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93763"
FT                   /db_xref="GOA:B2IBP1"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP1"
FT                   /protein_id="ACB93763.1"
FT                   /translation="MSEHHFLSLLTGSFSTPSDDNPTVAMVEAAYRHHGINARYINCDV
FT                   KKDNLADAIRGAKAMEWIGFNCSMPHKVAVIDHLDGLAESAAIIGAVNCVVIADGKLTG
FT                   HNTDGQGFLTSLQSVTDPKDKRITLLGAGGAARAIAVELALAGATHIGIVNRDQSRGES
FT                   LAKLISEKTKAKADFIPWTSGYRVPETTDVLVNATSIGLGDAEALPDIDTGSLRKGMIV
FT                   ADVIFNPPRTHLLRKAEEQGAVTLDGLGMLVNQGRVGIKLWTGKDVEASVMHATLATLF
FT                   GVA"
FT   gene            complement(118665..120113)
FT                   /locus_tag="Bind_0105"
FT   CDS_pept        complement(118665..120113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0105"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: gdi:GDI0016 putative sugar transporter
FT                   protein; TIGRFAM: sugar transporter; PFAM: General
FT                   substrate transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93764"
FT                   /db_xref="GOA:B2IBP2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP2"
FT                   /protein_id="ACB93764.1"
FT                   /translation="MNERAMVDYAQAHSLAVSVIETLPQDRPGGVAEAERFVIIVTIVA
FT                   ALGGLLFGYDTGIVASALIYITKTFDLSTFGQECVAAALNVGAVFGAACSGPISDRFGR
FT                   RPTVLLASLVFIIGSVGSAFAPDVPVLLVARLALGAAIGAATQIVPVYVAELAPAHRRG
FT                   ALVVMFQLIFSLGLLSSFFVGYLLSGGTESWRMMFLLGVVPAILLGVGMLFLPESPRWL
FT                   FLNKRERQAVLTLDKLRGDPLAVRQELDEILEASRTPNGGWRTLTKKWVRPALIAGLGV
FT                   AILSQLSGPNVIVYYAPIILTDAGFGDQAALLTSVSVGVASTLTTIMGMLLIDRIGRRR
FT                   LMLTLLPMAVLSLLLLGAVFLGGPMTGIRVPLMLLGLLGYIVFNFGSLSVAVWLIASEV
FT                   FPLIIRGKAMGLAAVSVWASDIVISLSTLSLVEVLGPTGTFWLFAGVNAIAVWFVWRYV
FT                   PETAGHSLEQIETSLKEGTFQPHS"
FT   gene            complement(120432..121886)
FT                   /locus_tag="Bind_0106"
FT   CDS_pept        complement(120432..121886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0106"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mes:Meso_1773 DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93765"
FT                   /db_xref="GOA:B2IBP3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP3"
FT                   /protein_id="ACB93765.1"
FT                   /translation="MTFNELGLSEKVLQAVAATGYTSPTPIQAEAIPHALAGRDILGIA
FT                   QTGTGKTAAFTLPMLSRLEQGRARARMPRTLILEPTRELAAQVEESFARYGINHKLNVA
FT                   LLIGGVSFAEQENKIMRGADVLIATPGRLLDFSERGKLLLTGIEILVIDEADRMLDMGF
FT                   IPDIERICKLVPFTRQTLFFSATMPPEITRLTETFLHNPVRIEVARASSTATTITQGLV
FT                   ASAHGPAKRETLRQLIRGAENLKNAIIFCNRKRDVAVLHKSLQKHGFSAGALHGDMDQR
FT                   ARMTSLDAFKSGDVNLLVCSDVAARGLDIPDVSHVFNFDVPTHAEDYVHRIGRTGRAGR
FT                   SGVALSIVTSADRKYVDEIEKLIARKIDWQGGATLDDVAAEESVAHATETRRGRGGKIA
FT                   KRPAPQEEARPSQAAARGPKSRRPVEEGRSDGRKPSNPPRSRRSYEDDDVPVVGLGDHV
FT                   PMFLLRPVKLKSSKNTAEKTDSTENV"
FT   gene            complement(122304..123137)
FT                   /locus_tag="Bind_0107"
FT   CDS_pept        complement(122304..123137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0107"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: bra:BRADO0319
FT                   conserved hypothetical protein; putative high-affinity
FT                   Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93766"
FT                   /db_xref="GOA:B2IBP4"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP4"
FT                   /protein_id="ACB93766.1"
FT                   /translation="MIAALIIVLREVIEAGLIIGIILAATRQIPGRMVYIVGGIAGGLI
FT                   GSGLLAFFAGALADMLEGMGQEIFNASILIIAVAMLTWHNVWMARHGRAMGEEIQKFGH
FT                   AVREGSQTLSALAIVIGIAVLREGSEVVLFLYGVLASKGASGLQVFLGGLGGLALGIAL
FT                   SLFTYSGLVIIPLKHLFRVTSLLLAFMAAGMAAQAVAFLEQADLLTALTKTAWNTSAYL
FT                   SETSLGGKVLHALLGYTDRPSQMQVLIYLLTLGVTFLFMKLLAPPPRTDRRLVTP"
FT   gene            123668..124402
FT                   /locus_tag="Bind_0108"
FT   CDS_pept        123668..124402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0108"
FT                   /product="porin"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; porin; KEGG: azc:AZC_3727 outer
FT                   membrane protein Omp31 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93767"
FT                   /db_xref="GOA:B2IBP5"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP5"
FT                   /protein_id="ACB93767.1"
FT                   /translation="MLRTIIHSSIVIMASSVAALAADLPNRAAPPTVPYLPPSPAFSWT
FT                   GVYLGGQIGYQFGRDSITAPGLFSVGHSPNGVVGGAHIGFNYQVSQFIVGFEGDVNGSS
FT                   YSGSVFNPVFRTQLTSRIPVDGSLRGRIGAAWDRVLVYATGGAAFASIKHGYIGSSLVP
FT                   GSATLTNDRVGWTVGGGVEYAMTDNWSVRVDYRYTDYGNISDFPGTITVPRIHHETNNR
FT                   VQAGFSYKFDTSPPTVPIVAKY"
FT   sig_peptide     123668..123733
FT                   /locus_tag="Bind_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            124857..125239
FT                   /pseudo
FT                   /locus_tag="Bind_0109"
FT   gene            complement(125255..127021)
FT                   /locus_tag="Bind_0110"
FT   CDS_pept        complement(125255..127021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0110"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: gdi:GDI1498 putative chemoreceptor McpA;
FT                   TIGRFAM: PAS sensor protein; PFAM: chemotaxis sensory
FT                   transducer; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93768"
FT                   /db_xref="GOA:B2IBP6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP6"
FT                   /protein_id="ACB93768.1"
FT                   /translation="MFGFSVPSRSQAGAVLAALSRSLAIIEFDPSGTILSANENFCDLM
FT                   GYDLSEIQGRHHSLFIEPAFVRSPDYQEFWAKLSRGEFDAREYKRIGKGGKEVWIQASY
FT                   NPVINANGRVMKIVKVATDITGEKLRNAEYESKINAISRVQAMIDFTPAGDVITANENF
FT                   LKTLGYRIEEIQGRHHSLFVEPAYARSQEYQDFWKKLNRGEYIAAEFKRIGKGGKEVWI
FT                   QASYNPIFDQNGKVVQITKFATDVTERVRAVNEIGLGLAQLADNNLSYRIEKAFIPAFE
FT                   KLRSDFNLSLEKLLSTMLQITDSTQTIQSGTQEISTAADDLSRRTEQQAASLEETAAAL
FT                   DQITATVKKAAEGALHARQIVVAANEDAKKNGLVVRRTVEAMDGIAKSAQQINQIIGVI
FT                   DEIAFQTNLLALNAGVEAARAGDAGRGFAVVALEVRALAQRSAEAAKEIKSLIMASTSE
FT                   VDHGVKLVAETGGTLENIMRQVGEINHLVNAIAEGTKEQAVGLEQVNTAINQMDQVTQQ
FT                   NAAMVEESTAASHALSQETRQLSNLVGQFQIGALCDNPRRNGDAMPFALQKGAPDVFQT
FT                   FREPALRAVSNG"
FT   gene            complement(127512..128558)
FT                   /locus_tag="Bind_0111"
FT   CDS_pept        complement(127512..128558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0111"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bja:blr2721 probable serine protease do-like
FT                   precursor; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   SMART: PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93769"
FT                   /db_xref="GOA:B2IBP7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP7"
FT                   /protein_id="ACB93769.1"
FT                   /translation="MFDTVFTPILNEPDSETPETQPLTAAFTAPRETDETENDDFLLLD
FT                   AYSRSVTKVVENLAPSVVKLDIRNAQGRHAGSGSGVIVSPDGLLLTNSHVVQGARRTEV
FT                   TLLDGRRLSGRILGDDPDTDLALVRIDEDTHLPAAKLGDSKRLKPGEIAIAIGNPLGFD
FT                   TSVTAGVISALGRSLPARGGRLIDDIIQTDASLNPGNSGGPLVSSRGEVIGINTAIIAG
FT                   AQGICFAVAANTARFVLGELVRHGKVRRAHLGIGATTIPLPRRIALRLGLTQKSGAMVS
FT                   AVEPNSPADHAGLLTGDILLALDGQAVTGAEDLIRLLDADKIERTVPIDLLRRSDQRRF
FT                   WVALHERR"
FT   gene            128940..129374
FT                   /locus_tag="Bind_0112"
FT   CDS_pept        128940..129374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0112"
FT                   /product="cytochrome c prime"
FT                   /note="PFAM: cytochrome c prime; KEGG: rpe:RPE_3086
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93770"
FT                   /db_xref="GOA:B2IBP8"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP8"
FT                   /protein_id="ACB93770.1"
FT                   /translation="MRKKLLLGTLFLMSATSLLAANDPIAQRKDILKEIGEVTKPVVGM
FT                   LKGEVPFDRAKVDAALTAYADGIPKLPSLFPDDSKTGGKTEAKARIWDEKPKFEALFKK
FT                   FGEDVKTTQGTITDVASLKANFPKVLGDCKSCHDDYREKH"
FT   sig_peptide     128940..129002
FT                   /locus_tag="Bind_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 21"
FT   gene            129371..130096
FT                   /locus_tag="Bind_0113"
FT   CDS_pept        129371..130096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0113"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rpe:RPE_3087 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93771"
FT                   /db_xref="GOA:B2IBP9"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBP9"
FT                   /protein_id="ACB93771.1"
FT                   /translation="MSGLFIMRDGRHGAKGTVEAWDLPTRLFKWMLVLLVAMAWLSDKY
FT                   GVATPEWHKWNGYTILVLIVFRLLWGFFGGVTARFSSFFPTPQRIFGYCGALVQGRKLP
FT                   YLGHNPLGACMVLLLLAAVFCQAVLGLYSADPDRLVIEGPLSGTLSDASVDEASHVHRL
FT                   GFDFLLILIGLHVLANLAYDLIGKEGMIRAMVVGRKPAALYADMPRSAPGSLWLAFTCL
FT                   IAAVILVFGGIFLLGGRSL"
FT   gene            complement(130073..131155)
FT                   /locus_tag="Bind_0114"
FT   CDS_pept        complement(130073..131155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0114"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bja:bll8163 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93772"
FT                   /db_xref="GOA:B2IBQ0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ0"
FT                   /protein_id="ACB93772.1"
FT                   /translation="MRILIATDAWQPQVNGVVRSLESLSKALNEQGVEVDFLSPQGYAT
FT                   LPLPTYREIRLALVGWRSIKKRLDGQGFDHIHIATEGPIGFAVRRYCLETGHPFTTSFH
FT                   TRFPEYIRERVPIPEWVSYGVLRRFHNAGNGLMVATPSLARELEQRGFNRPRIWSRGVD
FT                   HQRFHPDRAVPLSLPRPIFLYAGRLAPEKNLSSFLGLDLPGSKLVIGDGPARAALQQAH
FT                   PRAHFLGAMPSDELARYYAAADVFVFPSRTDTFGMVVLEALACGCPVAALPVQGPLDTI
FT                   GTSGAGVLDFDLRTACIEALTIPRERARTHALTFTWANSARQFLDNIAAVYDHRGTAPI
FT                   ARPVARPNLRKKASKGAPAE"
FT   gene            complement(131157..131969)
FT                   /locus_tag="Bind_0115"
FT   CDS_pept        complement(131157..131969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0115"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: xau:Xaut_4108
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93773"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ1"
FT                   /protein_id="ACB93773.1"
FT                   /translation="MDTILESSTHYRTLFLSDVHLGTRGCQAELLVDFLKYHDADTIYL
FT                   VGDIIDGWRLKSGWYWPQMHNDVVQKLLRKVRKGTRVVYVPGNHDEFARDYIGMTFGGV
FT                   DIVDHAFHETADGKRLLVIHGDQFDIVVQHARWLAWLGDWAYDVALWSNTWFNKARRAL
FT                   GFTYWSFSAWAKLKVKDAVNFIGAFEMTLTEEARKHGADGVVCGHIHHATIREIDGVTY
FT                   INTGDFVESCTAIAEHADGRLEILRWQATASERLARQANLPAAQRAAA"
FT   gene            132371..132988
FT                   /locus_tag="Bind_0116"
FT   CDS_pept        132371..132988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0116"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: mex:Mext_4469
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93774"
FT                   /db_xref="GOA:B2IBQ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ2"
FT                   /protein_id="ACB93774.1"
FT                   /translation="MGVEGRDKVKVLEAGAAALSSQLGKTVQRLRKAYNLSLSELSEQS
FT                   GVAKSIISQIERNETNPTLATIWRLSQALDVSIERVLQATEDEPFLEKASKGDTPILVS
FT                   DDGKCRLAIIGWIKTVEWLQWYDFAADPGGILESEAHQRGSVESLSVSVGELEIEVGGV
FT                   IERAKAGETLRYRCDRPHTIRNVSRKPASAMMVCILKAAAME"
FT   gene            133040..134305
FT                   /locus_tag="Bind_0117"
FT   CDS_pept        133040..134305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0117"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   swi:Swit_3034 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93775"
FT                   /db_xref="GOA:B2IBQ3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ3"
FT                   /protein_id="ACB93775.1"
FT                   /translation="MDSQQIGEAYRQRHWRFLADLQKKAGMEFVVGRREGSHIWNVENS
FT                   RRLLDCGNSGGVHSLGHCNPEIRQLIAESLETLDAGMWVMPTEEALAFQDTVNRADSPI
FT                   PDCRTVLTLSASDAMDATIMWSFRVTGRKKVLAFKHGYHGHSGFAALATGSEAEGLLSH
FT                   YSLPGDYSLFFEDYGDLDAIERTIDASCAAIIMEPMNYETFEPAPDGFLEGVQALCRRH
FT                   STLLILDETRSGLGRSGRLWMSGFYDIQPDIIISGKGLGGGYYPVGALIARSDIYDLCM
FT                   NSGHWGYMASLAGSPIGARIAMKVLDIVRRPELVANVHLLERDLTTLFLALSANFPDLY
FT                   RPAWVRGGIAALGLQDAQFASMIQLELFRRGVLCHSTSLITPSVVKFFPCLTSTPSIVE
FT                   ELGGALEDCAQSFRKQERVSTS"
FT   gene            complement(134392..135882)
FT                   /locus_tag="Bind_0118"
FT   CDS_pept        complement(134392..135882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93776"
FT                   /db_xref="GOA:B2IBQ4"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ4"
FT                   /protein_id="ACB93776.1"
FT                   /translation="MTRRGRERLRGSLSFALVSSLIATGGFSLSTARADTTDQLLDQLR
FT                   SKGILTKTEYRKLKDRHAHEAEDKARVAEPAGRRVVTKEGVKIVPDDRYVTKLDKGIGV
FT                   RIGEVDLRLTGVLSFFATEGFKTRGNATVAGGLLAPSVANNSNAIRAGYLPSNLVTNLT
FT                   TRQEGLDLSFTLGLYTGGNNVSVGKFNANNGGAAVALGTPGIDLRQVFGTIGTPDFGTV
FT                   KIGRDLGLFAADAVLNDATIPGVGFFSSNAAPGNATLGHVGFGYFYMDWLPQITYTTPD
FT                   FYGFTASVGVFSPLQEYNYSGLSGEMSAHDQPGLQWRLKYIGHYGDDLKLTAWTSGMTQ
FT                   QHRAEIGDSVVTNGSLAAGANIRAVGFDGGARLDAGPVSLLAYGYYGRGMGSTFLFFDG
FT                   INREGQKRDSYGGYAQASYTFYDRFTIGSAYGISLLNATYGDPSTLLRSNSSVMGFARY
FT                   KLTDWITLQGEFTHLISRNQAGGSVTGDAFVLGTFMSF"
FT   sig_peptide     complement(135778..135882)
FT                   /locus_tag="Bind_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 35"
FT   gene            complement(136076..137218)
FT                   /locus_tag="Bind_0119"
FT   CDS_pept        complement(136076..137218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0119"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; biotin/lipoyl
FT                   attachment domain-containing protein; KEGG: gdi:GDI1720
FT                   putative pyruvate dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93777"
FT                   /db_xref="GOA:B2IBQ5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ5"
FT                   /protein_id="ACB93777.1"
FT                   /translation="MITGEIKAITMPKFGLAMTEGKVASWAKTIGAEVNVGDDLADIET
FT                   TKITNAYESPVKGILRRQVAQEQEELPVGSLIAIIADRETSEDEIDRFIDKFQAEFVSE
FT                   QDKSETVAAPEPRVIEVSGQKIRILEIGNGEGAPIVFVHGFGGDLNNWMFNQPPLAEKH
FT                   RTIAIDLPGHGGSVKETSGDIASLAKSVGETLDALGVASAHFVGHSLGGAIILALALER
FT                   PTLVASLSLISPAALGDVINTDYTDGFITADRRKTLKPVLQLLFADPSLVSNDMIDDLI
FT                   KFKRLDGATTALTAIASANFKEGRQSLNLLSRLAEIKAPVEILWGKQDQVVPMVDPGQL
FT                   PGTIAFHPLEKSGHMPQMEQSAEVNGLIGDFITKVETKVG"
FT   gene            complement(137215..138240)
FT                   /locus_tag="Bind_0120"
FT   CDS_pept        complement(137215..138240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0120"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gdi:GDI1721 putative pyruvate
FT                   dehydrogenase E1 component subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93778"
FT                   /db_xref="GOA:B2IBQ6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ6"
FT                   /protein_id="ACB93778.1"
FT                   /translation="MSKKSYRQAINEALASEMRRDPTVIVMGEDVAGGAGTKGQQDAWG
FT                   GVLGVTKGLITEFGPERVLDTPLSESGYIGAAAGAAATGLRPVAELMFIDFMGVCFDQI
FT                   FNQAAKFRYMFGGKAVTPLVIRAMYGAGFRAASQHSQCLYPLFTHIPGLKVVIPSSPYE
FT                   VKGLLIQSIRDNDPVIFFENKVMYDDIEEVPDEPYTIPFGEANLTREGDDVTIVAIGRM
FT                   VKMANEAADRLEKQGITCNVIDPRTTSPMDFDTILDCVADTGRLVIVDEASPRCNMATD
FT                   ISAVVAQEAFGALKAPIKMVCPPHTPVPFAPNLEDLFVPNADRIEKAAKALMNYQIKEP
FT                   A"
FT   gene            complement(138252..139217)
FT                   /locus_tag="Bind_0121"
FT   CDS_pept        complement(138252..139217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0121"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase E1 component; KEGG: gdi:GDI1722
FT                   putative pyruvate dehydrogenase E1 component subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93779"
FT                   /db_xref="GOA:B2IBQ7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ7"
FT                   /protein_id="ACB93779.1"
FT                   /translation="MQLSREDLLKAYRTMRTIRDFEERLHIEFATGEIPGFVHLYSGEE
FT                   ASAAGICMHLTERDHIASTHRGHGHCIAKGVDVVSMMSEIYGRKDGVCGGKGGSMHIAE
FT                   IAKGMLGANGIVGGGPPLICGAALTAKTLKTGGVAVAFYGDGASNQGTTLESLNLAKIW
FT                   NLPVIFVCEDNGYAEATSSSYSVGGTQTKRAEGFGIPAQEVDGHDFFAVYDAARDAIQK
FT                   ARAGGGPSMLHVKTYRYYGHFEGDATTYREPGEADRVRKERDCLVKFRTKVTEAALLEN
FT                   QDLDGVDAEIAALIERAVQHAKAAPLPTEEDLLSDVYVSY"
FT   gene            139904..143272
FT                   /locus_tag="Bind_0122"
FT   CDS_pept        139904..143272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0122"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gbe:GbCGDNIH1_0231 acriflavin resistance plasma membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93780"
FT                   /db_xref="GOA:B2IBQ8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ8"
FT                   /protein_id="ACB93780.1"
FT                   /translation="MNAIVVTALRRPYTFVVLSLLILMFGVMSVFKTPTDVFPNIKIPV
FT                   VSVVWTYAGLMPEDVGGRIVRYYEQAVTSTVEGIEHIESTSYYGSAIVNIYFQPGTDLG
FT                   PAESDVVAISQTVIPQLPPGISPPMIMRLEASSVPVVTMQVTSDSRTPADLYNLAFARI
FT                   RPFVVTVPGAIIPHPYGGKPPFLLVNLNQQQLLAHNLSGMDVENAFEKQSIVLPAGDQK
FT                   IGRKDWMVQTNAIPMSVERFEDLPIKKVGNAFVHLRDIADVSLSGPPQTNAVLVKGKQA
FT                   VLVVVMKSGEASTLDVVQGVKDLMPRLQKLLPPDVHVQLLNDASIFVKDSIQDVVREMA
FT                   TAAALTGLVVLLFLGSWRATVIIATSIPLAILCAIIGLGWAGQTINVMTLGGLALAVGI
FT                   LVDDATVMIENIDTHLEMGKDIETAIIDAANQIVIPTFVATLCICIVWFPLFTLSGVSG
FT                   WLFMPMAEAIIFAMIASFILSRTLVPTMAKYLLAGHAAHAAHEGAHGAGAHGEDHANPA
FT                   EEALPIAVEEQEVVDYPHAMALKDAAEEASFNEAVHEELLHQEMQHETVGHAPHAEKAP
FT                   GFFSRFQKGFEKGFSNFRESYRGALEKAVMHRGAFITVFLVLTLGSMTLFYFSGRDFFP
FT                   EIKSGTLQMHMRAPLGTRIEVTSRIVSLVNDEIEKLLPGQVENIVNNCGLPVGPHNLAF
FT                   IPTPTIGTQDCDLTISLKNETSPVWDFRRILRKGLSSRFPGTIFTFQPADLTAKILNFG
FT                   SPSPIDVQISGLEAAKNYDFARKLAERLSTIPGAADVTIQQTMRTPTIMVNGNRTFGLG
FT                   TGMTEQDLANNELIALSGSQQIHQSYWLNPENGLSYPINIYTPQEQLTSVNDLLTIPVS
FT                   KGDGNPEGKAPQFLGSMSSLEPKGTPGQVSHYNLIPLFDLYVSNEGRDLGGVLDDVNKV
FT                   IASMEDELPRGAAIDVRGQAETMHSSYSQLIGGLVISVVLVYLLIVVNFQSWLDPFIII
FT                   TALPGALAGIAWSLFLTGTNLSIPALTGAIMCMGTATANSILIVSFARERFEIHGDAIR
FT                   AAIEAGYGRIRPVIMTASAMIIGMLPMSMSNSQNAPLGRAVIGGLTVATFATLMFVPCV
FT                   YALVYNRTNRKKESA"
FT   sig_peptide     139904..140002
FT                   /locus_tag="Bind_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.601 at
FT                   residue 33"
FT   gene            143272..144525
FT                   /locus_tag="Bind_0123"
FT   CDS_pept        143272..144525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0123"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: gdi:GDI3850 secretion protein, HlyD-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93781"
FT                   /db_xref="GOA:B2IBQ9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBQ9"
FT                   /protein_id="ACB93781.1"
FT                   /translation="MRKSKGAGRALIAVLIVGGIAGYQVFDRTKAAKEVADETLEGAVP
FT                   KISVVNPQAGPTEESLTLPGTIEAWYQAPIYAQVSGYVKMWHKDYGAHVKSDDLLAEIN
FT                   TPGLDAEYAQAQANLRSAQAKYNLAVVTANRWRALRKSQAVSEQSISEQEANEKSEAAL
FT                   VDAAQHNVARYEALQKFKKIVAPFDGVITSRSINVGDYVNQGGGSVGASGNATELFSVA
FT                   DIHAMRLFISVPEVFSYILKPGLTADVVTPQYPDRHYTAKFLTVANGYDTNTRTAVTEF
FT                   TIDNDDASLWPGSYSTVKLTASADPHILTIPTSALVFEEEGLQVATVTPDNHIHFKPVT
FT                   SGKILGEQVQITLGLTKADRIADNPPAALMEGQEVKIVPATPGYNNAVPNHEATQANGS
FT                   RQQLGLADEQTSAQETKK"
FT   gene            144522..146099
FT                   /locus_tag="Bind_0124"
FT   CDS_pept        144522..146099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0124"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: mca:MCA0176 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93782"
FT                   /db_xref="GOA:B2IBR0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR0"
FT                   /protein_id="ACB93782.1"
FT                   /translation="MKCLFPAGARSSGLLFLLSLSACDLAPAYQPPDLELPTHWQGKGP
FT                   FKEAQPADTAVRPGWWKLYHDPLLNRIEEEATASNADLQAAAERFVQARDMIMGAQSQL
FT                   FPQVGIGFGASNNKRSVHRLFNSPADPIHDSDETFAGLVSWEPDIWSAIRNKTRAELNF
FT                   AEQRAAEYASAQLSLQSQIAWDYFALRGLDAQDAIYKQSIAYYQQSLNIIKERLSGLVS
FT                   PKLDVARAENLLYSTQAEELDIQAQRQVMEHAIAILANTAPSAFHIPPANTLHTSIPKI
FT                   PTRVPSDLLQRRPDIASAERKMAQANRIIGIARAAFYPNVSIRVDGGFTDSGLNLFKVA
FT                   NSLWAYGADVTLPIFDGGLRRADLQQSLSAYRETTDNYRSTVLNAFREVEDGLSRTNRL
FT                   SAEVKKQHAAVTAASETQTMTMDLYKGGLNTSLDVITAQVNTLTARIREVQIQMQLLQV
FT                   STELIRALGGGWDKSNLPEQREMQAFGIFQVDNLDKPPPAGGIDVQTDPQANSDLTRPI
FT                   SQQSKAGH"
FT   sig_peptide     144522..144590
FT                   /locus_tag="Bind_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.886 at
FT                   residue 23"
FT   gene            147095..147952
FT                   /locus_tag="Bind_0125"
FT   CDS_pept        147095..147952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0125"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: rle:pRL110441 putative phosphomethylpyrimidine
FT                   kinase; TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93783"
FT                   /db_xref="GOA:B2IBR1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR1"
FT                   /protein_id="ACB93783.1"
FT                   /translation="MNDSLRGGAERAALIPNVLSIAGSDPSGGAGIQADLKTFAALECH
FT                   GMAAITALTVQNTQGVRAIHVPPADFVGAEIDALFADSTIAAVKIGMLAEASIAKAVAA
FT                   SLARHAPPHIILDPVLAATSGDSLSGPALAEALVTHLFPLATLVTPNLSEAAHLTGLPF
FT                   SAAKDSMGVTAEALMACGARAVLLKGGHLEGDLAEDLLYTASYQERFSARRVETRNTHG
FT                   TGCTLASAIAAFLAHGHDLRSAVAAAKAYLTRALESADRLDVGQGHGPVHHFHALWPSR
FT                   SGGV"
FT   gene            complement(147977..148681)
FT                   /locus_tag="Bind_0126"
FT   CDS_pept        complement(147977..148681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_4766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93784"
FT                   /db_xref="GOA:B2IBR2"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR2"
FT                   /protein_id="ACB93784.1"
FT                   /translation="MRKPYLPVGGFFVADLAALFSFIGLFATIPVLAQTAAPPPPYAYY
FT                   AQGMISAQTARFINDVLPAAQFLDEASRMALTHSHDQRIRRMARRIAGQQTMATNTMTA
FT                   FLTTGNTRAAGLMTGRSVAVQTGNPTDNPLAPVGGLSNVVTGGALGTQPMGMRPGTFAL
FT                   STHQSEELERLAKLRGPDFDRLYVSTQIDAMRQLAVIYRDYRQNGDNPGLREFAGSALP
FT                   LLTRTIARLSAL"
FT   sig_peptide     complement(148580..148681)
FT                   /locus_tag="Bind_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.885 at
FT                   residue 34"
FT   gene            complement(148825..149850)
FT                   /locus_tag="Bind_0127"
FT   CDS_pept        complement(148825..149850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_2959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR3"
FT                   /protein_id="ACB93785.1"
FT                   /translation="MSIFRESIFRKTVLPVLGRMVPRMAGLSVICLFASAAEAQLTLPG
FT                   AMHTAPSPAGGGNKASANPPANPLSGRTKFKPRPVGLKAPSEDTVQGRELTRYGQNGRL
FT                   AIAFGADKTLQITTLTLEGEQISVPRETCRIAVVADEPIVPRLVGKPAGLARYEADIAA
FT                   CPFHFDVMNGAVLIAREPATCDFTAADCRVDPTGLWGPQGSTISEKEARSWENIRGRSE
FT                   ANMRTNFRALLATAGKDKAAIKSIAGDQAGFSSQREMVCRNYAQEEVHGFCALRLTEAR
FT                   ALLLQTQYDDRVEKDPELKKQIQKEDAERRRNAELKAAAKANEAKTMQPAAASPGAFPN
FT                   F"
FT   sig_peptide     complement(149731..149850)
FT                   /locus_tag="Bind_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.890 at
FT                   residue 40"
FT   gene            150289..152187
FT                   /locus_tag="Bind_0128"
FT   CDS_pept        150289..152187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0128"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: mex:Mext_2960 chaperone protein DnaK; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93786"
FT                   /db_xref="GOA:B2IBR4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBR4"
FT                   /protein_id="ACB93786.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVMEGTTPKVIENAEGARTTPSIVAFTDD
FT                   GERLVGQPAKRQGVTNPERTFFAIKRLIGRTFEDPMTKKDIGLVPYKITKAPNGDAWVE
FT                   ADGKPYSPSQISAFILQKMKETAESYLGQPVSQAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKKGSGTIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDTRLVEYLADEFKKENGIDLKKDKLALQRLKEAAEKAKIELSSATQTEINLPYI
FT                   TADATGPKHLALKLTRAKFEALVDDLIQKTVEPCRKALKDAGLSAGEVDEVVLVGGMTR
FT                   MPKVQEIVKQFFGKEPHKGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPLSLGIETL
FT                   GGVFTRLIDRNTTIPTKKSQVFSTAEDNQTAVTIRVFQGEREMAADNKLLGQFDLVGIP
FT                   GAPRGVPQIEVTFDIDANGIVNVTAKDKATNKEQQIRIQASGGLSEADIDKMVKEAEQH
FT                   AAEDKVRRELVDAKNHGEAIIHSTEKSLAEFGTKVAESDKSTIDAAIAALKTELAGENL
FT                   EGIKAKTDALVQASMKLGEAMYKAGAEGGESAEAPKDDVIDADFKEVGPDDHKKSA"
FT   gene            152599..153717
FT                   /locus_tag="Bind_0129"
FT   CDS_pept        152599..153717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0129"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: mex:Mext_2961
FT                   chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93787"
FT                   /db_xref="GOA:B2IBR5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBR5"
FT                   /protein_id="ACB93787.1"
FT                   /translation="MAKRDFYEVLGVTKTCTEAEMKVAFRKAAMQWHPDRNPGNEEAEI
FT                   QFKEINEAYQTLSDGQKRAAYDRYGHAAFEHGGGGNDGFASSMADIFDDLFGDVMGRRG
FT                   GRNGPARGSDLRYNMEITLEEAFQGKLASLTLPTSITCEACDGTGAKAGAKPRICPTCG
FT                   GQGRVRAQQGFFAIERTCPQCHGRGEIIDDPCQACGGAGRVTRERTLSVNIPPGVEDGT
FT                   RIRLAGEGEAGTRGGPAGDLYIFVSTKPHPFFQRDGADLFCRVPISMTQAALGGEVTVH
FT                   TIDGKEAKVKISEGTQSGKQFKLKNKGMPVLRSREVGDLYIQATVETPQNLTKRQRELL
FT                   AEFDAESSNKTHPEASGFFARMKDFFENLSGQ"
FT   gene            153939..154733
FT                   /locus_tag="Bind_0130"
FT   CDS_pept        153939..154733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0130"
FT                   /product="ribosomal RNA adenine methylase transferase"
FT                   /note="SMART: ribosomal RNA adenine methylase transferase;
FT                   KEGG: azc:AZC_0161 phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93788"
FT                   /db_xref="GOA:B2IBR6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR6"
FT                   /protein_id="ACB93788.1"
FT                   /translation="MPALKLEQRLADEARFFKSWLDNPLLTGAVSPSSRSLARMMARYV
FT                   DLGVPGPIIELGPGTGPITEALLQHGVAPERLILIEYDSAFCQLLKQRFSGVRVVQGDA
FT                   YRLRQSLGPILEQPAACIVSSLPLLNKPEQQRLALLEDAFSCMGPEGSFIQFTYGLISP
FT                   VPRNLVSGRFEAKPSPPVWFNLPPARVWVYRRCVETVQRPAKFHDLLGKLKLGTDKIQR
FT                   EVDAAKARLHFGDKAKAVPLKRSMEPLRGQRTDGSRERGRRS"
FT   gene            154730..155485
FT                   /locus_tag="Bind_0131"
FT   CDS_pept        154730..155485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0131"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: mex:Mext_1520 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93789"
FT                   /db_xref="GOA:B2IBR7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBR7"
FT                   /protein_id="ACB93789.1"
FT                   /translation="MNAPSSSPDKPLDPRDRLIVALDVTDPAAARTLVNRLGDSVSFYK
FT                   IGMELAYGGGLPFASELLKEGKKVFLDLKLHDIATTVSNAVAQVARLGVHFLTVHAYPQ
FT                   TLDAARRGAVGSPLKILGVSVLTSYDDADLAEAGYAYSVADLVARRALQAREAGVDGLV
FT                   LSAAEAAAIRSQLGSDLILVTPGIRPRGTSAKDQKRVATPSLAIAAGADHLVVGRPITV
FT                   APDPKGAADQIVAEIEATLASMAPPPDKP"
FT   gene            155522..156337
FT                   /locus_tag="Bind_0132"
FT   CDS_pept        155522..156337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0132"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   mex:Mext_2507 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93790"
FT                   /db_xref="GOA:B2IBR8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBR8"
FT                   /protein_id="ACB93790.1"
FT                   /translation="MSELKLVVAGAAGRMGRVLIQTAIETSGVTVSAALARPGSLALGQ
FT                   DAGLLAGCGEINVPITEDALAAIVDADGILDFTSPDLSVELAALAAQARIVHIIGTTGF
FT                   SVAHLTKIEAAARHAVIVRSGNMSLGVNLLAALVKKTAAVLGPVYDIEIAEMHHRMKVD
FT                   APSGTALLLGEAAAQGRGISLSEHEQRGRDGHTGPRKDGDIGFVSLRGGTVVGDHTVIF
FT                   AGPGERIELAHRAEDRRIFGRGAVQAALWGKGRKPGLYSMLDVLGLGGE"
FT   gene            156383..157435
FT                   /locus_tag="Bind_0133"
FT   CDS_pept        156383..157435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0133"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: mex:Mext_4768 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   magnesium chelatase ChlI subunit; AAA ATPase central domain
FT                   protein; Holliday junction DNA helicase RuvB domain; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93791"
FT                   /db_xref="GOA:B2IBR9"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBR9"
FT                   /protein_id="ACB93791.1"
FT                   /translation="MSKTPERLVTSEVRDEDMTEASLRPLTLADFTGQAAARQNLSVFI
FT                   AAAKARREALDHVLFVGPPGLGKTTLAQIVARELGVNFRSTSGPVIAKAGDLAAQLTAL
FT                   EERDVLFIDEIHRLNPAVEEILYPAMEDFQLDLIIGEGPGARSVKIDLARFTLVGATTR
FT                   AGLLTTPLRDRFGIPIRLEFYTIEELERIVLRGARVQGLALEKEGANEIAKRARGTPRI
FT                   AGRLLRRVRDFAIVDGVESVTRTLADKALSLLDVDPIGLDQMDRRYLNVIALSFGGGPV
FT                   GIETIAAALSEPRDAIEDIIEPYLIQQGFLQRTPRGRLLTPHAFRHLGLKEPVRETPQY
FT                   GLFPDQSEED"
FT   gene            complement(157457..159502)
FT                   /locus_tag="Bind_0134"
FT   CDS_pept        complement(157457..159502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0134"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bra:BRADO4669 putative efflux transporter
FT                   permease; putative fusaric acid resistance pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93792"
FT                   /db_xref="GOA:B2IBS0"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS0"
FT                   /protein_id="ACB93792.1"
FT                   /translation="MTLPNSRDWIFSVKTFAAALLALYIALMFDLPRPYWAMATVYITS
FT                   QMLAGATRAKAAYRIAGTFCGAAVTILLIPNLVNAPLLLCLAIALWVSFCLYCSLLDRT
FT                   PRSYLFILSGYTAALIGFPAVEEPGTIFDIAVSRAEEISIGIICASLMSVVILPRTVGE
FT                   VVADRIEEWCAEADQLVLKICGTEGLEQLHTTFLRLAGGVLALEVFLKQIAYEASIKRH
FT                   SVEALAILRQHMLVLLPIASGISDRIRILKHLSAFPTEADHLIADLRKWLQGDDTSAVS
FT                   PMILRATAEAAKPAPTKDWNTLLSLSLIAQIEHFIDLQEDIRRLKKHVINGTRLPELKC
FT                   PYIRSTLNIRHRDHTLAFRSALSAFVSILVTCGFWILTGWSNDGSGAPMMAAVACCFFA
FT                   TMDDPAPAILKFANSTIIGALWTAIYLFALLPRVTNFEMLALMLAPALLLCGALMHHPK
FT                   TALSAMGAAVIGLTLLALHSAYGADFAVFVNSAFAVTSGMWIAAIVTRLIRSVDETWTA
FT                   RRLVNLNRSMLVEVADGHRRRGGFEIAALMLDRLGLISTRLKTARIAEELQPEVFLAEI
FT                   RAAINIAEIKQARRRQPEAIRRAIDRILNAAIGHFGGQVHMKTRTLLEEIDAGLTIIPV
FT                   DEEQDLCARLVGLRVALFPDALPYAPPSERIQDKNNPLLLEPVQRP"
FT   gene            complement(159499..159972)
FT                   /locus_tag="Bind_0135"
FT   CDS_pept        complement(159499..159972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0135"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bvi:Bcep1808_5466 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93793"
FT                   /db_xref="GOA:B2IBS1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS1"
FT                   /protein_id="ACB93793.1"
FT                   /translation="MSAKRNGARLRQHYTFTLLQAARAWRRYANVVVETYGLSEATALA
FT                   LIYIGRSKEAPRQSELASTLGIEGPTLVRLLDQLCALGLVVRREDPGDRRAKVLGLTDA
FT                   GRDSVMAIEDELDVLRGSVLEKVSMADLETSLRVFTAILDHTSRIDVHQEIEA"
FT   gene            160278..161213
FT                   /locus_tag="Bind_0136"
FT   CDS_pept        160278..161213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0136"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ter:Tery_4588 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93794"
FT                   /db_xref="GOA:B2IBS2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS2"
FT                   /protein_id="ACB93794.1"
FT                   /translation="MAGISVIVPVYNGARHLPALLDAFEAQTQDPAQVEYIIVNNKSRD
FT                   RTSEIASSYAKTAKINLTCIDENDIQGSYAARNKGIHTSRGEFLLFTDADCVPHPDWIK
FT                   NIIQGFENPNVGAVAGTILPYPGTTLLEEFAAHAGILSHVHSLNHAYMPFAQTANVAFR
FT                   RDVFRKTGLFRSGLRTGGDADLNWRMQKTTGYKLIHQENAVILHRHRRSFRDLYEQFER
FT                   YGRAAVYLDDMHGWKAPRELDFPYSFYQLVTWLFFKYPVLLTKYHAASIPRVEVYLEPL
FT                   TLYIKLCSAIGTAKARQLERVNDLSIEYLS"
FT   gene            complement(161253..164000)
FT                   /locus_tag="Bind_0137"
FT   CDS_pept        complement(161253..164000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0137"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic subunit
FT                   P20"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93795"
FT                   /db_xref="GOA:B2IBS3"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS3"
FT                   /protein_id="ACB93795.1"
FT                   /translation="MPARPFFRILFVAVVAVISHASYAEAAEKRIALVIGNSAYQADPL
FT                   ATSANDAGLIAQSLQAAGFDVVGARDLDAATLRSAFHEFLDKAGASGPETVALVYFAGR
FT                   GLQFEGENYLVPVDARITRDTDVPIEAFRLTDLTQPLTALPLKARIFILDAARANRFAP
FT                   AGQPLAGGLALMQPDPGTLIAFNAAPGTIAPESQQAYGAYASALTEMIKEGGLPLDELF
FT                   ERVRLRVNALTNGAEVPWYVSRVEAPFLFFERTSAAPPAQADRFAELMSRPIDSFDVHD
FT                   AYLAALTRDTLRGYQDFLAAYSNDPLARRVRAIIAVRREAMTWRQTVFADTPDAYWSYL
FT                   RRYPRGAHADDAHRRLAHFAAALEPPSTFAAIDYDVPPPPPEEIVYVERPVVSFADPEY
FT                   DLPPPPPVPVFFLPPQPVYFVDAPPPPPPVDEFVLPIPVYQPVPSWIERPHYVAPPPVN
FT                   VINANIHNNVEVNPASQTVVVTNPAGQQIAPLPTNLLPAQPAAPVEGQPNFVERHPGAS
FT                   AVIGAAAVALPTAALLHARQKAGQSPVQGQSPTVPGQAVGPGQQATPLQATPNPAVNPP
FT                   NQHPSVPSVQGGQPLPEPKAPTVTDHGPDHGVPPHGPSAAPTPPTLPGQVGPGQQATPP
FT                   QVTPNPVVNPPNQHPSVPPVQGLPPLPEPKAPTVPDHGPDHGIPAHGPSVVPTPPTLPG
FT                   QAPAVNQHPQQHPASPPPSTIQEGQPLPAQKAPPPVEHAAPPHNAGRAQTPVVPVPPTE
FT                   PHPNAPGLTAPHPAPPGQAPAAHPQTPQPPSVNPHEQHPGAAAPVPAGQAPLPKPLPAP
FT                   DHNAPPHSTGAMPAPSAPTAPAGHTPPAPHPQAIIPAEPQARPSAPLPERHPAPPIAPP
FT                   AAPPKVQQKLQQRQVIQPQERAAQPHPPQQKQSECGHPGAPPCH"
FT   sig_peptide     complement(163926..164000)
FT                   /locus_tag="Bind_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.635 at
FT                   residue 25"
FT   gene            164257..167055
FT                   /locus_tag="Bind_0138"
FT   CDS_pept        164257..167055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0138"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   ajs:Ajs_2889 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93796"
FT                   /db_xref="GOA:B2IBS4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS4"
FT                   /protein_id="ACB93796.1"
FT                   /translation="MTTKGARTDIMTNLARQADDRLNEEIRLLGQILGETIREQEGDES
FT                   FDRIETIRRLSVAFERGADAAAGETLDTLLRGLSAEQAVSVIRSFSYFSHLANIAEDHE
FT                   TIRRSIAETGTEEPAGQETDSADDDFDGGMARLTAAGVDKARIIEALRQSFLSPVLTAH
FT                   PTEVQRKSQLDAEHAIFSLLVEREHLGPGAARRRNDALLAACITQAWQTRLLRNAKLTV
FT                   RDEIENALSYYQTTFLRQLPALYAELEEWLGVRDLPCFLRMGSWIGGDRDGNPNVNAET
FT                   LDIALRRQAEVALRHYLSEVRALGNELSLSRLLVGCSQDLLRLAETSGDDSPHRADEPY
FT                   RRALIAIKGRLAATLKELTGQEDSKPAPLGTQAYPDASALLADLAIIEKSLAENHGRAL
FT                   IGPRLAPFQRAVKVFGFHLATVDLRQSSDRHAETIGELLRVAKVVEDYDALDEKARQDL
FT                   LMRLLQDPRLLHVPYLRYSARTEEELAVFETARRLRRSHGPLAIRQYIISHTETVSDLL
FT                   EVLLLQKECGLIEGLIGDPEQKPRAELMVVPLFETIEDLRNAQGIMADFFALPGMADLV
FT                   RASGGVQEIMLGYSDSNKDGGFFTSNWELYRVSIALAGFFAAQEGIVLRLFHGRGGTIG
FT                   RGGGPSHQAILAQPPGTANGLIRLTEQGEVISSKYAQPEIGRRNLETLVAANIEATLLG
FT                   GDEAPPEAFLEAAHFLSEASTKAYRGLVYDLPGFVDYFYAATPIAEIADLNIGSRPASR
FT                   KSSRKIEDLRAIPWSFSWGQARVSLPGWFGFGTAVEAFLNDAPEEKLALLQRMAREWPF
FT                   FHALLSNMDMVLAKADRKLARRYAALVPDQALAERIFGIIDTEWTRTLHALDEITGVHE
FT                   RLADNPALAHSISRRFPYIAPLNHLQVELLRRWRLGKTDARTYNGILISINGIAAGLRN
FT                   SG"
FT   gene            167209..169008
FT                   /locus_tag="Bind_0139"
FT   CDS_pept        167209..169008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0139"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ppg:PputGB1_4083 amino acid adenylation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93797"
FT                   /db_xref="GOA:B2IBS5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS5"
FT                   /protein_id="ACB93797.1"
FT                   /translation="MYPMRSVSVRRENAGRETTDLEAPDLEAKARTRDGETDHVFSATM
FT                   LVPGWRVQERIAFHAQRQPDEIALVQGPVRLTYDQINARANRLARYFVSLGLRPAAPVG
FT                   LCMRNGLVSMIACLAVLKAGGACVPLDPIMGPHWLAAFIIQAGIDVAIVDDHHALDLFE
FT                   DAPRLNLLDYESISAAAELESDADFDIAWDTDSLALILPVSQVAGPRGVEMTHRALHHC
FT                   CDLAHGLDFSAATVALQMVFAPQELAWFQNLSLLIAGGRLVFYGAIWPETAEIANLIRS
FT                   ETIDTSFLTPSLCGWLLDEDPSLFAPLERVVIGEQDLAPVPLAPIHLRILLRQLVKRGV
FT                   KGATKGEIVLLYGPAEAPAALMTRLWHEDDADDVTRIVPEPLNNARVQLLDTRRRPCPD
FT                   GVLGEICLGGEGLASGYRRDERLSQQSFIPDPAQPEDKLFRTGDYARRRLDGTFERLGR
FT                   LDEKVILSGYRVELKAIERVLRAQKGVADAVCDYRRSRAYGESVIAFFVEASPGAINET
FT                   RLLAALRRLLPPFMVPDFLRKLETLPLLPDGHPDRQALAALPMFAPSPKQRQPSFGMSK
FT                   EFLRGALRRFGLGRVPEDKAISG"
FT   gene            complement(169130..169663)
FT                   /locus_tag="Bind_0140"
FT   CDS_pept        complement(169130..169663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0140"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: gdi:GDI0826
FT                   ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93798"
FT                   /db_xref="GOA:B2IBS6"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS6"
FT                   /protein_id="ACB93798.1"
FT                   /translation="MAKSQSASVTHIEEYLGTPTDLHANDVREVAAGLKRLLADVFALY
FT                   VKTKNFHWHVSGRHFRDYHLLLDEQATQIFAMTDPIAERARKIGATTLHSIGQIASEKR
FT                   IADNDAEYVEPQDMLAELRDDNKQLVAYLRELHGVCDAAHDVATASLIENWIDEGERRT
FT                   WFLFESTRGFGANS"
FT   gene            complement(170001..171875)
FT                   /locus_tag="Bind_0141"
FT   CDS_pept        complement(170001..171875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0141"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mex:Mext_2752 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93799"
FT                   /db_xref="GOA:B2IBS7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS7"
FT                   /protein_id="ACB93799.1"
FT                   /translation="MRSPGKSRGPAASRPSRLALLMIAGLGMPGGLSDAFAETLAPSKT
FT                   PAAKIPLAKIPLTERPFIKTQFAKTDADEADTLRSVRAPSPLPASSTPPTVQSEDSVKP
FT                   DSATDKKPETAMAPAIPASALQKLIEDRAERPVTGPHITEQRREREAIAAFYAARDFAL
FT                   LWFTDGHPNRAARSLLPRLAAAAEDGLDLGPRLPALPPDNASADSNLDETRQAALDLAL
FT                   SEAVVAYGRQASGSRIDPHEIGKLIGARPEIADPSLILASVAAAGPEAGTILRGFNPQQ
FT                   EGYVALRDKLVAMRQERQPVARRLIPSGPPLRVGMRDPRVALIRARLSLDGKLDKGQTE
FT                   NGASEIYDSEVSMAVADFQRANGLPASGVLTPQTSAILSGARLSATPLSPHVEHEILAN
FT                   MERWRWMPHDLGHDRIEVNLPDFEVAVIEKDEVVSRHRVVIGKEETPTPIFSHVMQFLI
FT                   VNPYWNVPASILKKEMLPKLAANPNYLHRLGYEVFKRDGHLVVRQPPGERNALGRIKFM
FT                   FPNDYAVYLHDTPSKHYFEEDKRAFSHGCVRVDEPYHFAEAVLGPKWSESRIKGLFGEK
FT                   ERYITLPKPLPIHLEYFTATVDRFGHLHLSEDVYGYSQKVRIALGLQD"
FT   sig_peptide     complement(171762..171875)
FT                   /locus_tag="Bind_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.813 at
FT                   residue 38"
FT   gene            complement(172047..173600)
FT                   /locus_tag="Bind_0142"
FT   CDS_pept        complement(172047..173600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0142"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: mex:Mext_2753
FT                   sigma-54 factor interaction domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93800"
FT                   /db_xref="GOA:B2IBS8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS8"
FT                   /protein_id="ACB93800.1"
FT                   /translation="MSPRILIADDDPVQRRLLEAQVQRFGYVTETVDNGAAALARVKAQ
FT                   GQAQGQGHGHAPLDLLILDLAMPDIDGLGVLKTLRKEGYRVPAIVQTANGSIETVIAAM
FT                   RAGAADFVVKPVGTERLQVSIKNALRADALEDEIRRMNRHAAGALSFKDLIAGSEAMER
FT                   VIRLGERAAKSTIPILLEGESGVGKEVIARAIQGLSDRRGKPFITVNCGALPEPLVESI
FT                   LFGHEKGAFTGANERHVGKFVEANGGTLFLDEIGELPLETQVKLLRALQEGEVDPIGAK
FT                   RPVKVDIRLISATNRNLIEQVKRGRFREDLYYRLNVFPIHVPALRARREDITELARTFA
FT                   TRFAAEEGKPLRGLTPETEALLCAYDWPGNVRQLENAVFRAVVLADGDELTVTEFPQIA
FT                   AHVHGFDICVPPAPLPVALQPARETEFVPVELRDPHVLRLLDDEGEILPLERLEAEIIR
FT                   FSLIHYRGQMSAMARKLGIGRSTLYRKLKEYGLQQGAEGDPLGLSDPMAGLLNRAGAAA
FT                   "
FT   gene            174279..174536
FT                   /locus_tag="Bind_0143"
FT   CDS_pept        174279..174536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93801"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBS9"
FT                   /protein_id="ACB93801.1"
FT                   /translation="MQGPQRLGTLLAGFAFASVIAMGAALAGGTPNDAAGAQGHNAPSI
FT                   AAPTEGVSEGNPNAKILPYSSLDQKSDTEEASAAPEEHAK"
FT   sig_peptide     174279..174362
FT                   /locus_tag="Bind_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 28"
FT   gene            174770..175036
FT                   /locus_tag="Bind_0144"
FT   CDS_pept        174770..175036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93802"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT0"
FT                   /protein_id="ACB93802.1"
FT                   /translation="MQENQRCSGLLAGFALLGIVVGVFVSVLATGVAFAGGTPNDAAGA
FT                   QGHDAPSSAEPTPEISEGSPDAKVLPDDDDPEDVDAPSERSVR"
FT   sig_peptide     174770..174877
FT                   /locus_tag="Bind_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.949 at
FT                   residue 36"
FT   gene            175153..177234
FT                   /locus_tag="Bind_0145"
FT   CDS_pept        175153..177234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0145"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: noc:Noc_1156 peptidase S9, prolyl
FT                   oligopeptidase active site region"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93803"
FT                   /db_xref="GOA:B2IBT1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT1"
FT                   /protein_id="ACB93803.1"
FT                   /translation="MLLRRHMIPFTNFCCFQDFEKNRKYSNALSLPRFDENVQMTPRTA
FT                   PYGTWLSPVTTDLMTEAAIGLGGLAVDGTDLYWLETRPSEGGRTTLCQRQQDGTIVERT
FT                   PAPFYVGTRVHEYGGGAYAVENRTIIFSDRRDGSVWIIEGQGEGAAPRRIPTSENCRYA
FT                   DFIFDPNHPRVLCVREDHRDRPPTDPKSAIVSLPLDASDKERVIVEGPDFLSSPRLSPD
FT                   GKILVWLSWEHPFMPWDWTRLHLAPLTLYGSITPAVVLAGRERESIVQPGFAPDGTLHF
FT                   CSDRTGWWNLYALRGDKIVPVAPVDAEIGGPHWVFAQHYYAFLPDKRLVASIVRDGIRT
FT                   ACVIDGDVITPLSLGQGQAGQVADCPQPIGQGLAFLATPPTAPPALSLVDKPEATKIQI
FT                   VRVAAPAVIPEETISIGEPIDYPSRGTIAHAFWYAPKNADYQAPDGTLPPLVVLSHGGP
FT                   TSMTTNHFTLSVQWWTSRGFGVVDVNYGGSTGYGRDYRRALDGQWGLVDVEDCQAAALY
FT                   LVEKGLVDPNRIAIRGGSAGGFTTLAALTTTQTFKAGASLYGVADLMLLARDTHKFESR
FT                   YLDGLIGPLPQAKALYAERSPINHIDRLTCPVIFFQGEDDKTVPPNQAETMVAALEARH
FT                   LPVSYYLFAGEGHGFRKAETIRRVLDLELGFYGRVFGFEPPNLSERVVISLIGDDHEG"
FT   gene            complement(177222..177740)
FT                   /locus_tag="Bind_0146"
FT   CDS_pept        complement(177222..177740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0146"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: pth:PTH_0205
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
FT                   TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93804"
FT                   /db_xref="GOA:B2IBT2"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT2"
FT                   /protein_id="ACB93804.1"
FT                   /translation="MPDKAVPIGLGFGSNIGDRPGNIRRAIDLLMERGVARITKISSLY
FT                   RTAPWGYREQEDFANACALATTRLAPHALLAALKDIEKTIGRQETIRWGPRVIDIDILF
FT                   YDDEWLDDPDLILPHKELFNRPFVLLPLAEIAPDLCLRGRGIGEAAAAADPSGITLWEK
FT                   KEPIETHPS"
FT   gene            complement(177733..178506)
FT                   /locus_tag="Bind_0147"
FT   CDS_pept        complement(177733..178506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0147"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: rpe:RPE_1857 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93805"
FT                   /db_xref="GOA:B2IBT3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT3"
FT                   /protein_id="ACB93805.1"
FT                   /translation="MGILNLTPDSFSDGGRFNASEAALARAKQLVAEGADLIDIGAEST
FT                   RPGYRPVSAAEELARLDPLLGKICRAVNVPVSIDTMKAEVARRAVALGATIVNDIWGLR
FT                   KDPAMADTIAETGAGLVMMHNREDIDAQLDILADLHRFFDRSLHLAEKAGIPSSRIMLD
FT                   PGIGFGKTAAQNLLVLRELHHLRDYGLPILVGVSRKSFIGALLDADVDHRLIGTLAANL
FT                   VAATRGASVFRVHDVAEHVAAFKIFSAIRNARAHA"
FT   gene            178808..179002
FT                   /locus_tag="Bind_0148"
FT   CDS_pept        178808..179002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_1138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93806"
FT                   /db_xref="GOA:B2IBT4"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT4"
FT                   /protein_id="ACB93806.1"
FT                   /translation="MSHPGNFFVGLAVAAVGVVLFLGLVNMTRGGSPNLSQKLMRWRIG
FT                   LQFVAILIILGVLLYREGI"
FT   gene            179040..179630
FT                   /locus_tag="Bind_0149"
FT   CDS_pept        179040..179630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0149"
FT                   /product="ATP--cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: rle:RL4317 putative
FT                   cobalamin adenosultransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93807"
FT                   /db_xref="GOA:B2IBT5"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT5"
FT                   /protein_id="ACB93807.1"
FT                   /translation="MVVLTRIYTRGGDGGTTSLGTGERRKKQDLRIETYGTVDEANACI
FT                   GLARIHTASEAAHAKLDAMLLCIQNDLFDLGADLCMPENTAANPKVEALRILPAQVERL
FT                   ERDIDTINAGLEPLSSFVLPGGTPAAAALHLARTVARRAERLLCALRETPGESVGAPTL
FT                   AYLNRLSDFLFVAARHVNQQGAGDVLWVPGLNR"
FT   gene            179901..181118
FT                   /locus_tag="Bind_0150"
FT   CDS_pept        179901..181118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0150"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mex:Mext_4075 acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93808"
FT                   /db_xref="GOA:B2IBT6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT6"
FT                   /protein_id="ACB93808.1"
FT                   /translation="MTSSLLPTYARAPIAFERGEGAWLTSTTGERFLDFGGGIAVASLG
FT                   YSHPHLIKALHEQGDKLWHTSNLFQIPQAERLAERLTAVSFADFVFFTNSGAEAMEGVI
FT                   KTARKYHAACGHPEKNRIITFQGAFHGRTLATIAAAGNEKYLDGFEPRLPGFDNVPFGD
FT                   LEAVKAAIKPETGAILIEPIQGEGGIRVVSPDFLQALRKLCDEQGLLLLLDEVQSGVGR
FT                   SGKLFAYEWAGVEPDVMAIAKGIGGGFPLGAFMATREAAKGMVVGTHGSTYGGNPLATS
FT                   IGNAVLDIVLEPSFLAHVEATGVLLQQRLVALRERHPEVIAELRGAGLMRGIKVTLPVA
FT                   DFAAAARAEKLLVIPAGDNVVRLLPPLIIGEEEVDGAIERLDAACAALKARINANSSSL
FT                   LSGAAE"
FT   gene            181115..182074
FT                   /locus_tag="Bind_0151"
FT   CDS_pept        181115..182074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0151"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: mex:Mext_4076 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93809"
FT                   /db_xref="GOA:B2IBT7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT7"
FT                   /protein_id="ACB93809.1"
FT                   /translation="MTPLPVSDLIVQPKHFLDLSRLEAKDLRAILDLAAGLKAKRRRGQ
FT                   KAKEQPLEGKVLAMVFDQPSTRTRVSFDLAMRELGGETIMLTGQEMQLGRGETIADTAR
FT                   VLSRFVDAIVIRILNHADLLELAEYAEVPVINGLTKLSHPCQIMADLLTFEEHRGPIKG
FT                   RTIAWTGDSNNVLASWIEAARRLDFTLNVACPAELSPAPELVAFANAQGKRLNVLRDPF
FT                   EAVRGADAVISDCWVSMGDEEEEARRQALLSPYQVNAELMATAAKDAIFMHCLPAHRGE
FT                   EVTDEVIDGPQSVVFDEAENRLHAQKGILAWCFGVTGS"
FT   gene            182071..183048
FT                   /locus_tag="Bind_0152"
FT   CDS_pept        182071..183048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0152"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: mex:Mext_2009 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93810"
FT                   /db_xref="GOA:B2IBT8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBT8"
FT                   /protein_id="ACB93810.1"
FT                   /translation="MNESAARFVSDNGEDDSVLPFAVEPLDVRGRVARLGPSLDHILSQ
FT                   HRYPAPVARLLGEAVVLTVLLGSSLKIEGRFQLQTRSEGAVDMLVVDFDAPDRLRAFAR
FT                   YDAQRLEFAERGTELLGKGHLAFTIDQGNDMSRYQGVVALEGQGLEEAAHQYFRQSEQI
FT                   PTFVRLAVAENITGGGAVWRAGGIMLQFLPSSPERQRQADLHPGDAPEGHETEPLAEDD
FT                   AWSEAKILAGTIEDHELVDPTLSSERLLYRLFHERGVKVFAPQTVHDACRCSRDGIARM
FT                   LRNFTPQERQDMIGDNGKIGVTCEFCSTFREFEPEELETPSPED"
FT   gene            complement(183052..183591)
FT                   /locus_tag="Bind_0153"
FT   CDS_pept        complement(183052..183591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0153"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mex:Mext_0666 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93811"
FT                   /db_xref="GOA:B2IBT9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBT9"
FT                   /protein_id="ACB93811.1"
FT                   /translation="MSFDREREDGERPEAKPSLMLALYQPDIPQNCGTMLRLCACLGVE
FT                   AAIIEPAGFPVSDRHFRRAGMDYLDQVALSRHVSFTAFRAWQIETGRRLVLLSTKASQP
FT                   YTDFTFRPDDILLMGRESAGVPEAVHASADARVVIPLRPPMRSLNVAVAAAMVLGEALR
FT                   QVGALAKVMDAPRASL"
FT   gene            184015..184533
FT                   /locus_tag="Bind_0154"
FT   CDS_pept        184015..184533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0154"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /note="TIGRFAM: ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; PFAM: Rieske [2Fe-2S] domain protein;
FT                   KEGG: xau:Xaut_2957 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93812"
FT                   /db_xref="GOA:B2IBU0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU0"
FT                   /protein_id="ACB93812.1"
FT                   /translation="MATATIDAPTRRDFLFIATGAMGVVAAGSVLWPLIDQMNPDASTL
FT                   AAATTEVDIGNIAEGQIVTVKWRGKPVFVRHRTKKEISDAEAVPVSELRDPQTDQSRVQ
FT                   KPEWLVVIGICTHLGCVPIGHEGQYEGWFCPCHGSVYDTSGRIRQGPAPLNLAVPAYRF
FT                   VSDTKISIG"
FT   gene            184653..185909
FT                   /locus_tag="Bind_0155"
FT   CDS_pept        184653..185909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0155"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: azc:AZC_3500
FT                   cytochrome b/c1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93813"
FT                   /db_xref="GOA:B2IBU1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU1"
FT                   /protein_id="ACB93813.1"
FT                   /translation="MSGSSTYVPKSGLARWFESRLPIVGLIHSSFIVFPTPRNLNYWWT
FT                   FGGILTFMLVAQIVTGVVLVMHYTPETTLAFASVEHIMRDVNYGWLLRYAHANGASMFF
FT                   IAVYIHMLRGLYYGSYKAPREVLWIIGVIIYLLMMATGFMGYVLPWGQMSFWGATVITS
FT                   LFSAIPFVGDTITTWLWGGFAVDNPTLNRFFSLHYLLPFMIAGVVVLHIWALHVPGSNN
FT                   PAGLDVKTPKDTLPFHPYFTIKDGFGLVCFLVFFSWWVFYVPNYLGHADNYIEANPMQT
FT                   PAHIVPEWYYLPFYAILRSIPSKLGGVIAMFSAILVFAFLPWLDTSRVRSAAYRPVYRF
FT                   FFWVFVVCALLLGYIGAQPPEGGYVLAGQLLTAYYFLHFLVILPLIGLFETPRELPASI
FT                   ADAVLGKHEVAATASATTH"
FT   gene            186077..186934
FT                   /locus_tag="Bind_0156"
FT   CDS_pept        186077..186934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0156"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: rpd:RPD_1303 cytochrome
FT                   c1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93814"
FT                   /db_xref="GOA:B2IBU2"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU2"
FT                   /protein_id="ACB93814.1"
FT                   /translation="MSLFKSGNGRGKSWMSRIVAAGLLLSASGMSAFAEEGGAETAHPK
FT                   PPRQEWSFGGPLGKYDQAQLQRGFQVFREVCSNCHAAKFLNFRNLSESGGPGFTPAQVK
FT                   ALAAQYKIKDGPNEAGEMFERPGRPSDAFPWTFANPQAATAALGALPPDMSVLAKARTY
FT                   QRGFPLFLVDPFIQYQEHGADYIYALLNGYTNEKDPNWNEFMPGHKIAMPKPLSDGLVA
FT                   YTDGTPQTAQQYAKDVTSFLMWMAEPKLEERKKFGFRVVIFLAVFAAMLYFVKRKVWSS
FT                   VHGH"
FT   sig_peptide     186077..186181
FT                   /locus_tag="Bind_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(187010..187975)
FT                   /locus_tag="Bind_0157"
FT   CDS_pept        complement(187010..187975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0157"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   azc:AZC_3136 twin-arginine translocation pathway signal
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93815"
FT                   /db_xref="GOA:B2IBU3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU3"
FT                   /protein_id="ACB93815.1"
FT                   /translation="MPFHRRRGWEIAACEATPESLFLNRRAFLRTSVAAGALLTTGLSE
FT                   FGGTADAEGSSASLYPAKTNSTYSLDRPLTPERVNAHYNNFYEFGATKNVAEAAESLRT
FT                   RPWTLKVDGLVEAPRDYAIDDLERTFPLEERLYRHRCVEAWSMTIPWTGFPLRALLDQV
FT                   RPLSGARYVRMETFHDAKMAPGQRQFWYPWPYVEGLTIAEAGHDLAFLVTGAYGKPLGK
FT                   VFGAPLRLAVPWKYGFKSIKSITRISLVAERPKTFWEQLQASEYGFWANVNPAVAHPRW
FT                   SQASEEVIGTGERRPTLLFNGYGEQVASLYAGLQKEVLYR"
FT   gene            188182..189057
FT                   /locus_tag="Bind_0158"
FT   CDS_pept        188182..189057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0158"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: mex:Mext_2545 methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: purine phosphorylase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93816"
FT                   /db_xref="GOA:B2IBU4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU4"
FT                   /protein_id="ACB93816.1"
FT                   /translation="MSKAVVGIIGGSGVYDLPGLKDLREERVKTPWGEPSDALRFGRIG
FT                   DTEAVFLPRHGRGHVYSPSGINYRANIDAMKRVGVTDIVSVSACGSFKQELYPGLFVLV
FT                   DQFVDRTQGRESSFFGNGCVVHVSMAHPVAPLLQKRIAAAATAEEIPFVSGGTYVCMEG
FT                   PQFSSGAESLGYKSQNFDVIGMTAMPEAKLAREAEISYATIAMVTDFDCWHPDHDHVDV
FT                   ASVIKVVQANAANAARLLARLLADFPDQHEPCPIGSDRALDNAFLTAPDARDPDLLQKL
FT                   DAIMQRINAK"
FT   gene            189054..189593
FT                   /locus_tag="Bind_0159"
FT   CDS_pept        189054..189593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0159"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: bja:blr2490 adenine phosphoribosyltransferase;
FT                   TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93817"
FT                   /db_xref="GOA:B2IBU5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IBU5"
FT                   /protein_id="ACB93817.1"
FT                   /translation="MNKPIDLKSAIRTISNYPKPGIEFRDITTLLGDARAFRRAVDELV
FT                   QPWAGTKVDKIAGMEARGFILGGAVAHQLSAGFVPIRKKGKLPHTTVSIAYSLEYGLDE
FT                   MEIHADAVVKGEKVILVDDLIATGGTATGAVGLLQKLGAEVIAACFVIDLPDLGGAKKI
FT                   EALGVPVRSLISFEGH"
FT   gene            189641..190315
FT                   /locus_tag="Bind_0160"
FT   CDS_pept        189641..190315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0160"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: mex:Mext_2149 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93818"
FT                   /db_xref="GOA:B2IBU6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU6"
FT                   /protein_id="ACB93818.1"
FT                   /translation="MDMRPVFLFDLDGTLVDSVYQHVLAWQEALDIEGIPLSVWRIHRK
FT                   IGMSGGLFTHQLLRETKVEISPERIDRLRRLHAEAYRHHAAKIKPLPGARELLDTLTRE
FT                   QIPWAIATSGRMETAAKNLEALGVDPSKSPVVTRDDVKYAKPDPDLFLAAAARLDTPTT
FT                   ASIVVGDSIWDILAARRCQALGVGVLSGGYGADELERAGAYRVYEDPADILLHLDELGG
FT                   RR"
FT   gene            190404..191636
FT                   /locus_tag="Bind_0161"
FT   CDS_pept        190404..191636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0161"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rpd:RPD_3627
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93819"
FT                   /db_xref="GOA:B2IBU7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU7"
FT                   /protein_id="ACB93819.1"
FT                   /translation="MKFSFLHAADLHLGSPLIGLAAKDEDIARQFAAASRQAFSDLVAY
FT                   AIEQHIAFVVIAGDIYDGEWKDSSIGLFFNRELSRLHRAGIEVVILKGNHDAASVVTKT
FT                   ITLPESVYVFPTNKASTFRLDDYRVALHGRSFPNREVNENYVEAYPEPVAGWFNIGVLH
FT                   TSCDGRPPHARYAPCSLDDMRRHGYDYWALGHVHAHEILCDEPKIVFAGNLQGRSIREC
FT                   GPKGAVRVDVEDQAIKTVTHIPFDQARFGKLTLDLGSVEEEADLLRLVETNLAPFVNEA
FT                   GKRLLALRVECIGETSLHRALKADAQRLSDEVQAAAHRVSENVWLEKLAIATREPASMT
FT                   GMTAPSDLDLAGLFAACEKDPVLREDVEQLIKDVSRKLPRGCSDQGETLMAEIDALIED
FT                   ARASTLGRVLR"
FT   gene            191659..195204
FT                   /locus_tag="Bind_0162"
FT   CDS_pept        191659..195204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_3628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93820"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU8"
FT                   /protein_id="ACB93820.1"
FT                   /translation="MRLLSLSLERFGPFTDRLLTFREGAKLHLVHGPNEAGKSSSLAAI
FT                   GDLLFGIPRKTRFAFVHQERDLRLGATLLSREGLRFDFRRKPGGKGALIGADGNTLPDD
FT                   ALAPWLGGLSREVFGHAFGLDAESLRANAEMLLDAEGDMGASLLAAASGLRGLVTLRQT
FT                   LDDEADQIYGERKAQHRLFYQALARYEEASEAIRKDELKADDWKTLNAEIERLGADRHS
FT                   LKEQRVDLAREQARLERLKRIAPLFDAIDGRMRQIEALGDLPEVPPGFARHIEDELNAA
FT                   EAARKRLADLLGEKQRAEHELASIAIDIHLLDQAETISELFARTQAYAASRKDLPRVVS
FT                   ERDEKEAALRQCGASLGLTEGILREDQQPSSAAIARVTHLIRKGRAAANEVESLRHNLR
FT                   KEEDRQRDLLREKERLGVLSDPAPLLEQMARLGAFETEIAKYTDLRQKIRAETQALDEA
FT                   AARLQPRVTRLDDVVSRPLPSNATIQRFQTDFATLETEIRREEEKRGEALERAANAREE
FT                   LARLAGEGPVPSREAILAARGAREALWDKLRQDLLNPGTELQAARVETIAAFDRCRLEA
FT                   DDLADRAAGEAQRIAAHLRFTQSLKDEERKADEAVHKLADQRARQQSLAETWGEAWAGS
FT                   GLTPLMPAEMQAFAMQLNELLRRREGLLREHAAWTESEARLAVARPGLAALAKILNLEV
FT                   LSLETVEAEDLANLYGRIGRLVQARKDAWDGARDLAARERQFAESITDLRNAVLESERD
FT                   HAVFATKWSEAVSAIGLRREALIEEAEAALDVWRQAPALFEARNNRARRVEGMQRDQKL
FT                   FESETVPLLADVAPDLAALPHDHAIKTLHTRLVAMQKDQSRREECCKTLQRFEVEMSSA
FT                   EKTLEQAEARLADHAASIGAARDDLAGLWPRLAERESFQKEIEARKQQIHDLADGYAEA
FT                   DLRDELAASDRDRLDADLQALREEGERLVQKSNEIYASQERHLERRQKLEGGDGVQAEI
FT                   ALQRRRNAEAEMLAAARDYVVKKIGGKLIERAITRAREERQSPLLRRASEIFAHLTGGD
FT                   WAAIEQEFDADDKPHLVGRKSRETIRREDTKEESAGKAVPVIGMSEGTRDQLYLALRLA
FT                   YLTDYAERAEAAPFIGDDLFASFDDVRTGHGLRALAAIGDLVQPILFTHHHHVVEIAKA
FT                   ALGDAVDVIELYQRS"
FT   gene            complement(195469..195696)
FT                   /locus_tag="Bind_0163"
FT   CDS_pept        complement(195469..195696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93821"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBU9"
FT                   /protein_id="ACB93821.1"
FT                   /translation="MIRLIAVASFALFAATSVQAMTPAPTPHPDAMITQVRLGCGPGST
FT                   LVNGVCVARSTIRQTRRCVRWSGGACALYQ"
FT   sig_peptide     complement(195634..195696)
FT                   /locus_tag="Bind_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(195851..197071)
FT                   /locus_tag="Bind_0164"
FT   CDS_pept        complement(195851..197071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0164"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pnu:Pnuc_1086 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93822"
FT                   /db_xref="GOA:B2IBV0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV0"
FT                   /protein_id="ACB93822.1"
FT                   /translation="MRSRSEFDLSRRQWLSATAFALLSACSKVGRGIAVPPSERRDAIV
FT                   LGLPNARFFLDEPGALSAEQELALVREANSLGVSQGGILPTGHYLALSGGGDNGAFGAG
FT                   LLVGWTEHGDRPKFKLVTGVSTGALTAPFAFLGPEYDAVLTDVYTNISPSKVFVERFAP
FT                   FAALWQDAMADTSPLFETIAHYFDEAVLAKIAAEYEKGRLLLIQTANLDAGVPVLWNIG
FT                   AIAASGHSDALKLIRRLLLASASIPGEFPPVLIDVEANGRSYQEMHVDGGAVSQSFLIP
FT                   PTLVVRIAQEKTGFRRQRMVAYVIRNSRLTTDWSDVQRATLSIAGKAIMIMINYVGLGD
FT                   LYRIYLTCMRAGADFNVAYIGDDFQAEHKVLFDQGYMRALYNFAYEKAARGYRWEYAPP
FT                   GFQAETR"
FT   gene            197343..197555
FT                   /pseudo
FT                   /locus_tag="Bind_0165"
FT   gene            197691..198161
FT                   /locus_tag="Bind_0166"
FT   CDS_pept        197691..198161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0166"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: mex:Mext_4481 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93823"
FT                   /db_xref="GOA:B2IBV1"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV1"
FT                   /protein_id="ACB93823.1"
FT                   /translation="MSSQIAVLFVCTGNICRSPLAEAAFREEIMRLGVLAQVDSAGIGA
FT                   WHIGDPPDRRAQAVARRHGIEIGDYRARQVEKTDFEHFTHVIALDNSHLRALRRLSPEG
FT                   SRAQTSLLLDHVPGRAGQDVEDPYYGSDAGFDQTWRDVVEGAAGLARGLWRR"
FT   gene            198162..198980
FT                   /locus_tag="Bind_0167"
FT   CDS_pept        198162..198980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0167"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase;
FT                   fructosamine kinase; KEGG: mex:Mext_4482 aminoglycoside
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93824"
FT                   /db_xref="GOA:B2IBV2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV2"
FT                   /protein_id="ACB93824.1"
FT                   /translation="MNPLAAIAARLLGVEVRAVEPVSGGDLSQVLRLILADGHAILVKN
FT                   GPAPQVEARMLRTIADAGVPAPKVLAVNETALVLEELPQEGRLSDSSKDLWADLGTVLA
FT                   RLHTAQDDLYGWESDYAFGLLPIVNERQKDWPAFWAEHRLLPFLPHIHSTLGQRLESLA
FT                   RDLPNRLPKNPPPVLLHGDLWSGNILVAQGKITGLIDPACYYGHAEVDLGMLTLFDRPD
FT                   AAFYQNYFVLEQGHEERIALYRLWPALVHLYLFGGSYIRLVDDLLKRLGL"
FT   gene            complement(199001..199711)
FT                   /locus_tag="Bind_0168"
FT   CDS_pept        complement(199001..199711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0168"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="KEGG: mex:Mext_2003 cob(II)yrinic acid a,c-diamide
FT                   reductase; TIGRFAM: cob(II)yrinic acid a,c-diamide
FT                   reductase; PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93825"
FT                   /db_xref="GOA:B2IBV3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV3"
FT                   /protein_id="ACB93825.1"
FT                   /translation="MKNPVMSTTTLTAKTADFMEPGRTQQPPVFDDAFFTRLMDLFRWR
FT                   RDVRRFLPDPVAPALIEELVAMATLAPSVGNSQPWRFVSVESRERRQQVIDDFNACNAE
FT                   ALNTYEGERAARYARLKLSGLKEAPVHLAVFCDMDTLAGDRLGRLTMPETLSYSVVAAI
FT                   QIIWLAARARGLGLGWVSILHPGVLKKTLDVPSDWQFIAYLCIGYPQEEHEDPELVRQQ
FT                   WQARLKEPSQILRR"
FT   gene            complement(199723..200727)
FT                   /locus_tag="Bind_0169"
FT   CDS_pept        complement(199723..200727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0169"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mex:Mext_2486 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93826"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV4"
FT                   /protein_id="ACB93826.1"
FT                   /translation="MIFYEDMTSGKVIESGTREVTKEEIIDFAKVYDPQPFHLDEEAAK
FT                   SSLLGGLAASGWQTASLTQRLVHDVFIGKAASLGSPGIEELKWLKPVRPGDRLNARIHI
FT                   RDKRISKSRPEMGLVNLFVEVGNASGELVMTQQNVLLMGRRDMPQKPVERSLPSGAGNS
FT                   AATKFPDRPLKPWPPSQYLEDLRIGEEITLGTELFTAESIISFASAYDPQPFHLDEEAA
FT                   RQSHFGRLAASGWQTGAIWMKHYMIHRDAFFKEFADQGGLLPELGPSPGFVDLKWPHPV
FT                   YAGDRITYTGTVESVRPTSRPGWGLVTSINKAVNQDGRLVFSFKPVIFWQTRP"
FT   gene            complement(200897..201994)
FT                   /locus_tag="Bind_0170"
FT   CDS_pept        complement(200897..201994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0170"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: xau:Xaut_2605 GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93827"
FT                   /db_xref="GOA:B2IBV5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV5"
FT                   /protein_id="ACB93827.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTQTAAAQAANYPFCTIEPNVGDV
FT                   AVPDDRLTTLAAIAHSKDIIPTRLTFVDIAGLVRGASKGEGLGNQFLGNIRECDAIAHV
FT                   VRCFEDSDITHVAGKIAPIDDIETIETELMLADLESLEKRVGNIEKKAKGGDKEAKEIL
FT                   ELVNRCLVLLREGKPARLAEVRPEERKLFASLGLLSAKPVLYVCNVEEASADKGNSFSA
FT                   AVAARAAEEGAVAVVVSAKIESEIAILPPEDQKDYLEAVGLEEPGLNRVIRAGYGLLGL
FT                   ITYFTVGPKEARAWTIPAGTKGPQAAGVIHTDFEKGFIRAETIAYPDYVTHQGETGARE
FT                   AGKFRLEGKDYVVADGDILHFRFAT"
FT   gene            202299..203282
FT                   /locus_tag="Bind_0171"
FT   CDS_pept        202299..203282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0171"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="KEGG: ppg:PputGB1_1966 aliphatic sulfonates family
FT                   ABC transporter, periplsmic ligand-binding protein;
FT                   TIGRFAM: aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein; PFAM: Substrate-binding
FT                   region of ABC-type glycine betaine transport system; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93828"
FT                   /db_xref="GOA:B2IBV6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV6"
FT                   /protein_id="ACB93828.1"
FT                   /translation="MAGHDFWTTGRRKACFLLLSVLLGLAFPAEWAGAEEGVLRIGYQR
FT                   SSTLMALLKASGRLDQALVAKGVSLRWLEFTSGLPMLEALNLGNVDVTADVADTVPIFA
FT                   QAAGAKLTYIAEEAVSPEAQAVLVPAHSPIKTLADLKGKKIAVTKAAGSHYLLIKALAS
FT                   AGLDFKAIQPVYLTPADGRAALASDKVDALVTWEPFVSSVARQTSARILADGTGLANYK
FT                   RYYLTTPNYAEHHAPVLDALFAQLEETGRETKAHPQAAADILAKLWGIDAETVEQANSK
FT                   RSYRVGVVTRDGLGEQQRIADAFFEAGLLPKRIDTQDVSIFTPQAP"
FT   sig_peptide     202299..202397
FT                   /locus_tag="Bind_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.750 at
FT                   residue 33"
FT   gene            203510..205195
FT                   /locus_tag="Bind_0172"
FT   CDS_pept        203510..205195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_3817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93829"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="InterPro:IPR019060"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV7"
FT                   /protein_id="ACB93829.1"
FT                   /translation="MNKPTPSEAKTLPLYEETISVGKRRVRTGTIHVRTVTDTIRDHVD
FT                   IELSEDRIDVKRVPVDRVVDHVPEVRIEGDLMIVPVLKEVFFVEKRLVLAEEIHLRRWI
FT                   VSKHVKIPVERRSQRALVQTPFPEAASDTGGEDDSTINGRPSMTEINESVHYRLITAFY
FT                   DNEAAAQAAVDKLLAIGIPNDDIHFIHGRAMHAAIVEENKGFWEIIKYLFLPEEDRHIY
FT                   AEGLKRGGYLVSVRADDATYGKAFDILDSEGTLNLTEQEALWRAEGWTGYEGALEQPVV
FT                   EQPALEQPALEQSVVEQPIVAGEAEAAASVVSTSAVSVTPLAQTVSEPASLQTGTPLQT
FT                   GAPLMEQPAESKAFENEEMVIPIAEELLHIGKREIDNGRVRVHSYTVTKPASASIKLRE
FT                   ENITIERHPVDRPITATDNAFAERTIELDQHAEVPVVEKDVHVSEEIRLAKDVREHQET
FT                   VSDSVRETKVDIEDTRRSRLAASTGLVGSDMVSYADKIHDHMNVMASDGQLIGVVDHLE
FT                   GDRIMLTSSDSPDHLEHFIPLAWVKTIGADVELDKPANMVKASW"
FT   gene            complement(205282..206178)
FT                   /locus_tag="Bind_0173"
FT   CDS_pept        complement(205282..206178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0173"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: oan:Oant_1403 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93830"
FT                   /db_xref="GOA:B2IBV8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV8"
FT                   /protein_id="ACB93830.1"
FT                   /translation="MDRGFDWNDLRFFLAVARAGTVSLAARRLGVDHATVIRRIDGLEH
FT                   ALGAKIFERNPRGYNVTQKGEKLLASAQMIESEAQKAEQELAGSHQTVSGLVRISSLEG
FT                   FGNFFLASRLPRFTANHPNITLELLNIQQIVALSRREADLAITLQPPETGRFVRERLTD
FT                   YMLFVYGSRAYLDNAKPIRTREDFIDHPFSGYIDDLVFTRGLDYLHEVKPGLRARIQSS
FT                   SLHAQMEAACAGFGLCILPAFIAAHRPELVPVLPQEVALKRSYWLVADADAAMSSRIRA
FT                   VRHFIFAEVAEAQALFV"
FT   gene            206349..207512
FT                   /locus_tag="Bind_0174"
FT   CDS_pept        206349..207512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0174"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   sal:Sala_0308 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93831"
FT                   /db_xref="GOA:B2IBV9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBV9"
FT                   /protein_id="ACB93831.1"
FT                   /translation="MTSTIALPRLLRIGAGASRELASVLQSLGLSRPFIVTDAYLQESG
FT                   RADGLVQGLEASGLTAAVFSHTVPDPTVRSVDAALEAFRQGDHDCIIGFGGGSPIDTAK
FT                   AVAVLAVHGGPMSQYKAPHAQDLPGVPIIAIPTTAGTGSEVTRFTIITDESNDEKMLCA
FT                   GLAYLPVAALVDYELTLTKPKRLTADTGIDALTHAIEAYVSKKANPFSSTFALAAMRAI
FT                   APNLRRVFANPDDRPAREAMMLGATQAGIAFSNSSVALVHGMSRPIGAHFHVPHGLSNA
FT                   MLLPAITAFSAPVALPLYADCARAMGVAREEEGDQASVARLIDELRQLNADLQVPGPRA
FT                   YGIEETRWNSLLPLMAEQALASGSPGNNPIVPTSDQIQTLYRQAWAA"
FT   gene            207527..209056
FT                   /locus_tag="Bind_0175"
FT   CDS_pept        207527..209056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0175"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: xau:Xaut_3248
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93832"
FT                   /db_xref="GOA:B2IBW0"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW0"
FT                   /protein_id="ACB93832.1"
FT                   /translation="MTLPVTPAQTTIEPIPHVINGQLTEGQSGRFGEVFNPALGSVVRR
FT                   VPLATREEVGQAVEAAATAFPAWAATPPHVRARVLFRFRDLVEQQADRLAALITSEHGK
FT                   VFSDAKGELTRGLEVVEFACGIPQLLKGEFSEQVGRGIDAVSMRQPLGVVAGITPFNFP
FT                   AMVPMWMFPVALACGNTFVLKPSERDPSLGVALAQLLREAGLPDGVFNVIHGDKEAVDA
FT                   LLEHEKVEAISFVGSTPIAEYIYQQGTARGKRVQALGGAKNHMIVMPDADLDQAVDALM
FT                   GAAFGSAGERCMAISVVVPVGEKTAEALIERLVPRIQALKVAPGTDPSAEMGPLVTRQH
FT                   LDKVTAYIETGLAEGAKLRVDGRGLAVEGHAEGFFLGGSLFDHVTSSMRIYKEEIFGPV
FT                   LCMVRAKSFEEGLGLINDHAFGNGTALFTRDGDAAQSFLSRVRAGMVGVNVPIPVPMAF
FT                   HSFGGWKRSLFGDHHMHGPEGVRFYTRLKTATVRWPTGIRAGAEFTMPTLG"
FT   gene            209216..210619
FT                   /locus_tag="Bind_0176"
FT   CDS_pept        209216..210619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0176"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: scl:sce2728 permease
FT                   of the major facilitator superfamily,putative sugar
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93833"
FT                   /db_xref="GOA:B2IBW1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW1"
FT                   /protein_id="ACB93833.1"
FT                   /translation="MTTQRADSDVENGAGLKFLVFASSLGTMIEWYDFFLYGSLAVFFS
FT                   ELFYPKDNPVAALLISVATFATGFAVRPLGAVLFGHLGDRIGRKTTFLITLLLMGGATA
FT                   LIGILPTYASVGLLAPVLLVVLRLIQGLALGGEYGGAATYVAEHAPDGRRGGWTSAIQT
FT                   MASMGFFVSLAVVLSCRFLLGDAIFASWGWRIPFLLSAVLVMLSLGARLRLAESPIFLQ
FT                   LKAEDRVSKSPVRESFADPRNRRLMLAVLFGVASGQAVTFYTANFYALYFLQSILKVDF
FT                   LTSNLVMVLGVLIGMPLFVLFGIWSDKIGRKPLIIAGMAAAVVLLVPIFMVMQSAVGPQ
FT                   GINIWLLAACVFVLVAIAAAVYGPYAAYLVEVFPPQIRYTSLSIPYHIGNGIFGGFLPL
FT                   IGLSLVAATGNPLAGLIYPIAVCVINVIIGSLYLPETLHTPIDGRTSVEDLADESLPFA
FT                   AALPPKSAA"
FT   gene            complement(210690..212168)
FT                   /locus_tag="Bind_0177"
FT   CDS_pept        complement(210690..212168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0177"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bch:Bcen2424_2586 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93834"
FT                   /db_xref="GOA:B2IBW2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW2"
FT                   /protein_id="ACB93834.1"
FT                   /translation="MNFIGIDLGTSSVKTLVIDENENVTADLSEDVVWSSPHPNWSEAD
FT                   PESWWDAVARTLDRLAGENPGLLKEIRGIGLSGQMHGAVLLDGAHKPLRPAILWNDGRS
FT                   HREAAELASLPSPLLEQLGVMPMPGLTGPKLLWLHRHEPETLAATRSLLLPKDYIRLKL
FT                   CGELATDVSDAAGTWMFDQAGRCWSEAAIKICGADPAWLPKIYESNEATGILRKEWVSR
FT                   WGLPNDVVIAAGGGDAAMGGVGIGAISNGDAFISLGTSAQLFVAADQHRPSIHNLVHAF
FT                   CHAVPQGWYQMAAMLSGASPLAAAARWLEADIPLLLQEAEQSFRGPSKLIALPYLEGER
FT                   TPHNDPFARGVIFGLDNSATRADITQAVLEGVAFMLVDALDTLKAAGASIETAAFIGGG
FT                   ARSSFWAKLIASATGLRLQKFVVAERGPAFGAARLARLAVTGENPRTILLPPKVQSVIE
FT                   PDPALHRAYQSSIDRFRRLYQALKPVFRPASESR"
FT   gene            212571..213314
FT                   /locus_tag="Bind_0178"
FT   CDS_pept        212571..213314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0178"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH00969 probable zinc ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93835"
FT                   /db_xref="GOA:B2IBW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW3"
FT                   /protein_id="ACB93835.1"
FT                   /translation="MNTLNPAITLRNVTVAYDRHPAVHHVSGCFAPGSLTALAGPNGAG
FT                   KSTLLKAIMEELPLAEGSIDRGGLSVRDFGYLPQAAEIDRHFPLSVADTVMLGAWREMG
FT                   AFGGATRACAQRARKALLNVGLEGFEARPIGSLSAGQFQRVLFARLLLQDARVMILDEP
FT                   FTAIDARTTADLLAIIRDWHRDGRTVIAVLHDFDQVRSTFPETLLLAREAVDWGPTEKA
FT                   LSAANLVRARAMAEHWDENAPHCAA"
FT   gene            213323..214195
FT                   /locus_tag="Bind_0179"
FT   CDS_pept        213323..214195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0179"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: rle:RL1048 putative
FT                   transmembrane component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93836"
FT                   /db_xref="GOA:B2IBW4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW4"
FT                   /protein_id="ACB93836.1"
FT                   /translation="MSFFSLFIAPFADYGFMRRALVASVALGLGSGPVGVLLMLRRMSL
FT                   VGDAMSHAVLPGAAIGFLIAGGLSLPAMGLGGLIAGLSVALLSGLVSRTTALREDASFA
FT                   SFYLTSLALGVLIVSLRGSNIDLLHVLFGTILAIDATALYLVGSIASFTLITLAIVYRP
FT                   LVAECFDPGFMRSVSGMGSFYHLLFLFLVVLNLVAGFQALGTLMSVGMMMLPAAVAQLW
FT                   ARSLPAMIAIAASMAAFSGFVGLIISYHLGFASGPTIILTSGFIYGLSLLLGPEGAVRR
FT                   YLPSLHLTG"
FT   gene            214201..215106
FT                   /locus_tag="Bind_0180"
FT   CDS_pept        214201..215106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0180"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ret:RHE_CH00971 probable zinc ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93837"
FT                   /db_xref="GOA:B2IBW5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW5"
FT                   /protein_id="ACB93837.1"
FT                   /translation="MRRHFSRAGLLCALALVSGFAPGVSSAHAKTLRAVASFTILADVV
FT                   KQVGGDQVTVESLVPPNGDPHEFEPSPDNARALKGADITFISGEGLENWFQRLVKASGY
FT                   KGAAIVVSNGIKTFTMEEGGERVTDPHVWNSAANVVTWVDNIEKALIAADPEDTQAFHD
FT                   NANRYRKDLRELDAYAHARIDAVPQEKRKILTSHDAFGYFAKDYGVTFLSPLGFSTETE
FT                   ASAATVAKLIDQIRKEKVKVYFIENSNDPRLVKQIGDATGARPGGTLYVESLSPPDGKA
FT                   PTYLDMFRNNVNEIAGALSQ"
FT   sig_peptide     214201..214290
FT                   /locus_tag="Bind_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.880 at
FT                   residue 30"
FT   gene            complement(215277..216266)
FT                   /locus_tag="Bind_0181"
FT   CDS_pept        complement(215277..216266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gdi:GDI0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93838"
FT                   /db_xref="GOA:B2IBW6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW6"
FT                   /protein_id="ACB93838.1"
FT                   /translation="MNRRHILTAGLSVTGLCAFSAYAAPYYGFQQDHSQWTQRVSRRDQ
FT                   LAVEEHIPLWEGSPPGGGGPAGPEALNYKGTLTNVSVPTISLYRPAVPNGAAILIAAGG
FT                   GYHHIQMGKEAVPAAEWLNSLGITAFILAYRLPEEGWGAGRIAPFQDAQRALRLIRGRS
FT                   SSFGIDPSRLGVLGFSAGAHLLGMRATRPDWSCYPPMDAFDNISDESALNLLIYPIVTL
FT                   EPPYQDTQTCRILLGPDPKRHEASEWSVQTYVRRDDAPFFLVQASDDPISNPAHTAILE
FT                   AACQRKGVAVARHLFPTGGHGFGLGSPGTQTVEWPSMAEHWMRQMKFI"
FT   sig_peptide     complement(216195..216266)
FT                   /locus_tag="Bind_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(216374..216585)
FT                   /pseudo
FT                   /locus_tag="Bind_0182"
FT   gene            complement(216679..217983)
FT                   /locus_tag="Bind_0183"
FT   CDS_pept        complement(216679..217983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0183"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   xau:Xaut_1774 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93839"
FT                   /db_xref="GOA:B2IBW7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW7"
FT                   /protein_id="ACB93839.1"
FT                   /translation="MAHATTTPAVAVPQKLYLHLYAQVLVAIAAGILIGHFYPDLGANL
FT                   KPLGDVFIKLVKMVIAPVIFLTVTTGIASMRDLTKVGRVAGKAMVYFLTFSTFALFIGL
FT                   LVGNILQPGAGLHIDPASLDTRTVNEYAIKAHDQTVIGFLTNIVPTTPISALASGDILQ
FT                   VLFFSVLFGIALASVGQHGDPVIVVLNALSHAMFRLVSILMKAAPIGAFGAMAFTIGKY
FT                   GVGSIANLAMLVATFYLTAILFVTVILGIVAYYNGFSIIALLRYLKEELLLVLGTSSSE
FT                   AALPTLMEKMEYAGCSKSVVGLVIPLGYSFNLDGTNIYMTLAALFIAQATGIHLSLWDQ
FT                   LLLLLVAMLSSKGAAGITGAGFITLAATLSVVPAVPVAGMALILGIDRFMSECRALTNL
FT                   IGNSVATIVVARWEGELDDSRLKQALKGVTDTTII"
FT   gene            218280..220094
FT                   /locus_tag="Bind_0184"
FT   CDS_pept        218280..220094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0184"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: azc:AZC_3013
FT                   two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93840"
FT                   /db_xref="GOA:B2IBW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IBW8"
FT                   /protein_id="ACB93840.1"
FT                   /translation="MGIARWHSMPCRLLLFALAAILILGFDGAARYVAQRSVLSELGAA
FT                   AKIAASLRVAMLRNEIEKQRTLPIVLAQDPDVRATLERGGSVRLAALNAKLEALAAATR
FT                   AGAIYLLDANGIAIAASNYRMPTSFVGTNYAFRPYFKRTLEEGSAEHFAFGTVSHKPGL
FT                   YLTQRLDGPTGPLGMLIVKAEFDAVEAEWRHGTAPTFVSDERGIILVTSEPSWRFRTKT
FT                   PIPVERRAEILANLQFGDAKLDLLPLHTNTGSIGLVEATLPGEYRPRYFVEGGSKVSSI
FT                   DWTLHVLTPTETTMKLTVTAWRSLTLLLVTVALGVVGLWLSRQHRLVEERKQHATARRE
FT                   LENMVEHRTKELRHINERLTAEVEKREHAQIAVHNLQDELVQASKLAVLGQIAASVAHE
FT                   VNQPVAAIRTFAENSQVLLIRGDTGTARINLSTIAGLTERIGTIMDELRAFSRKTTSEK
FT                   EPISLRETIDGALLLVGHRLKQQTINLFVDLADADIVVAAERIRLEQVFVNLLQNAIEA
FT                   VSNQPDGSIQILARPTAENVIVTIADNGPGFPDAVMTALFMPFTTTKPDGVGLGLLISH
FT                   DILNEFNGTLAVENCDGATLTITLPRVN"
FT   sig_peptide     218280..218369
FT                   /locus_tag="Bind_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.327 at
FT                   residue 30"
FT   gene            220094..221434
FT                   /locus_tag="Bind_0185"
FT   CDS_pept        220094..221434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0185"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: azc:AZC_3012 two
FT                   component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93841"
FT                   /db_xref="GOA:B2ICF2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF2"
FT                   /protein_id="ACB93841.1"
FT                   /translation="MDVAFIDDDEILCAANVQALVLAGLDVVTYHSAMAALDELNSEFT
FT                   GVVVSDIRMPGIDGLQFFKYLKKIDPDLPVILITGHGDISMAVDALRDGVYDFISKPYT
FT                   FDRLLGSIRHALESRRLVLENRRLKRQIEASAINLPLLGSSPAMERLRQTLHQLADADV
FT                   DVLIEGETGTGKEVVANTLHQWSHRSNRPFVALNCGALPESVIESELFGHEAGAFTGAV
FT                   KKRVGRIEHAHGGTLFLDEIESMPPVLQVKLLRVLETREIAPLGTNNIRHVDIRVVAAS
FT                   KTDLRTLVERNSFREDLYYRLHVAYIHIPPLRERKADVSLLFGYFLANAAKRFRRSPVA
FT                   ITEMVRHHLNSYDWPGNVRELVHYAERVALGLVEEQKQVSAEPEATLRERMDAFEADQI
FT                   RAALAANSGDIQETVKSLGIARKTLYDKLHRYSIDQTIFRGTHTKSL"
FT   gene            221573..222784
FT                   /locus_tag="Bind_0186"
FT   CDS_pept        221573..222784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0186"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bbt:BBta_5036 putative metallo-hydrolase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93842"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF3"
FT                   /protein_id="ACB93842.1"
FT                   /translation="MTLPMASKNRFSRNQSDGTRRSSFSCDNPDRREIVCGCGVASFSV
FT                   LLAGLLGDASPAKAQTLALPVPELDALSIRIVTDSYQFAVAPSRKMDTLSIEHFGWGIS
FT                   PDYPPGPTLASEFGLSMVVTSSRKGETRKTLIDFGFTAMALNNNLQLLGIQPAEIDALV
FT                   LSHGHYDHFGGLAGFLRQYKDQLKPKLPFYVGGEDCFCAREWTAPPVKGNFGVIDREAL
FT                   AAAKLSVTAMEQPALVADHGFISGQIGQRSFEKLLSPSAMHVGVTEGSGCYPDRLPESE
FT                   RGPGSIPDQFRHEIATSFHVKGRGLVILTSCSHRGVVNAVRQAQTVSGIEKVHAIIGGF
FT                   HLAPYPADYVRQTVAALKEIGPDYIVPLHCSGEPFYEMAKAEMPDKLVRAYTGTQLVFS
FT                   GSAS"
FT   gene            complement(222814..223422)
FT                   /locus_tag="Bind_0187"
FT   CDS_pept        complement(222814..223422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0187"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mlo:mlr5353
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93843"
FT                   /db_xref="GOA:B2ICF4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF4"
FT                   /protein_id="ACB93843.1"
FT                   /translation="MVIHSVPMLKVSNREKILNEGLRVVHERGFAGASVRDIVQAAGVP
FT                   QGSFSNHFASKEAFGLEILERYLARVHASIAATLLNESFAPIERLRAYLNDVEESLQRN
FT                   DMRNGCLFGNFSAESSDNTESIRCRLKEIFTEVQTALATCLRAAVAAGQAPADLDCEEM
FT                   AGFVFSSLQGAILVSKAERSPLPFQRFKNVILTRILRPA"
FT   gene            complement(223491..223739)
FT                   /locus_tag="Bind_0188"
FT   CDS_pept        complement(223491..223739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93844"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF5"
FT                   /protein_id="ACB93844.1"
FT                   /translation="MIQILKPIALSAVLLLPLSGVVLAEPHQSRPELAAGLLEGRSIGT
FT                   GRHTVSDWSHAVLYKPFGQTPYDDNNRYRAFSDQTGR"
FT   sig_peptide     complement(223665..223739)
FT                   /locus_tag="Bind_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            complement(223785..223946)
FT                   /locus_tag="Bind_0189"
FT   CDS_pept        complement(223785..223946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93845"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF6"
FT                   /protein_id="ACB93845.1"
FT                   /translation="MTKTLKTIALSATLILTLSEAVLAAQTISNGSQNQAPYNYNNRYG
FT                   SFGDQINR"
FT   sig_peptide     complement(223872..223946)
FT                   /locus_tag="Bind_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(224108..224269)
FT                   /locus_tag="Bind_0190"
FT   CDS_pept        complement(224108..224269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93846"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF7"
FT                   /protein_id="ACB93846.1"
FT                   /translation="MTKTLKTIALSAALVLTLSEAVLAAQPVSNGSQNQAPYNYNNRYG
FT                   TFGDQTNR"
FT   sig_peptide     complement(224195..224269)
FT                   /locus_tag="Bind_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            224578..226485
FT                   /locus_tag="Bind_0191"
FT   CDS_pept        224578..226485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0191"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: CBS domain containing protein; Chloride
FT                   channel core; KEGG: bcs:BCAN_A0498 chloride channel protein
FT                   ClcB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93847"
FT                   /db_xref="GOA:B2ICF8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF8"
FT                   /protein_id="ACB93847.1"
FT                   /translation="MWFALVLPPEVLPPLMPAPAPIFSEKVLRIDVPAILRGIVRRHEL
FT                   GLILLGLITGQIAGIFVAGIFFLAGQMHKLLFGIALESHLSSLSVLSHPLQALVPVVGG
FT                   LVVGVTGHFIQTWRNDRPIDPIEANALRGGTMSLLDSLLITGQTILSNGSGASVGLEAS
FT                   YTQLGSGFASWLGQAFRLRRADLRTLVACGSAGAIAAAFEAPLTGSFYAFELILGSYTP
FT                   FGLAPIGAAAVGGALTARALGTGGDFIGHIPAVALSNSDMALLLLLGMICGLFGIGVMR
FT                   AVTTAEALFRNSRIPIILRPAVGGVVLGAFALITPHVLASGHGALSDLFDEEAPAIGFL
FT                   FGVLLLKATASAISIGSGFRGGLFFASLYLGGILGRIFVGVTAWANPTLAPDAWLATIV
FT                   GMAAMAVAIIGGPMTMTFLALETTGDLPLSIEMLAVAAIVSVMVRRMFGYSFATWRLHL
FT                   RGESIRSAQDIGWMRDLTVGKLMRSDTAIVRSDLPLARFKREFPLGSAQWVIAADTQGH
FT                   YAGMVAVTDAWLTEFQNNPVQEDFGREKGGKSDTGAPKDATITPLLRQKMCVLLPEMNV
FT                   KMAAQMFERSESEALAVVADVKDWRIIGLLTESQVLRRYTQELDKARRDLSGETWSGEG
FT                   "
FT   gene            226502..227305
FT                   /locus_tag="Bind_0192"
FT   CDS_pept        226502..227305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_0538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93848"
FT                   /db_xref="GOA:B2ICF9"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICF9"
FT                   /protein_id="ACB93848.1"
FT                   /translation="MGSLGSLLVIGIVISLSICVTLLVHHHIEIGLRRRYHDVGATMFL
FT                   QLGVIFAVLLAFVFSEVWSEYNEAAHALWAESDALRSMGVLAVTLPREEAGTILKAQRN
FT                   YVESVIETEWPRLAGHRRGDKATAEKLDTLTQQIAAMRLSEPDLNDTKRRVAALLAQAQ
FT                   IERDKRIFEASYGVPLPLWVLLIIFSGLLSLFASFSQIEDRLMAVAMSACFTFGVASIL
FT                   VLVRLLDYPFEGALSLPPDEFRPVLERLTTLLKSIEVTPQQGADQ"
FT   gene            complement(227299..228882)
FT                   /locus_tag="Bind_0193"
FT   CDS_pept        complement(227299..228882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0193"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   bxe:Bxe_B2121 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93849"
FT                   /db_xref="GOA:B2ICG0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG0"
FT                   /protein_id="ACB93849.1"
FT                   /translation="MRRSDLARPFPIRLATRSRMVSGLFAALLLTGCAPSAIDLAPPAP
FT                   DQPYVPQTKETGAIDAGKPAQEPVKQNFTLPANAEAGGLPAPPELAASKIYSLAELIDI
FT                   AQRNNPTTKVAWNAAREAALAVGIVESTYLPRLSVSAIGGTQQSNSTLTTGVLNVGISN
FT                   TNKAHSQGVIGAAGLQWLLFDFGRRAALVEATQQLSTASNITFTGAHQLLIHKVSLAFY
FT                   AYSAARTLTANAAQSLQNAKEVQDAAEAKLKQEVGTIVDVAQAKQATLQTNLLLVRAKG
FT                   LEQDAYLALLGAMGISPLTKIRVASAEGRTLSASMMQPTEAIIETALAQRPDVLAAFAA
FT                   QKASEANVRAAQADFLPKVFASGTVAQDNGGLGVTAIPGVGSDSLPTLNLNGSRFSGIV
FT                   LGGVTLPLYDGGTRAALLLQAREREAAAGSILSRTKQEAAREIVAAENGLKTSLAAYTA
FT                   ANALVQAAQTTFDAALAAYRNGVGSVTATSLAETNLLQARIGRTDAYSAALTAAATLAL
FT                   ASGSLGSVPY"
FT   sig_peptide     complement(228769..228882)
FT                   /locus_tag="Bind_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.678 at
FT                   residue 38"
FT   gene            complement(228869..230851)
FT                   /locus_tag="Bind_0194"
FT   CDS_pept        complement(228869..230851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0194"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: bxe:Bxe_B2120 conserved hypothetical membrane
FT                   protein, putative efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93850"
FT                   /db_xref="GOA:B2ICG1"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG1"
FT                   /protein_id="ACB93850.1"
FT                   /translation="MAAPSLASLLTPFPGRLAFAARLALTCALTVLIAETYETLEIALS
FT                   AYIVFFLTKEDRVSSIIMHISGLILITLIIGLIFLLAILVIDQPVWRVTTMALISFLVL
FT                   FLGSASKLRAIAPILALVVAYALDLLGLIPQGELATRALLHAWLLIGVPVFAGLIVNLG
FT                   LGTPPRLLAERTFVARLRAVAAVLRGTGSTAQERLESLLHDGNAALAKYLNFARIEHTS
FT                   TAKDLAALQAAAASSFRLMALTDSLAALPSPPSSPEDRDKLAATAEAMAAIFETGRYPI
FT                   DIEASLPSDAAPVLADMDGTLQHFTLAPPEAKAQKPKPKQKSGFFLPDAFSNPAHVRHA
FT                   LKTTAAAMICYIFYLQIDWSGIHTCLITCYIVSLGSAAETARKMMLRFIGAVIGAAPGM
FT                   LMLVFVMPHLESIGALMILVFLGAFVAAWVAAGGERIAYAGFQIAFAFFLSAIQGYGPG
FT                   FDLTVARDRVIGIFVGNLVMYVMATQVWPVSVSQRIGETIKASLRGLRDMAKSASQPEW
FT                   NTGALAARNALTTLEDEIELVAFEPSALRPREDWIAARAQVSTELETTFRLLAPLTPAD
FT                   GPASLADCAAQFDQLVGPASAEEDRVAASVEASPGTSAAPTGTIVTDAARTALRQQIDR
FT                   LTRALNTASDIPATGTIQQASHATV"
FT   sig_peptide     complement(230789..230851)
FT                   /locus_tag="Bind_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.870 at
FT                   residue 21"
FT   gene            complement(230868..231956)
FT                   /locus_tag="Bind_0195"
FT   CDS_pept        complement(230868..231956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0195"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B2119 predicted membrane fusion protein of efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93851"
FT                   /db_xref="GOA:B2ICG2"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG2"
FT                   /protein_id="ACB93851.1"
FT                   /translation="MKAAGAPKRGLLIRIIVLAVIGYGLFLAWQAYRQDRDFPYSDDAS
FT                   LDAEVVHVAASVGGRLLNLPVHENQAVRAGDLLFELDPVPYRLAVEQAKADLDLAKAAL
FT                   ATRRRVITTETAAANIAKEQTTRAKTNYELAVRTAERLAPLAAKNFVPKQQYDNAEVVR
FT                   RDAATSLSQAQRQEAAAIAAIGDTSGEEAAIRAREAALAIAERALENTIMRAPHAGRIA
FT                   GLKVTTGEFIAPAQSLFTLITTDEWFLIANFRESQLPVIKVGDCVTGYSMIDRTKPLHG
FT                   RVQGIGWGVLEASGPILPRQLPFVQRSLNWVRVAQRFPVRVHLEEPPEELMRIGASASA
FT                   QIRYGAACQGQENEGNDAAAHS"
FT   gene            complement(231953..232276)
FT                   /locus_tag="Bind_0196"
FT   CDS_pept        complement(231953..232276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0196"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93852"
FT                   /db_xref="GOA:B2ICG3"
FT                   /db_xref="InterPro:IPR031381"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG3"
FT                   /protein_id="ACB93852.1"
FT                   /translation="MRAAVPLLQRGEKAPVSSLLKHTGVLSISVILSGCSLDGAAAFEI
FT                   AGAYFPGWMFCATLGIFGGCFLRLLFIRLGLDERIPWKLFFYTASSLILTLLSWRHWFG
FT                   PAA"
FT   gene            complement(232382..233179)
FT                   /locus_tag="Bind_0197"
FT   CDS_pept        complement(232382..233179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0197"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: swi:Swit_2867 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93853"
FT                   /db_xref="GOA:B2ICG4"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG4"
FT                   /protein_id="ACB93853.1"
FT                   /translation="MNKPACQPTFFIPHGGGPCFFMDDPAGTWTQMAAFLRGLPKTLPE
FT                   PPRAILVISGHWETQGFATTDSAKPDLLFDYYNFPPHTYELRYPAPGAPALAEKVADLL
FT                   KQQGYQTTLDKTRGLDHGVFIPLKVAFPEADIPVVELSLDKGLDPALHLAVGHALAPLR
FT                   DEGVLILGAGMSFHNMRGYGDPKFTQPSQAFDQWLLETVTAPADRRAEQLTHWAEAPAA
FT                   RLSHPREEHLLPLMVVAGASDKPGTRVYSETVMETALSGFRFD"
FT   gene            complement(233198..234406)
FT                   /locus_tag="Bind_0198"
FT   CDS_pept        complement(233198..234406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93854"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017996"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG5"
FT                   /protein_id="ACB93854.1"
FT                   /translation="MTSRRELLSATQSVTLMTIAAKSHPMSSRNARPSAHSSMLRVLIL
FT                   LLSAPQVCAVAAPAAKEAAPILEVAATSPTHAWNGVAVANDGRIFASFPRWDKTTPSVA
FT                   VIGPDGAQTPYPGDGWNEWKPGEDPARHFISINSLFIDRDANHLWVVDPATPHFGGIVQ
FT                   GGPKLVEIDLATDKVVNVYSFDLANAPANSHLNDARVLGDHVFITDSGTGALLVLDRTT
FT                   GHIRRLLAKSRLTKADPSIIPHVDGHQLAGPTGKIPQLNADQIELSADRKTLFFMSPFG
FT                   PNLYRVALADLLDESLSDSDLEQRVKVARHVTPVGGLVIDRNNVLYLSEVETHSIRAEA
FT                   PDGHTLWTIKDRRLDWPDAYSIGPDGTFYIVAAQVDQLPGFNQGHDGRKPPYYMFRFKP
FT                   KAP"
FT   sig_peptide     complement(234236..234406)
FT                   /locus_tag="Bind_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.375 at
FT                   residue 57"
FT   gene            234723..235949
FT                   /locus_tag="Bind_0199"
FT   CDS_pept        234723..235949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0199"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: mex:Mext_0563 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93855"
FT                   /db_xref="GOA:B2ICG6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG6"
FT                   /protein_id="ACB93855.1"
FT                   /translation="MTQALLVVNAGSSSIKFKLYSVNGDDLDLVMGGALDGIGSQPRLK
FT                   VKDHAGTILVEHDYAVAEISTTEQAQTAIADWLTPHIKDYVIIGIGHRVVHGGSVYSRP
FT                   VLVDDQVMATLETFIPLAPLHQLGNLDPIRVLRQRRPDLPQVACFDTAFHFGHPELSDR
FT                   FALPRSLYDEGVRRYGFHGLSYEYVHAALRDIAPDTAHGRVIIAHLGSGASVCCLHEGK
FT                   SIETTMGFTALDGLPMGTRSGTLDPGVVLHLIEQKGMKPAEVGTMLYKQSGLLGLSGIS
FT                   NDVRALLASDRPEAKMAIDFFCLRVAQAMASLSVTIYGLDGLVFTAGIGENAPEVRARV
FT                   IEHLRWSGLALDPAANEAPAPSHQRQGNKGRRIDGKESRVPIFVIPTDEERMIGLHTLR
FT                   LLRQLKHHS"
FT   gene            complement(236097..237086)
FT                   /locus_tag="Bind_0200"
FT   CDS_pept        complement(236097..237086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0200"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   bch:Bcen2424_4872 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93856"
FT                   /db_xref="GOA:B2ICG7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG7"
FT                   /protein_id="ACB93856.1"
FT                   /translation="MTQNESKESVSVNGNTHEKYEALIARCKDLEPVTIAVAHPCDHTS
FT                   LKGAIDAANAGLIHPFLVGPADKIRQVAAEASIDLGPYEIVDTPHSHAAAARAVELIRE
FT                   GTCELLMKGSLHTDELMSEVVSRDKGLRTERRISHVFIMDVPTYPKPLFITDAAVNIAP
FT                   DLETKRDICQNAIDLAHVLGVKQPKVAILSAVETINPKIPSTIEAAALCKMADRGQIKG
FT                   ALLDGPLAFDNAINKEAAETKGINSPVAGDADILIVPDLVSGNILAKQLTFLASADAAG
FT                   IVLGARVPIILTSRADNVRTRLASCAVAALMAAARRSGTKETAGKPTV"
FT   gene            complement(237089..237874)
FT                   /locus_tag="Bind_0201"
FT   CDS_pept        complement(237089..237874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0201"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /note="KEGG: bbr:BB1383 enoyl-(acyl carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93857"
FT                   /db_xref="GOA:B2ICG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG8"
FT                   /protein_id="ACB93857.1"
FT                   /translation="MFDPSIITLNGKKGLVTGIANEHSIAYGCAKAFRFLGADLAITYL
FT                   NDKAKPYVEPLAKELEAALFLPLDVSVEGQLEAVFEAVEKQFGQLDFVLHSMAFAPKED
FT                   LHGRVVDCSREGFLKAMDISCHSFIRMAHLAEPLMPNGGTLFTMTYYGAHKVIENYNIM
FT                   GPVKAALEAVAQYLAAELGHKGIRVHSISPGPVKTRAASGITDFDKLLEEAAERAPAGR
FT                   LVSIDDVGLATAALATDAARLLTGDTLYVDGGLHILGVG"
FT   gene            complement(238077..240443)
FT                   /locus_tag="Bind_0202"
FT   CDS_pept        complement(238077..240443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93858"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICG9"
FT                   /protein_id="ACB93858.1"
FT                   /translation="MTNERQGETPDFFTNPFTAFWPTGAKNGFSIPAFPSELFPSFLSP
FT                   RAVPSPVFALQGKSSPATSWIDAFGLKPYQDYWQDAWQRSILFLDILRQRGDQYLERSQ
FT                   RDVPHVLSFGAELILDGRTFERPVNYGLVRIIPPQGVTVDPTKRPFIIFDPRAGHGPGI
FT                   GGMKHDSEIGEVLKAGHPCYFVGFLPQPVPGQTIEDVCRAEALFVKKVAELHPDSDRKP
FT                   TLIGNCQAGWQIAMMSALNPDLPGPLLLAGAPLSYWAGVHGRNPLRYLGGLLGGTWMTT
FT                   LAGDLGNGIFDGAALVANFERMNPANTYWKKNYNVYSKVDSEAPRFLDFESWWGNPITL
FT                   NAQEMQFIADELFVGNKLTCGEIVTSDNVRVDLRNIKSPIIVFCSWGDDITPPQQALGW
FT                   ITDLYDSRDEIVANGQTIVYTLHDSIGHLGIFVSGKIATREHGEFTQAMDLIDLIPPGL
FT                   YEAVIADVGQETANPELIEGRYLLVLQPRNLDDIRALGGNDLADERRFASLARLSDVNQ
FT                   GLYRTFASPVVRSLVTKESADYLRRLHPNRLRYAFFSDRNPWLRPVKALAEHVRANRHP
FT                   VTKDNPFVLLEQGLSNTIISTLENYGHWRDTLEENFFLTFYGSPTLQALLGLGADPTRP
FT                   PRQLGREVTREAIANAKRAALEFAFDKGSTVEAFVRASIYIHQPIPSIDERVLAALKEV
FT                   RQLLPTDKLTFSRFKDIVKQQHQIVLLDEKRALATLPQLLPASRKERTDLFEAIQRLVL
FT                   AGGQLPEEAQKRLFEIKTLLSGAKDQTEDRISAAE"
FT   gene            241450..242490
FT                   /locus_tag="Bind_0203"
FT   CDS_pept        241450..242490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0203"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   gsu:GSU2813 cytochrome c551 peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93859"
FT                   /db_xref="GOA:B2ICH0"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH0"
FT                   /protein_id="ACB93859.1"
FT                   /translation="MKMRLPMFMSLAALVLSGATTMADPLRDEIKDQFAPIPAKAPGLP
FT                   NNPATPEKLALGKMLYFDPRLSISHSLSCASCHNLGLGGTDDRPKSLGHDWQQGGRNAP
FT                   TVLNSVFNLAQFWDGRAADLAEQAGGPILNPVEMGSTKPQTIDVLKGIPGYVTAFKAAF
FT                   PGTSDSITYENLEKAIAVFEATLLTPEAPFDRWLSGDDKALTQNQKNGLRLFVDKGCSG
FT                   CHNGVNIGGSMYAPFGVVKAPAPDVRPADDLGRAAITKSKDDDYAFKVPTLRNIALTAP
FT                   YFHSGKVWDLKEAVKIMGESQLGVTLSDAETGKIVDFLNSLTGRQPDVSIPVLPALAAT
FT                   TPHPVP"
FT   sig_peptide     241450..241521
FT                   /locus_tag="Bind_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(242617..242988)
FT                   /locus_tag="Bind_0204"
FT   CDS_pept        complement(242617..242988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93860"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH1"
FT                   /protein_id="ACB93860.1"
FT                   /translation="MNRLGVAIPLTDDPFLSPDAPMRKWDVFFLATKITKGLELDFFEN
FT                   PQTEQEPALEPYDRLVFDVVARRSKFEGSVVTAISKDEAIIEAQGVKWRITRPTAEEAV
FT                   HPIQTLMKPRIWIVREEVQ"
FT   gene            complement(243099..243470)
FT                   /locus_tag="Bind_0205"
FT   CDS_pept        complement(243099..243470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93861"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH2"
FT                   /protein_id="ACB93861.1"
FT                   /translation="MPLPVLSSGVFSHVMRTRRTTFRILLFVIGGIALVSALRATADAT
FT                   PGHLLIIPTEDGYGVETCLTSDAACGRVVADAWCQANGHANAEAYGRAGDRIKDLASSR
FT                   DEAQLKSLRPDSLVVSCTD"
FT   sig_peptide     complement(243342..243470)
FT                   /locus_tag="Bind_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.973 at
FT                   residue 43"
FT   gene            243740..244285
FT                   /locus_tag="Bind_0206"
FT   CDS_pept        243740..244285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0206"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /note="TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   rpe:RPE_2812 riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93862"
FT                   /db_xref="GOA:B2ICH3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICH3"
FT                   /protein_id="ACB93862.1"
FT                   /translation="MAEPRRALAQMDDARISVGNARFLIIEAPYYEDIAAQLRAGAEAA
FT                   LTRAQARFDVVSVPGALEIPIALAIALDRAPALYQGAIALGCIIRGETYHFEIVANESA
FT                   RALTQLVVERKLPFGNGILTVETETQALERASVESGDKGGDAARAALALYRFSQEFGQV
FT                   VEQAQIQAQRPVLTSGAR"
FT   gene            244317..244784
FT                   /locus_tag="Bind_0207"
FT   CDS_pept        244317..244784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0207"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: rpa:RPA2729 transcription
FT                   antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93863"
FT                   /db_xref="GOA:B2ICH4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH4"
FT                   /protein_id="ACB93863.1"
FT                   /translation="MANAEQRSAARLAAVQALYQMEVTEKGLNETLAEFESFWIGNEIE
FT                   GDQYKEAEIAFFRDILGGVLADQEPIDRQLDKTLVDGWPLRRVDPVVRAILRAGAYELK
FT                   KRTDIPARVSIKEYVDVAGAFFGREESGMINAVLDELARRYRADEFAASRL"
FT   gene            244798..245793
FT                   /locus_tag="Bind_0208"
FT   CDS_pept        244798..245793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0208"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: mex:Mext_3160 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93864"
FT                   /db_xref="GOA:B2ICH5"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH5"
FT                   /protein_id="ACB93864.1"
FT                   /translation="MPRLSEDELIATYFAPLAGPAGLNLRDDAAVLTPLPGQDLVLTKD
FT                   MLVAGVHFFPDDAPETIARKLLRVNLSDLAAKAALPCGFLLGLALPPDWGTDWLAAFAR
FT                   GLGEDSAQFRFPLLGGDTVKTPGPLTLSLTALGHVPRDTMVPRPGARAGDRLYVTGTIG
FT                   DAALGLRVRLDAPQDRIWIAALTPAARTDLLNRYLVPEPRLGLAPALRRHARAAMDVSD
FT                   GFAGDLAKLLGLAHLTVRVPLAAVPLSRAAREALHLEPGLIDTILTGGDDYEILCAVPP
FT                   GECVGFEESALALGMRVSPIGEAESGDALPHFEAPGTVPRVYPQGSFQHF"
FT   gene            246019..248157
FT                   /locus_tag="Bind_0209"
FT   CDS_pept        246019..248157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0209"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mlo:mlr8418 membrane-bound
FT                   proton-translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93865"
FT                   /db_xref="GOA:B2ICH6"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH6"
FT                   /protein_id="ACB93865.1"
FT                   /translation="MNPLWWIIFGGLLSVAYGIVTSKQLLEQPAGSLRMQEIAGAIAEG
FT                   ANAYLKRQYTTIALVGTVIFVVLGLLLSWTVAWAYLFGAVLSGAAGFIGMNVSVRANVR
FT                   TAQAASQSLGEGLDLSFKAGAVTGLLVAGLALLGVTLTFYLLTGPLGHAQDSREVVNAL
FT                   VGLGFGASLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVG
FT                   DCAGMAADLFETYVVTVVATMVLGAIFFGGDAVLASAMLYPLAICATCIVTSLIGTAFV
FT                   KLGLDEAIMSALYKGLIATGLLTIPGLALATYATVGFGTIGTVHGVPLTGLHLFFCGLI
FT                   GLAVTGALVVITEYYTGSGKRPVVSIAQASVTGHGTNVIQGLAVSLESTALPALVIAAG
FT                   IIATSQLGGLYGTAIAVTTMLGLAGMIVALDAFGPVTDNAGGIAEMAGLPKEVRRATDA
FT                   LDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSYDLDYFTKHGDVFSYFRNVGVVSFDLS
FT                   NPYVVAGLIFGGLIPYLFGGIAMTAVGRAAGSVVEEVRRQFREKPGIMEGTERPDYGRA
FT                   VDMLTKAAIREMIIPSLLPVLAPPFVYFVVLAVSGSKASAFAALGASLLGVIVNGLFVA
FT                   ISMTSGGGAWDNAKKSFEEGFLDKNGVTHYKGSEAHKASVTGDTVGDPYKDTAGPAINP
FT                   AIKITNIVALLLLAILAH"
FT   gene            248333..249238
FT                   /locus_tag="Bind_0210"
FT   CDS_pept        248333..249238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0210"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: nha:Nham_1059
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93866"
FT                   /db_xref="GOA:B2ICH7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH7"
FT                   /protein_id="ACB93866.1"
FT                   /translation="MKGIILAGGSGTRLYPITRVVSKQLLPVFDKPMIYYPLATLMLAG
FT                   IKDFLIISTPRDTPLFERLLGDGKDLGMSLTYAVQDEPRGLAESFIIGRDFIGSDRVAL
FT                   ILGDNIFHGHGLPQMLQQAVARTTDATIFGYQVTTPEQYGVVTLDRTGKALDIVEKPKT
FT                   FHSNVAVTGLYFYPNDVVDIAAKITPSARGELEITDVNRAYLQRGQLFVEMLGRGFAWL
FT                   DTGTHASLVEASHYIQILEQRQGIRVACIEEIALRMGYIPLDQFHELAKRSMKSSYGEY
FT                   LLAIYEAAKKDPTSFAPSIA"
FT   gene            249425..250363
FT                   /locus_tag="Bind_0211"
FT   CDS_pept        249425..250363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0211"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: rru:Rru_A0792 serine O-acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93867"
FT                   /db_xref="GOA:B2ICH8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH8"
FT                   /protein_id="ACB93867.1"
FT                   /translation="MHPCLGQPWRQGFSWGKIMNRQTMNHMTLISDSGVPAGHSDRPGL
FT                   YDPLWNRLRQEAEEAFARERALAPLFVSSILNRTSFESAVAHRIAARLGNETVPAYLIA
FT                   EIFAQATDDDPTIGEAFRADILAVLDRDPACARLIEPFLYFKGFHAIQTHRLAHWLWNH
FT                   QRQDFALYIQSRSSDVFQTDINPAARFGKGIFLDHATGLVVGATASIDDDVSILQNVTL
FT                   GGTGKERGDRHPKIRRGVMIGAGAKILGNIEIGSCSRIAAGSVVLRPVEPNTTVAGVPA
FT                   RQVGTAGCSEPARSMDQILSQLSYDSFDYTI"
FT   gene            250609..250758
FT                   /locus_tag="Bind_0212"
FT   CDS_pept        250609..250758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93868"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICH9"
FT                   /protein_id="ACB93868.1"
FT                   /translation="MGELKSSRKKTKCLLPVHTLAAGRFRDALLVKQDKSGLTSTPILY
FT                   ARSV"
FT   gene            250848..251837
FT                   /locus_tag="Bind_0213"
FT   CDS_pept        250848..251837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0213"
FT                   /product="cysteine synthase"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: atc:AGR_C_543 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93869"
FT                   /db_xref="GOA:B2ICI0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI0"
FT                   /protein_id="ACB93869.1"
FT                   /translation="MAQPAVKQPDAPVQTAGRGRIYDSITETIGNTPLVRLQKIAKEKG
FT                   VKANLLAKLEFFNPIASVKDRIGVHMIASLEAAGKIVPGKTTLIEPTSGNTGIALAFVA
FT                   AARGYKLILVMPESMSLERRKMLALLGAELVLTPAPQGMKGAIAKAEELVQATPDAVIP
FT                   RQFDNPANPEIHRLTTAEEIWNDTEGNVDYFVSGVGTGGTITGVAQVLKPRRPSLKIVA
FT                   VEPEDSPVLSGGQPGPHKIQGIGAGFVPSVLDRPLIDEVVTVGNQTAFETARLVARLEG
FT                   IPVGISSGAAVAAAIEVGLRPEAEGKNIVLIIPSFAERYLSTALFEGL"
FT   gene            252107..252232
FT                   /locus_tag="Bind_0214"
FT   CDS_pept        252107..252232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93870"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI1"
FT                   /protein_id="ACB93870.1"
FT                   /translation="MRAFWLFLAALFGFRLFSNSRYNREFRNLPEEEQKARRRWF"
FT   gene            252475..253476
FT                   /locus_tag="Bind_0215"
FT   CDS_pept        252475..253476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0215"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: nwi:Nwi_0218 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93871"
FT                   /db_xref="GOA:B2ICI2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI2"
FT                   /protein_id="ACB93871.1"
FT                   /translation="MASPTLDLLGFGNAIVDVLGQVDDDFLLAQGLHKGSMTLIDEARA
FT                   TSLYGAMGPVTVVSGGSAANTIIGAAGLGCKTGFVGKLKSDPLGTQFAHDIRGAKVAFT
FT                   TSFAEDGPASATCLVLVTPDGQRTMNTYLGASANLTEADVDAEQVQSAAIIYLEGYLWD
FT                   PPAAKAAFLKASRIARDAGRQVALTLSDTFCVDRYREEFLGLIRDKSVQILFANESELH
FT                   ALYQTSDFDTAIAALRQENILGVVTRSEHGSVVVTSENVLAVPAFPVDQVVDTTGAGDL
FT                   FAGGFLTGLSKNKDHSTAARLGALAAAEIIQHIGARPQKDLAYLARQNGFDL"
FT   gene            complement(253564..254169)
FT                   /locus_tag="Bind_0216"
FT   CDS_pept        complement(253564..254169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0216"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: bja:blr0495 isopropylmalate isomerase small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93872"
FT                   /db_xref="GOA:B2ICI3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI3"
FT                   /protein_id="ACB93872.1"
FT                   /translation="MEKFTTLTGVAAPLKITNVDTDMIIPKQYLKTIKRTGLGEGLFSE
FT                   LRFKDDGTENPDFVLNQPAYRKASILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFA
FT                   DIFYNNCFKNGILPIKVTPEQLALLMEDAERGANATLTVDLENQTIRGPDGGSIPFNID
FT                   PFRKHCLLNGLDDIGLTMQKADEISAYEERQAKQHAWL"
FT   gene            complement(254603..255007)
FT                   /locus_tag="Bind_0217"
FT   CDS_pept        complement(254603..255007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0217"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: bbt:BBta_0409 ATP synthase subunit epsilon,
FT                   membrane-bound, F1 sector"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93873"
FT                   /db_xref="GOA:B2ICI4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI4"
FT                   /protein_id="ACB93873.1"
FT                   /translation="MAAFHFELVSPERLVFSGEADSVVVPGVEGEFTVLAGHAPFMTTL
FT                   RPGLITVNDATSKEKLEFYTLGGFVDVGEGGLTILADVALPIAEADQARFTADLAQAET
FT                   DIHDAPDADFRLVAIERRDQLAYLKTLLRP"
FT   gene            complement(255157..256605)
FT                   /locus_tag="Bind_0218"
FT   CDS_pept        complement(255157..256605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0218"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: azc:AZC_4125 ATP synthase F1 beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93874"
FT                   /db_xref="GOA:B2ICI5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI5"
FT                   /protein_id="ACB93874.1"
FT                   /translation="MADAALNGPTGHITQVIGAVIDVKFDGHLPAILNALETQNNGNRL
FT                   VLEVAQHLGESEVRCIAMDVTDGLIRGQAVIDTGAPISVPVGEECLGRILNVIGEPVDE
FT                   LGPVNTTARRAIHQLAPAYDEQSTEAQILVTGIKVVDLLAPYSKGGKVGLFGGAGVGKT
FT                   VIIMELINNIAKAHGGYSVFAGVGERTREGNDLYHEMIESHVNVDPHEHGGSAKGSKCA
FT                   LVYGQMNEPPGARARVALSGLTIAEDFRDKGQDVLFFVDNIFRFTQAGSEVSALLGRIP
FT                   SAVGYQPTLATDMGALQERITTTTKGSITSVQAIYVPADDLTDPAPAASFAHLDATTVL
FT                   SRSIAEKGIYPAVDPLDSTSRILSPLIVGEEHYNVARQVQQLLQRYKSLQDIIAILGMD
FT                   ELSEEDKLTVARARRIERFLSQPFHVAEIFTGSPGKLVALSDTIKGFKGLIEGKYDHLP
FT                   EAAFYMVGSIEEAVEKAQKLAASV"
FT   gene            complement(256632..257513)
FT                   /locus_tag="Bind_0219"
FT   CDS_pept        complement(256632..257513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0219"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: mlo:mll4063 F0F1 ATP synthase subunit gamma;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93875"
FT                   /db_xref="GOA:B2ICI6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICI6"
FT                   /protein_id="ACB93875.1"
FT                   /translation="MPSLKDLRNRIASVKATQKITKAMQMVASAKLRRAQLAAEAARPY
FT                   AERMDEVLASLASIVGTGPDAPKLLAGNGYDRTHLLVVCTAERGLCGGFNASIARLARD
FT                   TAEKLIAEGKKVKILCVGKKGYDLLKRQFGEQILELIELRSVRTIGFVNAEAIGRKILN
FT                   LYKDAEFDVCTLFFAKFRTVLHQIPTAQQLIPLAVKTQEDAPAAPPSLYEYEPSEEQIL
FT                   ATLLPRNITIQVLRALLENAASEQGARMSAMDNASRNAGEMIKKQTLKYNRSRQAMITK
FT                   ELIEIISGAEAL"
FT   gene            complement(257652..259181)
FT                   /locus_tag="Bind_0220"
FT   CDS_pept        complement(257652..259181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0220"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.4.21.68"
FT                   /note="KEGG: bbt:BBta_0406 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93876"
FT                   /db_xref="GOA:B2ICI7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI7"
FT                   /protein_id="ACB93876.1"
FT                   /translation="MDIRAAEISAILKKEIANFGNEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVEVGEMVDFESGVRGVAINLEADNVGVVIFGSDRTVSEGQTVKRSRTIVQVPVGKELL
FT                   GRVVDALGNPIDGKGPINAAQSARADIKAPGIIPRKSVHEPMSTGIKAIDALIPIGRGQ
FT                   RELIIGDRQTGKTAVALDAMLNQKPANLGTDENAKLYCVYVAIGQKRSTVAQFVKVLEE
FT                   QGALPYSIVVAATASDPAPMQYLAPFAGCAMGEYFRDNGMHALITYDDLSKQAVAYRQM
FT                   SLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDEKGAGSLTALPVIETQANDVSAYIPT
FT                   NVISITDGQIFLETDLFYQGIRPAVNVGISVSRVGSAAQTKSMKKVAGKIKGELAQYRE
FT                   MAAFAQFGSDLDATTQKLLARGSRLTELLKQPQFSPLKIEEQVCVIYAGVNGYLDALPV
FT                   NRIRAYEDGLLALLRTAHADLLDTIRTSKDLSDDSAAKLKALIEGYSKNFS"
FT   gene            complement(259181..259753)
FT                   /locus_tag="Bind_0221"
FT   CDS_pept        complement(259181..259753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0221"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: azc:AZC_4128 H+-transporting two-sector ATPase
FT                   delta (OSCP) subunit; TIGRFAM: ATP synthase F1, delta
FT                   subunit; PFAM: H+transporting two-sector ATPase delta
FT                   (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93877"
FT                   /db_xref="GOA:B2ICI8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICI8"
FT                   /protein_id="ACB93877.1"
FT                   /translation="MGSVAVEETIVTGMAGRYAQALFSLAKESGTIDQVASDLQRLREI
FT                   YRESEDLQRFIGSPAFSSEIQVKVLNALLNKVEITGLAANFIKLVAFKRRLFGLPKMID
FT                   DFNHLRDVEYGIVRATVTSAAPLKDEQLETLKGVLAAQGGGKSVEIAAKVDPALIGGLI
FT                   VQLGSRMVDGSLKTKLNAIRTRMKEVG"
FT   gene            complement(260062..261084)
FT                   /locus_tag="Bind_0222"
FT   CDS_pept        complement(260062..261084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0222"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta; KEGG: rpc:RPC_0286 DNA polymerase
FT                   III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93878"
FT                   /db_xref="GOA:B2ICI9"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICI9"
FT                   /protein_id="ACB93878.1"
FT                   /translation="MVAIKSHEADRFLARPTTHVFLYLVHGTDNGLVAERVKTIVARSV
FT                   DDPKDPFQFLRLDGDDLAADPQRLADEAHTVPLFGGRRAILIGARGKAFIQAVEPILAV
FT                   PPQDCTIIVEAGALKKDNALRKLCERDKNAAAIECYPDSQRDLQALIEAETAATRQTIR
FT                   ADAKEELLSLLGADRLTTRGELDKLLLYTHGEAEITLSHVEAIVADASSLFVDGAINAA
FT                   FAGEATNADRIARRVFEEAGDANMLLGMALRQALSLHRAKLDKDMGLAPRGGAPFAASW
FT                   RMGNAEQHLSRWSVERLSEASTLLGEAVRQARREPKLAEAIALRALWSVAFLARGKTFR
FT                   "
FT   gene            complement(261303..261725)
FT                   /locus_tag="Bind_0223"
FT   CDS_pept        complement(261303..261725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll6206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93879"
FT                   /db_xref="GOA:B2ICJ0"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ0"
FT                   /protein_id="ACB93879.1"
FT                   /translation="MTFLPFGKSASGKNVFRILLLACALTALSRPSVAASLLERYDANG
FT                   NGVLDAEEAKDAAEDSFDDIDKDDTDTLDREEIGFRLTDAEFAAADLDHDGVLSEYEYI
FT                   ALVKNRFEKADKDHDGSLSQAELATRAGQAFLRVLQ"
FT   sig_peptide     complement(261621..261725)
FT                   /locus_tag="Bind_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 35"
FT   gene            complement(262172..262711)
FT                   /locus_tag="Bind_0224"
FT   CDS_pept        complement(262172..262711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93880"
FT                   /db_xref="GOA:B2ICJ1"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ1"
FT                   /protein_id="ACB93880.1"
FT                   /translation="MWLREKIRRCASRLPRQALIAGFGSLLLAGCLQPVYGPLSAGGSV
FT                   ESELQAIQIDPISDRLGHYLGNELIFNLNGTGSHVPPKYRLKVVVFESVQTPLIDTVSG
FT                   RASAATVVVNAIYILTPVGGDVPITKGTATVTASYDRNSQRFANLRAARDAEIRDAKAL
FT                   ADQIRLRLATAFAAKG"
FT   gene            complement(262698..265379)
FT                   /locus_tag="Bind_0225"
FT   CDS_pept        complement(262698..265379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0225"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: rpd:RPD_0436
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93881"
FT                   /db_xref="GOA:B2ICJ2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ2"
FT                   /protein_id="ACB93881.1"
FT                   /translation="MLFTGTSRFIFKRLILGMDSERYNAREAEPKWQKIWEEAALFQTA
FT                   NADTRPKYYVLEMFPYPSGRIHMGHVRNYTMGDVIARYKRAKGFGVLHPMGWDAFGMPA
FT                   ENAAMQNKSHPAEWTYANIATMRAQLKSMGLSLDWSREIATCDVAYYKHEQRLFLDLLD
FT                   MGLAYRKQSKVNWDPVDCTVLANEQVIDGRGWRSGALVEQRELTQWFLKIGDFAEDLLL
FT                   ALETLTRWPEKVRLMQANWIGRSEGLLLRFALAPNAAIEACEIEVYTTRPDTLFGAKFI
FT                   AIAADHPLATACAASDPTLPAFISECRRMGTSVAALETAEKKGYDTGLKVRHPFDENWL
FT                   LPVYVANFVLMDYGTGAVFGCPAHDQRDLDFANAYGLGNQPVVCPPDVNPDEFVITDTA
FT                   FDGEGVLVNSRFLDGMTIEEAKAEVTRRLEAATLGNAPQAKKRVNFRLRDWGISRQRYW
FT                   GCPIPIIHCEACGIVPVPRADLPVTLPKDVSFDEPGNPLDRHPTWKQVNCPQCGRPARR
FT                   ETDTMDTFVDSSWYFARFTDPWNEADPTTPEAISHWLPVDQYIGGIEHAILHLLYARFF
FT                   TRAMQVTSHMGDVKEPFSGLFTQGMVVHETYRAKDGAWLFPSQLRFETQGNERRAFRLD
FT                   TGEEALIGPIEKMSKSKRNTVDPDEIISTYGADTARWFVLTGSPPERDVIWTEEGVQGA
FT                   SKFVQRLWRLIGELAEAAGPEPVPQPALFGEAAAAIRKAAHGALIKVENDIERLHFNTA
FT                   IASVHDLANKLSAAIGAIESEVIGDDLRFACREAASIIVRLFAPMMPHLAEECWTRLGY
FT                   ATMVAQSFWPEADPSLVVEDEISLPVQVNGRKRADLTIAREASEAEIQAAAVALEAVQK
FT                   ALEGKPVKKIIVVPRRIVNVVA"
FT   gene            265435..266127
FT                   /locus_tag="Bind_0226"
FT   CDS_pept        265435..266127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0226"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bbt:BBta_0174 putative exported protein of unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93882"
FT                   /db_xref="GOA:B2ICJ3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ3"
FT                   /protein_id="ACB93882.1"
FT                   /translation="MHSPQAPEPLPDNVLERLAVIRGHIARAARDAGRAPSSVNLVCVS
FT                   KTFPAEAIEPVLSAGERIFGENRVQEAMDKWPALRPAYPGVELHLIGPLQSNKAREAVG
FT                   FFDCIETVDREKIARAIAEEIQKSGKHPRLYIQVNTGAEPQKAGVLPQEADSFIEQCQK
FT                   EFGLVISGLMCIPPVDDQASPHFALLNKIAERHGLTNLSMGMSADYELAIQLGATHVRI
FT                   GSALFGAR"
FT   gene            266331..267443
FT                   /locus_tag="Bind_0227"
FT   CDS_pept        266331..267443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93883"
FT                   /db_xref="GOA:B2ICJ4"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ4"
FT                   /protein_id="ACB93883.1"
FT                   /translation="MRWEAPDSFRASRTLARTRRLACVLALFSSPFTAWPALAESASVA
FT                   ATLNRLSINLPADVAANEILRKPLDELSREPCDRQAIVALANALQKVGYRREAANAHAH
FT                   FSESCGGYAQSLQAAVNILLGLSDFKGAAELATNLIKMEPFSHNGYFLRALARDGAGEY
FT                   KGALDDYISTLELVPNKEQVVSTPYFKMAKVYDALGQPCDAAQAVQSWVEMNAPRRETP
FT                   QTQMMIATYTAKGQCKANMKTGVEVFPNSAGKGVVKLTVLVNGVPGQFILDTGASFVSL
FT                   KDSFARKANIDIDEGSAVRLHTANGMTDGKRGQAKTIKLRSLEAKNTIVVVQSDNAGAY
FT                   GANVDGLLGLSFLSRFHVAIDPRTITISTR"
FT   sig_peptide     266331..266450
FT                   /locus_tag="Bind_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.943 at
FT                   residue 40"
FT   gene            complement(267464..268141)
FT                   /locus_tag="Bind_0228"
FT   CDS_pept        complement(267464..268141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93884"
FT                   /db_xref="GOA:B2ICJ5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ5"
FT                   /protein_id="ACB93884.1"
FT                   /translation="MAGMRQIKGSIVSRETSAKRLSSRALCNVKMPQRAPRRTVKPAGN
FT                   ALLRHFRVGRPAAGSNPSRGKILAGALVLPCALGKTGIKARKREGDHASPLGTYRLLGG
FT                   FFRADRMPRPRSLVPLRVLRPDMGWCDDTRSFLYNRPMRLPAKVKSKLSHEVLWREDHL
FT                   YDLMIILDHNQCPRVRGHGSAIFLHCARPDFVPTEGCIALPLPVLRKLLPRLSRGCTLR
FT                   IGR"
FT   gene            268501..269187
FT                   /locus_tag="Bind_0229"
FT   CDS_pept        268501..269187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0229"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: azc:AZC_0090 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93885"
FT                   /db_xref="GOA:B2ICJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ6"
FT                   /protein_id="ACB93885.1"
FT                   /translation="MSQVLKILIVDDDSDLRSALSEQFALHEEFTILPAETAQAALAVI
FT                   HQETPDLILMDVGLPDMDGRDAVKQMREEGFKNPVIMLTGHDSEGDTVQGLDAGANDYV
FT                   TKPFRFAVLLARIRAHLRQHESSDEAMFRIGHYTFQPGAKHLINEKGSKLRLTEKETAI
FT                   LRFLYRAGQTVVTRDVLLREVWGYNANVTTHTLETHIYRLRQKIEEDPAKAQLLITETG
FT                   GYKLVP"
FT   gene            269476..269928
FT                   /locus_tag="Bind_0230"
FT   CDS_pept        269476..269928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0230"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mex:Mext_1575
FT                   cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93886"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ7"
FT                   /protein_id="ACB93886.1"
FT                   /translation="MGLDETIDDLSLNPAFAGFDRAALRKLAQCAEARLFLPREILFRQ
FT                   GDPSHGSFLITTGSLQLSRGVGDAAMHAHVGRGTLVGTKALLMPIPRPVTATARETTSA
FT                   LFISRHVFQTILQNFPSGAAAMQEVLIQALRDMMQDFRMTTFRDAA"
FT   gene            269918..270163
FT                   /locus_tag="Bind_0231"
FT   CDS_pept        269918..270163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93887"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ8"
FT                   /protein_id="ACB93887.1"
FT                   /translation="MLRDSEHWIRKGDTFGLNLAPLSWLMRSVMDMTDGPFSNFVISLK
FT                   KGTFKKHEKSLFAILGLMPMVMMNDRWTALEFSLSL"
FT   gene            270471..271742
FT                   /locus_tag="Bind_0232"
FT   CDS_pept        270471..271742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93888"
FT                   /db_xref="GOA:B2ICJ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICJ9"
FT                   /protein_id="ACB93888.1"
FT                   /translation="MGNKLTMRIGQALTSFLTLPLFLLVLLVARLLLLALLFWVTGGKE
FT                   LGNDVAMHMTMMRSPFCILTYQYPGYEQYPPFLPFLELFPAYLLQFFLPDFLSFRLTMV
FT                   VYEILVGFLFYRLMMRLEFSPGRFGLCLLGFLALPMGWMTSIVMAQDVVIVTAFLLLAI
FT                   LLFISGRHRLALFSCGLGVICGKLFIILEIFTLLAFCSRKRIIAYGAIGLSPVILVYGL
FT                   MSIHRIMHGLPLPLVSFRPDPYFGTNFWILLKTYRHLSFQDYGPFSGMLALSASLIPAL
FT                   IIFIKGFGPTDSMRVITASSATILIFFSLFYHVNPEYFMMVFPLMLIVGRNTIDAVYSV
FT                   LISAVPWAGKFFQNAQFQMGVEVNEGKAVAMKYYMAVFHSSPEYWLAGTQIVFSILTIT
FT                   LSIRLCLQLFEPKQSQPQTLIQSA"
FT   sig_peptide     270471..270578
FT                   /locus_tag="Bind_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.510 at
FT                   residue 36"
FT   gene            complement(271858..272667)
FT                   /locus_tag="Bind_0233"
FT   CDS_pept        complement(271858..272667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0233"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: nwi:Nwi_2038 TonB like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93889"
FT                   /db_xref="GOA:B2ICK0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK0"
FT                   /protein_id="ACB93889.1"
FT                   /translation="MSFISDRPFLPPEEEGLDTKKWVLAGTLVLLAHAGLVFWLTRPHE
FT                   DDLAAGQLEPAVMIDLGPEAMAPPVDTPAEVAPQQMTEADPEENKEKPDPDPVPDQPVP
FT                   PPELPPLPETPVVPKAEVVMPAKPVVKKPPPKKKDVKKEHAPKTTAPVQTNARASNAAA
FT                   SAATGAGGSSAAANDWKSRVFSQLARNKRYPDSERQNGVQGVVGLAFTIDRSGNVLSAH
FT                   VSRSSGSSALDNAAVEMVHRASPLPAPPDDIGGSRITLSAPVRFSVH"
FT   gene            complement(272702..273235)
FT                   /locus_tag="Bind_0234"
FT   CDS_pept        complement(272702..273235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0234"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="TIGRFAM: TonB system transport protein ExbD; PFAM:
FT                   Biopolymer transport protein ExbD/TolR; KEGG: bme:BMEI0364
FT                   biopolymer transport ExbD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93890"
FT                   /db_xref="GOA:B2ICK1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK1"
FT                   /protein_id="ACB93890.1"
FT                   /translation="MGAKLSTGDSDDLEENHEINVTPFIDVILVLLIIFMVAAPLSTVD
FT                   VKVDLPASSAQPAPRPDKPVFVTLKPDQSIYVGDAQVARDRLGAMLDQTTQSDHEQRVF
FT                   VRADKTVPYGDLMEMMNLLRKAGYLKIGLVGLETVPSASAASVPGTSVQGTSTSGTGAA
FT                   PGSSGAPSSVKSPL"
FT   gene            complement(273238..274305)
FT                   /locus_tag="Bind_0235"
FT   CDS_pept        complement(273238..274305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0235"
FT                   /product="tonB-system energizer ExbB"
FT                   /note="TIGRFAM: tonB-system energizer ExbB; PFAM:
FT                   MotA/TolQ/ExbB proton channel; KEGG: xau:Xaut_4273
FT                   TonB-system energizer ExbB type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93891"
FT                   /db_xref="GOA:B2ICK2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK2"
FT                   /protein_id="ACB93891.1"
FT                   /translation="MTDCRHVLNLQERLPQRPARTRRERRTTLLPLVCLTQFALVSAPV
FT                   LILGPSLALAQTASQQPSASSPSPLAPSSQTASSQATPAAEPAAPAATAASEAPAVEPG
FT                   SVAAAVDPSNIPHDLSPWGMFTHADIIVQGVMLGLLFASLVTWTIGIAKCLELMAGDRN
FT                   ARRGLNILSGAQSLRLADSALEGTLGRGKGVVAKLVSAAIAEAERSQGLPADGVKERAA
FT                   ALLSRIEIRASRAMTRGTGLLATIGATGPFVGLFGTVWGIMNSFIGISKSNTTNLAVVA
FT                   PGIAEALLATACGLVAAIPAVIIYNVFSRAIAGYKGILGDASTEVLRHLSRDLDRAALK
FT                   DQKDWRVTNLRQPAE"
FT   sig_peptide     complement(274138..274305)
FT                   /locus_tag="Bind_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.813 at
FT                   residue 56"
FT   gene            complement(274471..275151)
FT                   /locus_tag="Bind_0236"
FT   CDS_pept        complement(274471..275151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0236"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: azc:AZC_3753 2OG-Fe(II)
FT                   oxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93892"
FT                   /db_xref="GOA:B2ICK3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICK3"
FT                   /protein_id="ACB93892.1"
FT                   /translation="MIVHIPAVLNAEQIARCRAVMQTGDWIDGRVTAGHQSRLVKNNLQ
FT                   LPESSPEHQELGEMIVRALWHNPLFISAVLPHTIFPPLFNRYDVGMGFGTHVDTAVRRN
FT                   LDGSLRIRTDVSATLFLAGPEDYDGGELTIEDTYGTHSVRLPAGDLIIYPADSLHFVSP
FT                   VTRGSRIASFFWIQSLIRDKTQRNLLFNLDTAIMRLTEDVAGNPALVSLQGVYHNLLRQ
FT                   WAEI"
FT   gene            complement(275239..276546)
FT                   /locus_tag="Bind_0237"
FT   CDS_pept        complement(275239..276546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0237"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: nha:Nham_0971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93893"
FT                   /db_xref="GOA:B2ICK4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK4"
FT                   /protein_id="ACB93893.1"
FT                   /translation="MVMRRDHVGAMAFSHSSRPSLAEASPIKKRPGTWRPLWRKIHLYL
FT                   GFGSGLVLLVLALSGITLIFSDDLDRLLHPDFYATTGAEAALTPDVYLAAATAVVPEGA
FT                   ATQLRWPRTTGAPVTVLVRAEPKHRATDQGADHTATKKDMDAAPSGERRNEARQFLVFL
FT                   DPPTARVLGTVNYRERFAAIVLSLHRSLLVPQWFGADIVGFSGIGLAILCVTGLVLWWP
FT                   RGPFLKGLYFHRGRYLRTNLHYTTGFWVLAPLTIMVVTGLTLSYPRQARGLVNVFAELS
FT                   PRPPERPGRDALLLAPHLDPAEILDRALAQIRQEAPETLLRPVSLTWPSMSGKVWRVQL
FT                   DLGQEESTLLIDDATGEVARAPETLSGEALLLFLRRLHGATHHGLVWEGLALLAGLGIP
FT                   LLLVTGILMWLRRRPHAVENLPATAVCLPESEQSAA"
FT   sig_peptide     complement(276478..276546)
FT                   /locus_tag="Bind_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.732 at
FT                   residue 23"
FT   gene            276861..279194
FT                   /locus_tag="Bind_0238"
FT   CDS_pept        276861..279194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0238"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: rpe:RPE_4578 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93894"
FT                   /db_xref="GOA:B2ICK5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK5"
FT                   /protein_id="ACB93894.1"
FT                   /translation="MKRDEFEIFEGSAANTPATELYIKAKARPPLKNAVVGLASLMLGG
FT                   GAATAQESTNLALEQIEVEAGNASNNGSAYNPRSTGLDRLPEPILDTAQSINVIPQQLL
FT                   RDQQTTTMVEALRNVPGISINSAEGGTQGDNINIRGFSARNDIYRDGIREPAWYSRDSF
FT                   SVENIDVYKGPSSFIFGRGSTGGVINVVSKLPVFTNFTDFSLSGNTAPGVRSTIDVNRT
FT                   FGDIAARIIILGTDWDTAGRNFIGTKRVGAAPSIAFRFTEQTKLTLSYIYQHDDNVPDY
FT                   GIPIVPGSIFGTSYGKPAPVSRGTYYGQQTPGFNDTEKVDAHIVTAKLEHEFNKDWMLT
FT                   NGTRFSNVDRFLRARAPQWVASTSAIYAQPVGGTALTSLAGVPIGSLYSIDNNHFQNHT
FT                   INSMISNLTNVVGHEETWGLKHTIQMGLDLSKEDRYNARQATNNTTAATTNQRINLLYP
FT                   DPYPFGNNFGPNTTLTRTEARDIGMYVSDQVKFNDYFELKGGFRYDFYKAWQFTANSSR
FT                   ADGSLSQNGTTPFNLSSTNNFASWNGSALFHPAPNATLYYSFGTSVNPLAEYTTITNGG
FT                   QNLGATTNESHEVGAKIDLFDSRLSLTGAAFMITQNNAVETIDATTSPPTVALVGKTRV
FT                   KGIEVGATGEVTPGWNVFAGYTYLDGRLLQSQQYANFVGNVVQNVPRNQASFSTTYQVT
FT                   PDWKIGTSVYFVDSRWTNVQHAGWVPSYWRWDLMTSYQVTENFSLQANLFNVLNTTNYE
FT                   SIAGAGFAVPGVGRSLQLTARLHW"
FT   gene            complement(279202..279582)
FT                   /locus_tag="Bind_0239"
FT   CDS_pept        complement(279202..279582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93895"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK6"
FT                   /protein_id="ACB93895.1"
FT                   /translation="MSRDTCSHAALQRICLHSLKQIKGFEHVTEILVQWREPVGRDPCG
FT                   RENLGQNPSSRDEAEYEANWTLAAVRPRVDNQVLRSARAMIEWLQQTYRLDGPPDSLRE
FT                   KTRRQRHSTAFPRDVLDKDFPG"
FT   gene            complement(279751..280092)
FT                   /locus_tag="Bind_0240"
FT   CDS_pept        complement(279751..280092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0240"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bra:BRADO1086
FT                   conserved hypothetical protein, hypothetical UPF0337
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93896"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK7"
FT                   /protein_id="ACB93896.1"
FT                   /translation="MNLHEIEGAARGFTGKAETKFGEITGDRDAEAQGLIDQASGKVQD
FT                   LYGRIKESVQDASAQVPDSVSETVEKGQEIYKHGVEQLGKRVGTQPFEALLLAGALGYL
FT                   LGWAMHRRA"
FT   gene            complement(280246..281238)
FT                   /locus_tag="Bind_0241"
FT   CDS_pept        complement(280246..281238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0241"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: mex:Mext_2554
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93897"
FT                   /db_xref="GOA:B2ICK8"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK8"
FT                   /protein_id="ACB93897.1"
FT                   /translation="MLTSQLPRIDAAGEDELNLSPLSPYHRFTREQWARLRADTPLTLT
FT                   LDDLARLRSIDDPISLEEVIAIYLPLSRLLALYVAATQGLFKATQRFLGAGDGKVPYII
FT                   GVAGSVAAGKSTLSRVMQALLLRWPNTPKVQLITTDGFLYPNHILQREDLMDKKGFPES
FT                   YDGTALLCFLSDIKAGKRNVRAPVYSHISYDIMPGESVTVDRPDILIVEGLNVLLPNRP
FT                   NKDGMAIPFVSDFFDFSIYLHADEDDLERWYVARFMRLRETAFRDPRSYFKKYADIDDS
FT                   AAEAAARDIWRRINLANLRENLFPTRARANLILTKGPSHHIETVELRKL"
FT   gene            complement(281228..281548)
FT                   /locus_tag="Bind_0242"
FT   CDS_pept        complement(281228..281548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0242"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   bra:BRADO0217 phosphoribosyl-ATP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93898"
FT                   /db_xref="GOA:B2ICK9"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICK9"
FT                   /protein_id="ACB93898.1"
FT                   /translation="MKRFTLEDLAAVIADRAKATAESSYTKSLLEGGPPRAAKKLGEEA
FT                   VEVVIAALGTDRAALTAETADLLYHLLVVLHLRDISLQDVLDELGRRTSRSGHEEKASR
FT                   AH"
FT   gene            complement(281553..282383)
FT                   /locus_tag="Bind_0243"
FT   CDS_pept        complement(281553..282383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0243"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: pla:Plav_1233 imidazoleglycerol phosphate synthase,
FT                   cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93899"
FT                   /db_xref="GOA:B2ICL0"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICL0"
FT                   /protein_id="ACB93899.1"
FT                   /translation="MLKARVIPCLDVKDGRVVKGVNFVDLRDAGDPVQCAIAYDAAGAD
FT                   ELCFLDITASHEDRGILLDVVERTAAACFMPLTVGGGVRTEDDIRKLLLAGADKVSIMS
FT                   AAVTDRDFVRRAAEKFGSQCVVVAIDAKEVRPGAWEIFTHGGRKPTGIDAITYARDVAE
FT                   RGAGEILLTSMDRDGTKAGFDLALTRAVSSAVSIPVIASGGVGTLDHLVEGIAQGGAQA
FT                   VLAASIFHFGTFTIAEAKHYMAQHGLPMRLDTGAAMPPGPFPAPSPPVSPAATG"
FT   gene            282840..283886
FT                   /locus_tag="Bind_0244"
FT   CDS_pept        282840..283886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0244"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475; KEGG:
FT                   nar:Saro_2044 protein of unknown function DUF475"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93900"
FT                   /db_xref="GOA:B2ICL1"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL1"
FT                   /protein_id="ACB93900.1"
FT                   /translation="MRYFRGSLLFTILCLFLAGWLGWSLTGTISGVLSTLWIALVLGVL
FT                   EISLSFDNAIVNATVLRGLDPVWRRRFLIWGILIAVVGMRILFPLMIVAIAAHIGPLDA
FT                   LFLAILEPRHYEQIITDVHITISGFGGAFLAMVSLKFFFDSSKRVHWIGLFEKRLARLG
FT                   DLDAITHTIVLLALYAVSRLLAPEDAAELIVAGIFGLVTFVGVEVIGNVLGGPGGRTGE
FT                   VARVGLSGFLYLEVLDASFSFDGVVGAFALTNNLFVIALGLGIGAMFVRSMTVMLVDRG
FT                   TLSEYRYLEHGAFYAILALAGVMLLSARYDIPEVVTGLISACLIGLSLLGSILYNRKRS
FT                   AIEPPPTQ"
FT   sig_peptide     282840..282914
FT                   /locus_tag="Bind_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.322 at
FT                   residue 25"
FT   gene            complement(284018..284440)
FT                   /locus_tag="Bind_0245"
FT   CDS_pept        complement(284018..284440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0245"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   pla:Plav_0634 class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93901"
FT                   /db_xref="GOA:B2ICL2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL2"
FT                   /protein_id="ACB93901.1"
FT                   /translation="MPRLFINPRLSIDEAELLFSFARASGPGGQNVNKVESAVQLRFDV
FT                   YNSPSLDETVKERLSLLSGSRITKDGILVIFAQNFRSQELNRQDAQTRLLDLIGAAGKK
FT                   PKPRIKTRPSLSAKRQRVDSKVRRGETKRLRSGPID"
FT   gene            complement(284477..285205)
FT                   /locus_tag="Bind_0246"
FT   CDS_pept        complement(284477..285205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0246"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: mex:Mext_2551
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93902"
FT                   /db_xref="GOA:B2ICL3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICL3"
FT                   /protein_id="ACB93902.1"
FT                   /translation="MILYPAIDLKEGHCVRLLQGDMQKATIFNDDPAAQAAAFEAQGFT
FT                   ALHVVDLDGAFAGKPMNAAAVDAILARVKMSVQLGGGIRDEATIEAWLGKGIARVIIGT
FT                   AAVRDPDLVRRAAARFPGKIAVGIDAKDGFVAVEGWAKTAQLSAVELGKKFEDAGVAAL
FT                   IYTDIARDGGLTGLNIDATLALAKAVHIPVIASGGLASLADIERLTAPDCAILAGAISG
FT                   RALYDGRIDPAKALALLRKD"
FT   gene            complement(285202..285882)
FT                   /locus_tag="Bind_0247"
FT   CDS_pept        complement(285202..285882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0247"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: azc:AZC_4500 imidazole
FT                   glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93903"
FT                   /db_xref="GOA:B2ICL4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL4"
FT                   /protein_id="ACB93903.1"
FT                   /translation="MNEAKTAASRLGVAIVDYGSGNLHSAHKAFERAASETGYAGTIAV
FT                   THDPEAVALADRIVLPGVGAFADCRRGLNAVPGMIEAMEHAVRREGKPFLGICVGMQLL
FT                   ATRGLEHETTAGLDWIKGEVAALEPTDKSLKIPHMGWNTLTALRPHPLLAGIPLGAEGL
FT                   HAYFVHSYAFRPQREADLIATTDYGGPVTAMIGEANIAGTQFHPEKSQTLGLALISNFL
FT                   KWHP"
FT   gene            complement(285879..286442)
FT                   /locus_tag="Bind_0248"
FT   CDS_pept        complement(285879..286442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93904"
FT                   /db_xref="GOA:B2ICL5"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL5"
FT                   /protein_id="ACB93904.1"
FT                   /translation="MALYAIYLPPEAPGATLGMTADKAEARLERAARARFVKQSFSWGA
FT                   FWFGPFWLAARGLWLSLGLWILAMLAVSLLLVLGTFGSVLFSSFAIMLAIFLGLEGFGL
FT                   CERRFRRQGYQLENIVAAPGRDTGESRFFSLFDADLEQLGDDDVPPARPPERPPAARAA
FT                   TTLAHQGETGRDLLGLFPSRGRRQ"
FT   gene            complement(286478..287065)
FT                   /locus_tag="Bind_0249"
FT   CDS_pept        complement(286478..287065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0249"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   bbt:BBta_0148 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93905"
FT                   /db_xref="GOA:B2ICL6"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICL6"
FT                   /protein_id="ACB93905.1"
FT                   /translation="MRTGAVSRKTKETEIEVAVDLDGRGTAHISTGIGFFDHMLEQLAR
FT                   HSLIDMTIKAKGDLHIDDHHTVEDTGIALGQAVRQALGDRAGITRYADVLLPMDETLTR
FT                   VAVDVSGRPYLVFRTHFLRDKIGTFDTELVREFFQAFTTHLGANIHVETLYGENAHHIS
FT                   ESSFKGLARALRVALTLDPRQLGEIPSTKGVL"
FT   gene            287367..287960
FT                   /locus_tag="Bind_0250"
FT   CDS_pept        287367..287960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0250"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   nwi:Nwi_0127 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93906"
FT                   /db_xref="GOA:B2ICL7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL7"
FT                   /protein_id="ACB93906.1"
FT                   /translation="MRDYPSFPAFSQASSPESWHGTTILMVKKGGRTVIGGDGQVTLGQ
FT                   TIVKGNARKVRRLSKGDVIGGFAGATADAFTLFERLEAKLEQYPGQLMRACVELAKDWR
FT                   TDRYLRRLEAMMLVADKQAGLVLTGTGDVLEPEMTEQGSVMGIGSGGNYALAAGRALLA
FT                   TEFDAETITRKSLEIAADICVYTNRNLIIESIDA"
FT   gene            288011..289318
FT                   /locus_tag="Bind_0251"
FT   CDS_pept        288011..289318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0251"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: rpc:RPC_0302 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93907"
FT                   /db_xref="GOA:B2ICL8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICL8"
FT                   /protein_id="ACB93907.1"
FT                   /translation="MTDFSPREIVSELDRYIVGQNDAKRAVAIALRNRWRRLKLEGAMR
FT                   EEVLPKNILMIGPTGCGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVEQIIRDLV
FT                   ETAIVMVKAEKRKSLEAKAHQSVEERLLDALVGANAAQTTRDSFRKKLRDGDLEDKEIE
FT                   IELAQATGNLPMFDLPNMPGAAVGAISIGDIFAKSLGRSTKRRRSTVKEAREPLLAEES
FT                   EKLMDQEQIIAQAIHSVENNGIVFLDEIDKICAREGRGGADVSREGVQRDLLPLIEGTS
FT                   VATKHGTIKTDHILFIASGAFHVAKPSDLLPELQGRLPIRVELLPLNEEDFRRILTETE
FT                   VSLIKQYEALLATEGVNLVFTPEAVSSLAKVAVQVNSSVENIGARRLQTVMERVLDEVS
FT                   YTAPDRSGQTITIDAAYVEKNIGDLAKNTDLSRFIL"
FT   gene            complement(289534..290091)
FT                   /locus_tag="Bind_0252"
FT   CDS_pept        complement(289534..290091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_2857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93908"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICL9"
FT                   /protein_id="ACB93908.1"
FT                   /translation="MLPCFPRSLVLTAAGAVLFCLALPATAAQRGRDDTGGVPVLDVKS
FT                   TCKEAQNYGTEDKRAAYTGCLQDEEQARQQLKAQWKKFKPKDKENCVASSASVMPSYVE
FT                   VLTCLEMSQENNLPEYQPERKWPTYSTVPNPNAPSPTNPAETTPRYHSLDEKAPETGSA
FT                   TKEGQQPSKEETKDQKHEDTAH"
FT   sig_peptide     complement(290008..290091)
FT                   /locus_tag="Bind_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(290386..291324)
FT                   /locus_tag="Bind_0253"
FT   CDS_pept        complement(290386..291324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_2002 hydrogenase
FT                   expression/formation"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93909"
FT                   /db_xref="InterPro:IPR006894"
FT                   /db_xref="InterPro:IPR038527"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM0"
FT                   /protein_id="ACB93909.1"
FT                   /translation="MTQEPHHRKHLASVLPETPMPLPSGRRPRPYRNDARDPLAEFAPT
FT                   TPSPDRELGDSNGKIAYFQGAPNNCSTAGKRLLDRLAIALLEGVDDGNDEEEILFDLTE
FT                   LGTKDIQFIQHLLGEGRITGKIALTDGVVAEVRSTALTRAWEIVFRGPDGVILEHFLQV
FT                   DDLPRILRQAALATPLEFQEPARPDADPAFPLLKMIQFHAWHFEDKRNAVRDPLTLDLL
FT                   KLEDLATAQTLCEILGRGSIDLSIKIADVDNPVSPIVSQRITSTGTRHVWLLESFDAKG
FT                   TLLQQAVSIDDVPLAMMLASPSSALLPNAGP"
FT   gene            complement(291789..292394)
FT                   /locus_tag="Bind_0254"
FT   CDS_pept        complement(291789..292394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0254"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain protein; Zinc finger C4-type, RecR; KEGG:
FT                   oan:Oant_0023 recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93910"
FT                   /db_xref="GOA:B2ICM1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICM1"
FT                   /protein_id="ACB93910.1"
FT                   /translation="MTAPIAGPEIERLIHLLARLPGLGPRSARRAALHLIRKRTELLGP
FT                   LAEALQQAYNHLIPCQICGNIDTRDPCTICADAKRDPTLLVVVETVADLWALERAAALP
FT                   ARYHVLGGTLSPLDGVGPKDLNLQSLTERVAQGEIREVILAVNATVDGQTTAHYITDSL
FT                   AAFPVKITRLAHGVPVGGELDYLDEGTLAAALRSRTNF"
FT   gene            complement(292475..292780)
FT                   /locus_tag="Bind_0255"
FT   CDS_pept        complement(292475..292780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   xau:Xaut_2167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93911"
FT                   /db_xref="GOA:B2ICM2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICM2"
FT                   /protein_id="ACB93911.1"
FT                   /translation="MKDMMGLLKQAQAMQAKVQDMQAALEQITVEGHAGGGLVKITLTV
FT                   KGQIRSVSIDPSLLKPEEKEIVEDLVALAYENARHQAEQIMEEKMREVTGGMQLPF"
FT   gene            complement(293029..294984)
FT                   /locus_tag="Bind_0256"
FT   CDS_pept        complement(293029..294984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0256"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: azc:AZC_0142 ATPase; TIGRFAM: DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93912"
FT                   /db_xref="GOA:B2ICM3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM3"
FT                   /protein_id="ACB93912.1"
FT                   /translation="MPDERIQNDAAPPSPVSPLIPQASTPKPYLVLARKYRPSRFEDLI
FT                   GQEAMVKTLSNAFDLDRIHQAYLLTGVRGVGKTTTARILARAFNYEVPAENGQPAIEKP
FT                   TVHMDRFGVHCQAIIESRHVDIIEMDAASHTGIDDIREIIESARYRPVSARVKVYIIDE
FT                   VHMLSKQAFNGLLKTLEEPPEHVKFIFATTEIDKVPITVRSRCQRFDLRRIEPAVLIDY
FT                   LASVCAKENVLIEREALGLIARAAEGSVRDALSLLDQAIAHGTGQADPHSSAQPISATD
FT                   LQAMLGLADRARIIDLFEAVMRGDMAKALADLKNLHDCGADPAQVLVELAEFVHFVTRL
FT                   KLSPHTFDAAATPEELSRGGAMAGTLSVMVLTRAWQILTKGLQEVKDSPRPLACADMVL
FT                   VRLAYAADLPTPDVVLRQLAKTPPSPHGRDGSTDAVSGSRVQPSLPSASGPSLGSPLVT
FT                   SSRLGAQAATQAASHMAPLAVSAPSLQPGLAQAPAIRLQSFGALVALAGEKRDIQLKTA
FT                   LERDVRLVRFEEGTIEFALAPGASPQLAQTLMRRLQEWTGTRWMVAIASETSGGAAALT
FT                   LKEQAEKQAAAVRQGIEADPLVRKALSQFPGAQIIAVRPNEAPATVPEDQPFAADSAES
FT                   DDDVAFPDQFEMDEDR"
FT   gene            complement(295126..295227)
FT                   /gene="ffs"
FT                   /locus_tag="Bind_R0002"
FT   ncRNA           complement(295126..295227)
FT                   /gene="ffs"
FT                   /locus_tag="Bind_R0002"
FT                   /note="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            295523..296500
FT                   /locus_tag="Bind_0257"
FT   CDS_pept        295523..296500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0257"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: bxe:Bxe_A2188
FT                   putative phosphohydrolase, MutT/NUDIX"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93913"
FT                   /db_xref="GOA:B2ICM4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM4"
FT                   /protein_id="ACB93913.1"
FT                   /translation="MAAIKPYLFAVEPTPSEPSAETGFALNGLDRLSQRREDANFLQAM
FT                   TEAPSTRTLVFSGDIPVLKRCGTVHEATFTLAEAAHLGIAREAAFLGVDAAGEALFALL
FT                   LESVLPEKQQERDDIAMIDLRTIALQGLVAPFMLGRLGEAKSLLYWHSRHRFCANCGTK
FT                   TQVSVSGWRRHCPACEASHFPRTDPVVIMLVQDGAHCLLGRQAAFPPRMVSCLAGFMES
FT                   GETIEDAVRREVFEEVGIGVGKVTYFASQPWPFPASLMIGCLAEARSRDLVLDHEELED
FT                   ARWYSRAEVRQMLEAPLPEGPICPPKLSIANLLLRRWASESLTF"
FT   gene            296560..297285
FT                   /locus_tag="Bind_0258"
FT   CDS_pept        296560..297285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0258"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: azc:AZC_3675 ExsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93914"
FT                   /db_xref="GOA:B2ICM5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM5"
FT                   /protein_id="ACB93914.1"
FT                   /translation="MPEHSSDTGNNKALVLFSGGQDSTTCLAWALDRFAFVETIGFSYG
FT                   QRHVIELTQRQVVRASIARQFPAWAERLGDDHLVTIEALAEISQTALTRDMAIEMDAQG
FT                   LPNTFVPGRNLLFLTFAGALGYRRGLKHIVGGMCETDFSGYPDCRDDTVKAMQVALNLG
FT                   MDRRFVLETPLMWLDKAETWRLAEALGGQALVDLIIEETHTCYLGERGALHAWGHGCGQ
FT                   CPACVLRAKGYAAYRDGVA"
FT   gene            297400..298527
FT                   /locus_tag="Bind_0259"
FT   CDS_pept        297400..298527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0259"
FT                   /product="putative 3-carboxymuconate cyclase"
FT                   /note="KEGG: scl:sce5181 probable 3-carboxymuconate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93915"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM6"
FT                   /protein_id="ACB93915.1"
FT                   /translation="MRSILKITGSSLAALAAIFSLSSAAVAQSLQERAHGTLYTMSNAV
FT                   NGNAILAFRQTETGELSPAGSFPTGGLGTGGGLGNAGGLVLSQDQHWLFAVNAGSNEIS
FT                   VFAIDDEGRLRLASKTASGGGQPVSIAVDDDLVYVLNANSDLINGFRLKRDGRLEQIPG
FT                   SLRALGGTGTNPAEIAFSPDGQSLIISEKATNRLAVFKVDRAGLTDNAPGLVPSAGLTP
FT                   FGFAFSHRKTLLVTEAGGGTNGSTLSSYHLRRDELPVLVDGAVRTTQSAACWVAVTPDG
FT                   RYAYTSNAASQSITGFRVAPSGDLTLLDADGVTASTAGNGNPIDSVISRDGQFLYVLSA
FT                   GKDTIGAFKIGHDGGLTPIAALQGLPASANGLAIR"
FT   sig_peptide     297400..297483
FT                   /locus_tag="Bind_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 28"
FT   gene            complement(298586..300319)
FT                   /locus_tag="Bind_0260"
FT   CDS_pept        complement(298586..300319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0260"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: mag:amb4061 superfamily
FT                   II DNA and RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93916"
FT                   /db_xref="GOA:B2ICM7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICM7"
FT                   /protein_id="ACB93916.1"
FT                   /translation="MTFSTRNPSLARALTERGYDQPTPVQAAVLEWEDSNRDLLVSAQT
FT                   GSGKTIAYGLALGSALLADEKPLPVAPNAPLGLIIAPTRELALQVHRELSWLYAYAGVR
FT                   LVTCVGGMDPRRERRDLDQGAHVVVGTPGRLRDHLERGALNLQNLKAVVLDEADEMLDL
FT                   GFSEDLTTLLDAAAPERRMLLFSATLPRDIVALAQRYQRDAARISVTAPAGGHADIDYR
FT                   LVRVVPDEIPHVVVNLLRQVEAPGAFVFCNTRESSRHLQALLSERGFSAVLLSGELSQN
FT                   ERNRALQALREGRARICVATDVAARGIDLPNLGLVIHADLPNDAATLQHRSGRTGRAGR
FT                   KGLSVLLASPSRRRRAEQLLKTLGLPIVWQAPPSAEEIRKLDQERLLQDPLLMEAAGED
FT                   DQASAAMLLEAYPPQAIAAAFARLLREHRPAPEEVRDPGFGPDSRQGAGARRGQLGDAG
FT                   AIWFKLGIGRKQNADPRWLLPMICRRGKISRSAIGAIKIFERETKFEVAIPVAEQFAAN
FT                   IRIPDPEGVRIERAEAPDAHGMAGHAGETQAHRHGSKPGRMPKPAGKSARSKAQAEEAR
FT                   A"
FT   gene            complement(300468..300698)
FT                   /locus_tag="Bind_0261"
FT   CDS_pept        complement(300468..300698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0261"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG: mex:Mext_2355
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93917"
FT                   /db_xref="GOA:B2ICM8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICM8"
FT                   /protein_id="ACB93917.1"
FT                   /translation="MKADIHPQYHLIKVVMTDGTEFQTRSTYGEEGATLNLDIDPKTHP
FT                   AWTGGTQQLLDRGGRLSRFNSRFGNLSFGKK"
FT   gene            301068..302363
FT                   /locus_tag="Bind_0262"
FT   CDS_pept        301068..302363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0262"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   xau:Xaut_0037 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93918"
FT                   /db_xref="GOA:B2ICM9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ICM9"
FT                   /protein_id="ACB93918.1"
FT                   /translation="MANVVVVGAQWGDEGKGKIVDWLSIEADIVVRFQGGHNAGHTLVI
FT                   GNQVYKLALLPSGIVRLGKLSVIGNGVVVDPQHLVEEIAKLAAQGIEITPDNLKIAENV
FT                   PLILGLHRELDAHRESSTVEGVKIGTTKRGIGPAYEDKVGRRAIRLMDLAEPDTLDEKI
FT                   VRLLAHHEPLRRGLGLEPISAGAIRAELESLAPKILPFMDATWDLLENARRAGKRILFE
FT                   GAQGALLDIDHGTYPFVTSSNTVAANAATGSGLGPKAIGYVLGIAKAYTTRVGGGPFPT
FT                   ELLDETGQLIGDRGHEYGVNTGRRRRCGWFDAVLVRQTVKTCGIDGIALTKLDILDGFK
FT                   EIKVCVGYDLDGRRIDRLPASQSAQARVKPIYETIDGWEGTTAGARSWADLPAQAIKYV
FT                   RRIEELIEAPVALLSTSPERADTILVHDPFRD"
FT   gene            302572..304051
FT                   /pseudo
FT                   /locus_tag="Bind_0263"
FT   gene            complement(304234..304647)
FT                   /locus_tag="Bind_0264"
FT   CDS_pept        complement(304234..304647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0264"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bvi:Bcep1808_5860 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93919"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN0"
FT                   /protein_id="ACB93919.1"
FT                   /translation="MPSTVQKKPRQQTPPSVQLLSCAPHVVLTHLGDKWTILVVLLLAR
FT                   APENRLRFSEIKRGVQGISQRMLTLTLRMLERNGLVLRHYYSEVPPRVEYELSAMGKSM
FT                   LYPLEVFTGWIGENWQAMQQARERYDAREDRTP"
FT   gene            304748..305560
FT                   /locus_tag="Bind_0265"
FT   CDS_pept        304748..305560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0265"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   pst:PSPTO_0819 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93920"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN1"
FT                   /protein_id="ACB93920.1"
FT                   /translation="MMQIGIIGAGYVGEALAARLVETGYKVKVANSRGRDSLAAFARKT
FT                   GAQATDIEDISSGVNILVVAIPMARVAELPKSVIDTLPQGAIVVDAGNYYPLRDGEIAT
FT                   IDQGMPESAWVSQQLGIPVIKVFNNIIASRLATCGKPKGDRHRIALPVAGDDPKARTTI
FT                   MGLVETLGFSAFDAGPISESWRQQPGQPAYCTDPTLAELPLLLKRADRMEAARNRDKAA
FT                   RILPKLPETYSTEQLVRVARFFVGLDRLKPASWIAMLRLGYTLLRSPR"
FT   gene            complement(305606..306484)
FT                   /locus_tag="Bind_0266"
FT   CDS_pept        complement(305606..306484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0266"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: nwi:Nwi_0150 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93921"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN2"
FT                   /protein_id="ACB93921.1"
FT                   /translation="MRPDSSCPLASLAILLVFLTGFLSHATTGMTAEAKPTFLPNFWDP
FT                   RHLPEKPVLSSARTIRFLTEADWPPFHFTLDDGTLVGFDIDLARAICEDLKLACTIQAR
FT                   RFDLLEPALAAKEGDVLLAALRVDRATRPGPQSGIAFTAPYYTTPARFVTRRASPIEAI
FT                   PEKLAGKRIGVEQGTAHEAYLTAFFAQVTRQPFPTLAEAQEALRNGSIDALFGDGITLA
FT                   LWLNGTDSQDCCAFQGGPFTESAYFGEGIGMAMRTDDDDLRKALDYGLARVATRGLYSE
FT                   LYLKYFPLGFY"
FT   sig_peptide     complement(306404..306484)
FT                   /locus_tag="Bind_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.888 at
FT                   residue 27"
FT   gene            306960..308525
FT                   /locus_tag="Bind_0267"
FT   CDS_pept        306960..308525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0267"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: xau:Xaut_2375
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93922"
FT                   /db_xref="GOA:B2ICN3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN3"
FT                   /protein_id="ACB93922.1"
FT                   /translation="MVDLLARTDSRAEPEIEAAPSAPAASSSAEGLSCLPLFFPLAGRT
FT                   VVLAGDGEALVWKAELLYSTGAYLRVFAPQPVPRLAAFLQSEDHEAEKPAPSASSQEQR
FT                   CLWHQRPIRAEDLSGAALVIAACDEDSEAAALLAMARAAGVPINIIDRPERSDFQFGAI
FT                   LDRSPLVIGISTHGAAPALAQALRGRLEAWLPASLQHWAAAARNWRARLKREPVNNPRR
FT                   FWSLFSQAALAADREAPRETDFQRMREESQKQDDAESLEETISPNQKGVVALVGAGPGD
FT                   PELLTLKALRFLQEADVVLYDDLVSPRIVAMARRDAEKIPVGKRGYRPSCRQDHITAQL
FT                   VALGLAGKKVVRLKGGDPMIFGRANEEIAALRAVGVRVEVVPGITAALGAAASLQMSLT
FT                   ERDKARRLQFITAHAHDGSLPDDMDWRALCDPRASSIVYMGVKTLQALASRLLAEGIDP
FT                   TTPALLIERATQRDERVLAGTIESLPPLVAAAAPDGPCLVFIGAAFASPETETSKDSVI
FT                   EAAL"
FT   gene            complement(308610..309011)
FT                   /locus_tag="Bind_0268"
FT   CDS_pept        complement(308610..309011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93923"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN4"
FT                   /protein_id="ACB93923.1"
FT                   /translation="MKSRENIMRLKRFYAEEKRRRVMQIEAMIAEFSRMASDLEQEISL
FT                   EEQRAGVSDPTHFAYPTYARAARTRRDNLQRSAEELSHQLIEARNSLDEALADLDKVPN
FT                   LDTREKNADSASDEDQQKQAPYNLRSLEA"
FT   gene            309554..311695
FT                   /locus_tag="Bind_0269"
FT   CDS_pept        309554..311695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0269"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: nwi:Nwi_3134 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93924"
FT                   /db_xref="GOA:B2ICN5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN5"
FT                   /protein_id="ACB93924.1"
FT                   /translation="MASASILKLRVEGMDCGACALKIEAAMRSLPGVADIAVDYHKASL
FT                   SLTLDEDRSSRAVIEARIRALGYTPIGDGVAVACETDRDHGPRQDAWWASRKGRLVITT
FT                   GVVLSLATIIAYRAPEWSYWAYGVATLAGLLPLSRRALAGARSGVPFSIETLMTIATAG
FT                   AIAIGEAQEAAVIVFLFAVGELLEGIAADRARTGIKALTKLLPRQALRLHGANVEMVSV
FT                   ETLAVGDHVVVRPGDRIPSDGFVVEGMSEVDEAPVTGESMPVAKETGAIVYAGSINANG
FT                   ELRVEITRTAADNTIARIIHKVEEAQASKAPTARLIDRFSRLYTPFAMAAAGFVVLMPP
FT                   LFFGADWFLSIYRGLAVLLIACPCALVVSTPTAIASGLASGARHGLLIKGGAALETLSR
FT                   VQTIAFDKTGTLTLGHPQVTDVLPIHGSVAEILVKAAAVERGSSHPLGVAIVAEAEKRH
FT                   LALPECFGGGIAIPGKAMMGRLKSGFVWVESPRHAAAQTALADNNDDDIAARIAALEGE
FT                   GKTVVVIRENKTILGLIALRDAPRSDAAEGLARLRALGLRLVMLTGDNGRAATTLGHVL
FT                   GLEVKAELLPDAKLDAILTYKAEAPIAMVGDGINDAPALAAASVGIAMGCGTDVALETA
FT                   DAALLKNRVTGVAELVALSRATLAIVWQNIALALGFKSVFLATTLWGATPLWTAILADT
FT                   GAMVLVTGNALRLLRFKVS"
FT   gene            complement(311688..313034)
FT                   /locus_tag="Bind_0270"
FT   CDS_pept        complement(311688..313034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0270"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat
FT                   protein TolB; PFAM: TolB domain protein; WD40 domain
FT                   protein beta Propeller; KEGG: bja:bll7152 translocation
FT                   protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93925"
FT                   /db_xref="GOA:B2ICN6"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN6"
FT                   /protein_id="ACB93925.1"
FT                   /translation="MKPFLSNPLSLTRRSAAKLLIGLSAAPVIAPIPRAFAQDRYLDVR
FT                   PGGEFKPVSIAVTTFAGDGSGPSHPTSIIINNFRRSVFLNPLDPKSFVSDVSNPDQAPQ
FT                   MDAWKTINAQFVVTGRSARSADGRLQTEFRLWDVTSGQQIAGQQYVTDPNNARRVAHII
FT                   SDTIFSRITGEKGFFDTRVVFVDETGARDHRRKRLAIMDQDGANVRYLTRGDDLVVTPR
FT                   FSPSSQDITYMSFGAADPKVLLLNIETGQREVVGNFPGMTFSPRFSPDGQKIVMSLSQG
FT                   ASSNLFTMDLRSRNTTRLSDSSSIDTSPSYSPDGTQIVFESDRGGTQQIYMMSAAGGGT
FT                   RRVSFGDGRYSTPVWSPRGDYIAFTRQKGSSFGIGVMKPDGSGERILTEGFHNEGPTWA
FT                   PNGLYIMFFRDASGQGGPRLFMVDLYGRGEFPVPTPSFASDPAWSPLLN"
FT   sig_peptide     complement(312921..313034)
FT                   /locus_tag="Bind_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            complement(313031..314341)
FT                   /locus_tag="Bind_0271"
FT   CDS_pept        complement(313031..314341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0271"
FT                   /product="TolA protein"
FT                   /note="KEGG: bcs:BCAN_A1737 TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93926"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN9"
FT                   /protein_id="ACB93926.1"
FT                   /translation="MRLHALHHPGENFDDADDWDRQETGASAASLVSMIRQSISKKLND
FT                   NPGFGVSLTAHAALLLAFVISFSSTPQFPEAVESIPVDMVTTQDLNQIMKGEKTAKTVQ
FT                   SSHRAERVSDLAELHPQPPLAEAKKDVMPPPRPGKPQPDPGESEKPQEAQRETPTPPKP
FT                   PERPAQTPPPRPAQEAKLEPPTPPAKPQPPQKAEPKPQPVSPEAAEPLPAPRPKAETKP
FT                   KPEPKSESKPEDKPKPHEAKPNETKPTPKFAPDAVAKLLEQTPAKTETKKAEAKPAQRP
FT                   KSGSEAATEPSKFNAADISKLLSAEAPQHKASTGKTVQQTASLGLPNANAAKMSPSMWD
FT                   RLDSILQDQYKQCWSFIGLNKQKYVPEIHVQYAEDGSLIGQPSLLNPPSDPQLRGLADS
FT                   AMRAVRRCNPLKIPAQYQPYYDQWKGRIVRFDPEEML"
FT   gene            complement(314356..314805)
FT                   /locus_tag="Bind_0272"
FT   CDS_pept        complement(314356..314805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0272"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mex:Mext_4762 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93927"
FT                   /db_xref="GOA:B2ICP0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICP0"
FT                   /protein_id="ACB93927.1"
FT                   /translation="MGMSMATGRRGGGRGRRGGRRYGAMADINMTPFIDVMLVLLIIFM
FT                   VAAPLLATGVPIDLPQTKAAALNVEHKPLSVAVDDKGDIFVMDKQVDSSTLAAALKDMA
FT                   KEGFDERIYVRGANTVNYGKIAEVMTIITGAGYKKVALVTDPSKN"
FT   gene            complement(314860..315585)
FT                   /locus_tag="Bind_0273"
FT   CDS_pept        complement(314860..315585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0273"
FT                   /product="protein TolQ"
FT                   /note="TIGRFAM: protein TolQ; PFAM: MotA/TolQ/ExbB proton
FT                   channel; KEGG: rpa:RPA1117 TolQ protein, inner membrane
FT                   protein, tolerance to group A colicins"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93928"
FT                   /db_xref="GOA:B2ICP1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICP1"
FT                   /protein_id="ACB93928.1"
FT                   /translation="MNPADLASAAAPVTEVSLFSMFWSAHIIVKIVMLGLLGSSIWCWA
FT                   IIVNKVLLFSKVDRDMARFEDIFWSGTSLDELYATLSAKPVSGMASLFVAGMREWKRSM
FT                   QGAAHSFLGLQARIEKALDVSIAREVEKYESSLLVLATVASAGPFVGLFGTVWGIMTAF
FT                   RSIAASKNTSLAVVAPGIAEALFATAIGLFAAIPALIAYNKLQNDVARKQAKLESFADE
FT                   FSSILSRQIDQHNVQDRAA"
FT   gene            315978..316619
FT                   /pseudo
FT                   /locus_tag="Bind_0274"
FT   gene            complement(316993..317574)
FT                   /locus_tag="Bind_0275"
FT   CDS_pept        complement(316993..317574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0275"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bam:Bamb_6109
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93929"
FT                   /db_xref="GOA:B2ICN7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN7"
FT                   /protein_id="ACB93929.1"
FT                   /translation="MTRKTDARARAIATAERLFRIQGYTATGLTQILEESGAPKGSFYF
FT                   HFPRGKAQLAEEAIDHYIAGRIAVLRNISANTTGDALNFVHQIFGTFAAEMVATDFQYG
FT                   CLMQNLANELPTLDAELTKRVARGFVDSTEIIAEHFRGCGFAPARASSTAAALVAALEG
FT                   ARTIARLERTPAIFEALADVSVQRWATPER"
FT   gene            317656..318960
FT                   /locus_tag="Bind_0276"
FT   CDS_pept        317656..318960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0276"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bam:Bamb_6110
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93930"
FT                   /db_xref="GOA:B2ICN8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2ICN8"
FT                   /protein_id="ACB93930.1"
FT                   /translation="MPLYKIKPSPSRRAVLAMGAASLVAASLRPAHANPMGGTDLTIWT
FT                   YGEGTLPTGVRSRMIHGVNGLNVHILEAGYESPSRPLALLLHGFPDLAYGWRHLIPILA
FT                   EAGYHVVAPDQRGFGRTTGWVNDYDAPLEPFSFLNMARDALGLVAALGYRRTAMLVGHD
FT                   LGSPVAAYCALARPDVFPSVVLMSAPFPGPPAFPFDTAKNEASSVQPNTENQKLAAALA
FT                   ALDPPREYYQQYLSTRAANDDMWHPPQGLHAFLRAFFYVKSADWPGNKPHPLKARTAAE
FT                   LARMPTYYVMDLGRTMPQTVAPFQPSATEVLACKWLTEPELGVYTEEYDRTGFQGALQA
FT                   YRVFSDPDLNAELRLFSGKTIDVPSLFIGGKSDWGTYSAPGALDLMRTKAATRMGGMEL
FT                   IDGAGHWIQQEQPVRLGALLLAFIKEVGGAGRTSR"
FT   sig_peptide     317656..317757
FT                   /locus_tag="Bind_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            complement(319223..319657)
FT                   /locus_tag="Bind_0277"
FT   CDS_pept        complement(319223..319657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0277"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: tol-pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   azc:AZC_0520 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93931"
FT                   /db_xref="GOA:B2ID74"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID74"
FT                   /protein_id="ACB93931.1"
FT                   /translation="MESPESVVPHCLGIRVYYEDTDFSGIVYHASYLRFMERGRTEFLR
FT                   ERGISQGLLAMRSEGEAFAFVVRGMVLDFLRPARMDDELIVETLIETIGGASITMTQRV
FT                   TRQDSEQKTILVTATVRLAILAGSRAKRIPPSIRAKLAEG"
FT   gene            complement(319794..320003)
FT                   /locus_tag="Bind_0278"
FT   CDS_pept        complement(319794..320003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0278"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: rpa:RPA4719
FT                   molybdo-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93932"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID75"
FT                   /protein_id="ACB93932.1"
FT                   /translation="MSKISACNVLDGTVAAIHQGPTTSHVEITVQGIKLIASMTNESVK
FT                   ALNLKEGMPAHAVINPNDVLLLVD"
FT   gene            320330..321190
FT                   /locus_tag="Bind_0279"
FT   CDS_pept        320330..321190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0279"
FT                   /product="modD protein"
FT                   /note="TIGRFAM: modD protein; PFAM: Quinolinate
FT                   phosphoribosyl transferase; KEGG: rpd:RPD_1188 ModD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93933"
FT                   /db_xref="GOA:B2ID76"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID76"
FT                   /protein_id="ACB93933.1"
FT                   /translation="MILPILPDHVLDQLLADDSPLLDLTTHVLALDAHAGEMHFAARDP
FT                   MVAACVEEAARIIERAGAKVVRHAASGDRLVPKAPILTAQGPAPVLLRAWKVSQNLIEV
FT                   ASGIATATAALVDAARAVRPNIAVTCTRKAVPGTKLISLKAILAGGALPHRLGLSETIL
FT                   IFAEHRAFLSGQSEQALVEQVRREAAEKKIVVEVASVEEALAWAKAGADVIQAEKFSPA
FT                   AIISLVEAVGSLQPKPVIAAAGGINAENAGLYAAAGADVLVTSSPYWGKPRDVAVTLGP
FT                   AILGQ"
FT   gene            321523..322008
FT                   /locus_tag="Bind_0280"
FT   CDS_pept        321523..322008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0280"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: bra:BRADO1761
FT                   hypothetical protein; putative molybdenum ABC transporter
FT                   (ATP-binding protein) (C-ter fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93934"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID77"
FT                   /protein_id="ACB93934.1"
FT                   /translation="MLEVAKKTRRRPSLKTMLHARVLRHDESMGLTTLFCEDGELRVPL
FT                   IDHPIGSVVRVRIDARDVSIALSRPMDVSITNRLPGQIAELEYLTPPYVRVTFDLGKTR
FT                   LHALVTKESILRLALEPGLSAWVMIKAVAIASGEITPDRAPAPRPWPLARKPNPEPT"
FT   gene            complement(321938..322342)
FT                   /locus_tag="Bind_0281"
FT   CDS_pept        complement(321938..322342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0281"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: bra:BRADO1762
FT                   putative transcriptional regulatory protein, LysR family;
FT                   putative molybdenum transport regulator, ModE"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93935"
FT                   /db_xref="GOA:B2ID78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID78"
FT                   /protein_id="ACB93935.1"
FT                   /translation="MQKPKPSRACLAIELQLPNGGSFGPEDLALINMIRSERSIIGASR
FT                   ALGLSYRKCWLTVDALNRTFESPVIATFPGRRGGGAEITPFGERLVALYCSIERHSSNS
FT                   AKKSLDELTLALDWAFEPKAKVVEPERDLA"
FT   gene            complement(322555..323439)
FT                   /locus_tag="Bind_0282"
FT   CDS_pept        complement(322555..323439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA4634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93936"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID79"
FT                   /protein_id="ACB93936.1"
FT                   /translation="MRPDPFSNRTDSNRFSSRPLAIVLGTNEIASAVAVLLHRTGRAVI
FT                   LTHDPVIPVIRRGMAFHDALFGDFAWVNDLKGQRVDYLSEVPAALAARDTVLVTMMGLI
FT                   DLLILGPVDVIVDARMHKRSIKPDLRGLAKCAIGLGPGYRIGENCDLAIETRPGRIGHP
FT                   LVDGATEDQHEEPSLLGGVGAERFVYTEAGGRWRTALDVGTRVFKGVVIGHLDRQPIMA
FT                   PMDGILRGLARDDTEMPSGVKLVEIDPSGRAGRWTGMDERPHSIAEAVLRAMRRADAAR
FT                   IDLSHLVPGLHLH"
FT   gene            complement(323750..324418)
FT                   /locus_tag="Bind_0283"
FT   CDS_pept        complement(323750..324418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0283"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bbt:BBta_7870
FT                   putative carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93937"
FT                   /db_xref="GOA:B2ID80"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID80"
FT                   /protein_id="ACB93937.1"
FT                   /translation="MGEQITLTASDGVKIGAYKAVPSGTPRGGIVVVQEIFGVNPHIRK
FT                   VADGYAAEGYLVVAPALFDRMEPDVELGYTGEDYNKAINFMNKIDKEKALLDIAAAVAA
FT                   ASSAGKVGIVGYCFGGLMSFTAAARVPGLAAAVAYYGGGIAQVADLQLKVPLLLHFGER
FT                   DNLIPPADVAKIHAAHPNVPIYTYPAGHGFNCDARSSYDKPSADLALSRSLAFFSEHLR
FT                   "
FT   gene            complement(324592..325755)
FT                   /locus_tag="Bind_0284"
FT   CDS_pept        complement(324592..325755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0284"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: cme:CMP318C
FT                   sphingolipid delta 4 desaturase protein DES-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93938"
FT                   /db_xref="GOA:B2ID81"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR013866"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID81"
FT                   /protein_id="ACB93938.1"
FT                   /translation="MAKLFDLGPPDRAPRLTAYIPGPAQRPHPPRRRAITAAHPDVVAL
FT                   VGHDPLTFVITLGIVGFQILMAGWMSSHVWWVALIAAYCIGAFANHALFVVIHDATHNC
FT                   IFESVRANKWAGILADLPNTVPTAMGFRYFHIKHHSHLGDYDYDADLPSHWEARLFGRT
FT                   WYGKAAWMLLFPVFQGTRLSRLKATVPMWSRWTFINLACVVLFDLAILAAFGPVALLYL
FT                   FASFWFSVGGLHPLGARWIQEHFTPDTQQETYDYYGPLNFLALNIGYHNEHHDFPDVPW
FT                   IWLPCLKAMAPEFYGHLKYHRSWFKLFVTFIVDPRFTLYTRLDRSAASLASPEAVMARA
FT                   QEAQASAQGQVQEQAQGPAPQTQTIPVNKPVDGTAGKTSKQATPAAA"
FT   gene            complement(325977..327308)
FT                   /locus_tag="Bind_0285"
FT   CDS_pept        complement(325977..327308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0285"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_1567 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93939"
FT                   /db_xref="GOA:B2ID82"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID82"
FT                   /protein_id="ACB93939.1"
FT                   /translation="MQPLLSIDFLRFGLESSLMLSLLGLLLVASGFLALIGINIFELLI
FT                   GRRLRVPLPGPLVAEANLPHVLIQIPVFNEAEMVAEALQAAAALQWPRDRLHIQLLDDS
FT                   TDETSTIAQRIVLNLRAQGTDVLHLRRADRSGYKAGALAAGMARCDAPYVAIFDVDFRP
FT                   PSNWLRAVVPMLIADKKAGFVQSRCEFSNYATNWLTRIQGLMMDAHYTMEQATRYRAGW
FT                   LFQFNGTAGLWRREAIEAAGGWSADSLCEDLDLTVRARVAGWHGVFTMEPVVPGLVPEK
FT                   VRHWRVQQRRWSTGFVQVTRKLMKQIWTSDCSFGLKLSSSFLILIQAFYPCAAVATASI
FT                   LAGVLLRGGDATDYVPLLDGFAAFVAFIAIGLTLVPYLVLRRGPLHQYLLTLILLPPMM
FT                   IYISLSNAPAILKSSFGGTETWKRTPKSRALPAGASTDDSFGDL"
FT   gene            complement(327629..328432)
FT                   /locus_tag="Bind_0286"
FT   CDS_pept        complement(327629..328432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0286"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bte:BTH_I1339 oxidoreductase,
FT                   short-chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93940"
FT                   /db_xref="GOA:B2ID83"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID83"
FT                   /protein_id="ACB93940.1"
FT                   /translation="MPLNSRRPPQTVLITGASSGIGRALALAYAAPGSRLILIGRNAER
FT                   LAATAQKAMDQGAEVIIGAIDVRDQAAMAAWISERDKTHPIDLAIANAGITTGLSPGEL
FT                   TEDPQAVRAILATNLLGVLNTIEPLIQPMSARGKGQIACIGSIAGLHGLPYAPAYCMTK
FT                   SAVHAYMESIRGRLEARGLVVSLIIPGFVKTPLNDSIDALKPLEISDSKAAALIRRGLE
FT                   RGKAIIAFPLPLYWLARFGRLLPPRLYDRIMAGVAAQVPQTQERV"
FT   sig_peptide     complement(328346..328432)
FT                   /locus_tag="Bind_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.506 at
FT                   residue 29"
FT   gene            complement(328422..328901)
FT                   /locus_tag="Bind_0287"
FT   CDS_pept        complement(328422..328901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0287"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bxe:Bxe_B2727 putative MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93941"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID84"
FT                   /protein_id="ACB93941.1"
FT                   /translation="MSLDPGVSCPDFPWPKPGEILPPQALGPFDSSALSAYALASGDDN
FT                   PLHLDPAAAHSIGLPLPPVQGMLILASFEPCLAAWNPQLRLSRLSAKFLRPVFLGQGLT
FT                   LSGKIVRHRTEPEPEIVLRLMAHLAAPPASNDSKPGELAILAEANLIRNPSPHAS"
FT   gene            complement(329148..329885)
FT                   /locus_tag="Bind_0288"
FT   CDS_pept        complement(329148..329885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0288"
FT                   /product="manganese containing catalase"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   ava:Ava_3821 manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93942"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID85"
FT                   /protein_id="ACB93942.1"
FT                   /translation="MFLHVKETLHPVSIGTPDPSFGQMLLEQFGGATGELTAALQYWVQ
FT                   SFHVEDASIRDMLQDIAIEEFSHLEMVGKLIAQHTSKIDQTAVHAAPLFSMKGIGPHFL
FT                   DSQGAHWTASYINEGGNVVRDLRANIASEAGARQTYEALIKRCMDEKTKKVLVHLLTRE
FT                   ITHTQMFMKALAAMGKLDDPMFGTITPDETVNVVFNFSAGEDYRGPWNEGNFKYISNPQ
FT                   AEGGLPPDPINPDDEKINKAAAE"
FT   gene            330432..330620
FT                   /locus_tag="Bind_0289"
FT   CDS_pept        330432..330620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93943"
FT                   /db_xref="GOA:B2ID86"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID86"
FT                   /protein_id="ACB93943.1"
FT                   /translation="MRFRLSPPSPPVLLVSLAVAVTAIATLYTKVPWVGHYVSTHRFWA
FT                   MAAAYGILLAGVVFEGL"
FT   sig_peptide     330432..330509
FT                   /locus_tag="Bind_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.664 at
FT                   residue 26"
FT   gene            330675..330923
FT                   /locus_tag="Bind_0290"
FT   CDS_pept        330675..330923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93944"
FT                   /db_xref="GOA:B2ID87"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID87"
FT                   /protein_id="ACB93944.1"
FT                   /translation="MAGTVSMVVAAGVLFVIFWLALAIPTALFAHRAGDRVWIAFAVWC
FT                   PFWMAPLLYLFPARTGFLVWFFWAPGAVYLWLLALRK"
FT   sig_peptide     330675..330767
FT                   /locus_tag="Bind_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.678 at
FT                   residue 31"
FT   gene            330987..333641
FT                   /locus_tag="Bind_0291"
FT   CDS_pept        330987..333641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0291"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: mex:Mext_4055 excinuclease ABC, B subunit;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93945"
FT                   /db_xref="GOA:B2ID88"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID88"
FT                   /protein_id="ACB93945.1"
FT                   /translation="MPKAPSSPRTAQSKTAEPAVAKKPRTSKAKASKPEVQPLDEHLAA
FT                   LLNPALNKSLATLEEHGEPSGFAEARAAFHFDVEPLEMEAPARRRGGRGTAAKPAFSEL
FT                   TGASATAESLQDLLARGDPNLRERPPWQPHRPPRPDKSEGGHAFEIVSDYTPQGDQPQA
FT                   IDELVTGIKAQERDQVLLGVTGSGKTFTMAQVIARTNRPALILAPNKTLAAQLYGEFKS
FT                   FFPNNAVEYFVSYYDYYQPEAYVPRSDTYIEKESSINEQIDRMRHAATRALLERDDVII
FT                   VASVSCIYGIGSVETYTAMTFTLKRGERIDQRQLIGDLVALQYKRSAGDFSRGVFRVRG
FT                   DTLELFPAHYEDRAWRIGFFGDEIESIVEFDPLTGKKVQDLEFVKVYANSHYVTPRPTL
FT                   LQSIKGIKQELKQRLDELNAAGRLLEAQRLEQRTVFDLEMLEATGSCAGIENYSRYLTG
FT                   RRPGEPPPTLFEYLPDNALVFTDESHVTVPQIGAMYRGDFRRKATLAEYGFRLPSCLDN
FT                   RPLRFEEWEAMRPQTVHVSATPGSWEMEQTGGVFVEQVIRPTGLIDPPVEVHPARSQVD
FT                   DLLDELRQVTRQGYRSLVTVLTKRMAEDLTEYLHEAGIRVRYMHSDIDTIERIEIIRDL
FT                   RLGAFDVLIGINLLREGLDIPECGFVAILDADKEGFLRSETSLVQTIGRAARNVEGKVI
FT                   LYADHETGSMQRAMAETTRRREKQEAYNREHGITPATIKRGIHDILGSVYEQDHVSVDA
FT                   GLAQADLKPGHNFKMTIADLEKRMREAAANLEFEAAARYRDELQRLQAVELAVSDDPLA
FT                   RQEEVEEQAGAYKGARKYGAAANLPVNRPHKPTDAEMGPHNFGGGEAKPHAGSGKSPQR
FT                   MKRRASKPTRSAS"
FT   gene            333798..333995
FT                   /locus_tag="Bind_0292"
FT   CDS_pept        333798..333995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93946"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID89"
FT                   /protein_id="ACB93946.1"
FT                   /translation="MTEALELLIAKARKIQMTDEQAREQRLSFVYGNTHIENSMITREM
FT                   VAEADEKITQEEKAQAAEAK"
FT   gene            333992..334651
FT                   /locus_tag="Bind_0293"
FT   CDS_pept        333992..334651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0293"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: rpc:RPC_3396 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93947"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID90"
FT                   /protein_id="ACB93947.1"
FT                   /translation="MSEDRHSQADPVELISDPIEKARREAENGVRQFKTAAKIIIDQIW
FT                   DGGRKFRLTQALILQLHQQALEGLHPLAGTYRNSPVRIGQSHHNPPPHIEVPDHVAEMC
FT                   RYVNENWDERNAIHLAAYVLWRMNWIHPFADGNGRTARVVSYVVLNIKLKSLLPGTPTI
FT                   PDQIAADKKPYYDELEKADAGWKHERLHLAGMEKMLEEMLERQLSHATEEAATDPL"
FT   gene            complement(334798..335643)
FT                   /locus_tag="Bind_0294"
FT   CDS_pept        complement(334798..335643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0294"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase LpxD"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase LpxD; KEGG: mex:Mext_2080
FT                   UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93948"
FT                   /db_xref="GOA:B2ID91"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID91"
FT                   /protein_id="ACB93948.1"
FT                   /translation="MSDPLFTPPAPWLSLAEVAALTGAQGAGDLTAHIHAVAPLENAGR
FT                   GDLSFFDASQDPALLCETGATACLIVPAQASLLAPSVVPLLTLDPPGAAALVLAILFRE
FT                   SLRPESGFGGPGLLGVSPGAHVHPNARLETGVGIDPGAVIGPRAEIGAGSLIGAGSVIG
FT                   PGVRIGRDCSIGAGVSISHALIGNEVVLAPGVRMGQSPVLTAWPVAPGRVIVQDKVVIG
FT                   ANSTIDRGILRDTIIGEGTRIAALVAIGADVSLGRFCRVPQRTELSVGMTYGDQSVIGV
FT                   "
FT   gene            complement(335857..338424)
FT                   /locus_tag="Bind_0295"
FT   CDS_pept        complement(335857..338424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0295"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: mex:Mext_2081 outer
FT                   membrane protein assembly complex, YaeT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93949"
FT                   /db_xref="GOA:B2ID92"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID92"
FT                   /protein_id="ACB93949.1"
FT                   /translation="MPIIKGHSSRIIASKAEAAASQDASVGSSPRRLSRAGLSGKAKFL
FT                   GRASATALIASLYLAAVMPSAFAVSVSVHGNKRVDTETIASYFTGTDSASVNKGVKDLY
FT                   ATGMFSDVKISQAGGGLVVSVTENNIINRVVFEGNSKVKTETLQGEVQSKSRGAYSKAT
FT                   VDADVERIKDAYRRAGRAGAKVTSRIVDLPNGRMDVVFTIDEGEKTGVKRIEFVGNTVF
FT                   TSNKLRDLMQTTEMNFLSFFKTSDVYDPDRIGSDLELIRRFYLKNGYADFRVVGSDAKF
FT                   DENEGGYVITITVEEGVQYKVQSVTIDSHLPDIDTNSLQKFLRLSPGEIYNGDMVEKTV
FT                   DALTREISRHGFAFSQVHPRGDRDPASRTVSIVFVLEEGPRVYIERIVIRGNTRTRDYV
FT                   IRREFDLGEGDAYNRAIVERAERRLNNLGYFKKVKITNEPGSAPDRVIIVVDVEDQSTG
FT                   SLSLSGGYGTASGLIAEVSVSESNFMGRGQYVRLAVSAGQYSRGVDFSFTEPYFLGNRI
FT                   AAGFDLYAKKTEVSYYSYYSNFITGGTFRLGLPVTEELTFSPRYSIYNSDLTIPDDWNH
FT                   PYDDCNRPIWGLTPGFGAGAPSYSYSCLTNGEASLALKQAAGQYLTSMFGYTLSYNSLD
FT                   NNKNPTSGIFAELRQDVAGAGGYSEFVRTTGDFRIYHELTEDIVGFLRLQGGDLVSLNS
FT                   KGHPLRIVDNFNLGPSLVRGFQPMGLGPRDVSPGVDWSGNPLGGTKYWGATLEAQFPLW
FT                   GLPRDLGLRGAVFADAGSLWGYEGRTNFANGGNIIPNNAPPLYTQGNTITVGGAGMTVR
FT                   SSVGVSLIWSSPMGPIRFDFAKALTKSPFDQTRIFNFTGGTSF"
FT   gene            complement(338684..339829)
FT                   /locus_tag="Bind_0296"
FT   CDS_pept        complement(338684..339829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0296"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="TIGRFAM: membrane-associated zinc metalloprotease;
FT                   PFAM: PDZ/DHR/GLGF domain protein; peptidase M50; KEGG:
FT                   xau:Xaut_4432 putative membrane-associated zinc
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93950"
FT                   /db_xref="GOA:B2ID93"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID93"
FT                   /protein_id="ACB93950.1"
FT                   /translation="MPILSSLWSLGAYLVPFVCVLSLIVFFHEFGHFLIGRLCGVQVDA
FT                   FSLGFGPELFAFVDRYGTRWRLAALPLGGYVKFHGDANGASMTDEAAAASMPAAERAVS
FT                   FFAQKVWKRAAIVVAGPLANFILAIVLFTGIFYVNGRNILLPYVDGVSAGSAAEAAGFQ
FT                   PGDLILSIDGQPIDSFEAMQRLVQTTRDQSLTFTIARQGKELTLNATPRVRDIVTPLGT
FT                   TRVGVLGVEAKGKPENWRVEHYGLADSAHLAVSETWYVIARTGDYVVGLFSGKESAAQM
FT                   SGVVGIAQASGEMAKIGIAAVLHLAAILSISVGILNLLPIPLLDGGHLFFYAIEAIQGR
FT                   ALNERVQQFGFRVGMTLVAALMIFATYNDVLRITRQLLHWG"
FT   gene            complement(339940..341169)
FT                   /locus_tag="Bind_0297"
FT   CDS_pept        complement(339940..341169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0297"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: bra:BRADO4134 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93951"
FT                   /db_xref="GOA:B2ID94"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID94"
FT                   /protein_id="ACB93951.1"
FT                   /translation="MGKVSELRSEAAEAKASRSIVILGATGSIGQSTAAIISGAKGAFT
FT                   VAAVAGGRDPQALAKVARELGASFAALADPAGYKDLKEALSGTGIEAAAGPDSVVEAAL
FT                   HPSDMVMGAIAGTAGVAPTYAALSAGRTVALANKECLVCAGPAFMRQAAAMGTRLLPVD
FT                   SEHNAIFQAMNDANLDSIEMITLTASGGPFRTWTAEEIAKATPEQALNHPNWSMGPKIT
FT                   VDSAGLMNKGLEVIEAHYLFGIEAARLDVLVHPQSVVHGLVHFTDGSVTAGMAAPDMKV
FT                   PIAHCLSYPERINTAARRLDLAGVGSLTFERPDFERFPALRVALDALRAGQGLPTILNA
FT                   ANEIAVEAFLDKRISFHAIARLVEQACEQAQADGIARDPESVTEALEMDQLIRERTRAS
FT                   LAKGNVATLH"
FT   gene            complement(341273..342163)
FT                   /locus_tag="Bind_0298"
FT   CDS_pept        complement(341273..342163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0298"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   azc:AZC_1698 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93952"
FT                   /db_xref="GOA:B2ID95"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID95"
FT                   /protein_id="ACB93952.1"
FT                   /translation="MNASPSENPAPAIPLPAGKRRFGDLGPRIASAVVLMSLALVALWQ
FT                   GGLVFLVVWLGASLAIFYEWESLIGGARRPLRLGLGWLTLIGLALCLWIGHPASGFLLL
FT                   LFGTALLAAVAEPGKRLWSAGGLPYAGLMLMAVQGLGTGDLCATLVMAWLFVTIWGTDI
FT                   SAYFAGRLIGGPRLWPRVSPGKTWSGMLVGVLCGGIFGTLLLVAASPIPCVSTPGLTPI
FT                   FLLGLLTAQISQGGDLFESWIKRHFGVKDSGHLIPGHGGFMDRLDGFITASIFIWLVGA
FT                   ARGLPSLAQGVLFWS"
FT   gene            complement(342160..342960)
FT                   /locus_tag="Bind_0299"
FT   CDS_pept        complement(342160..342960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0299"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: nha:Nham_1698 undecaprenyl diphosphate
FT                   synthase; TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93953"
FT                   /db_xref="GOA:B2ID96"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID96"
FT                   /protein_id="ACB93953.1"
FT                   /translation="MTMPEATTQERDKGMKTRAADVPAHVGVIMDGNGRWAAARGLPRL
FT                   EGHRRGVEALRATVRAALDFGLDYLTVYSFSVENWSRPIEEVTDLMGLLKRFIRHDLRD
FT                   LHKAHVRVKIIGAREPLQPDIRALLDEAEDLTRDNDRLTLVVAFNYGSRQEIAGAARAI
FT                   AHKVAEGLLQPEDINEHLFASYLDTAGIPDPDLIIRTSGEQRLSNFLMWQAAYAEFVFL
FT                   PMHWPDFNQQAFAAALTEFATRERRFGGVSAAPKKSKFLGGFRP"
FT   gene            complement(343239..343799)
FT                   /locus_tag="Bind_0300"
FT   CDS_pept        complement(343239..343799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0300"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: nwi:Nwi_1856
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93954"
FT                   /db_xref="GOA:B2ID97"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ID97"
FT                   /protein_id="ACB93954.1"
FT                   /translation="MSAEFDISDLKRRMQGAIATLKHELGGLRTGRATASLLEPVHVDA
FT                   YGQSLPLNQVATISVAEARMLSVQVWDKGMVGPVDKAIRDSNLGLSPTVEGQILRIRIP
FT                   ELNEQRRKEMAKVAHKYAEEAKVAVRHVRRDGIDTLKKLLKDKAIGEDDEKRHAAEIQK
FT                   VTDQFVGEVDQALAAKEKEIMQV"
FT   gene            complement(343900..344658)
FT                   /locus_tag="Bind_0301"
FT   CDS_pept        complement(343900..344658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0301"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: xau:Xaut_4437
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93955"
FT                   /db_xref="GOA:B2ID98"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID98"
FT                   /protein_id="ACB93955.1"
FT                   /translation="MTTSDANAASSASAASTIPWRRVVVKLSGEALMGSSSHGLDAPTL
FT                   NRIAGDLAGAAALGVEVAVVVGGGNFFRGIAGADKGIERARADSIGMLATVMNGLALEY
FT                   AIEKQGQSARTLSSIPMPSICEPYSRQTALHHLGKGRIVVLAGGTGNPFFTTDTGAALR
FT                   GAELSCDLIMKATQVDGIYSADPKRDPTAVRYDKLTHDEAISKNLAVMDTAAFALAREN
FT                   RIPIIVFSIGEAGAISAALLGKGRATYVSP"
FT   gene            344894..346576
FT                   /locus_tag="Bind_0302"
FT   CDS_pept        344894..346576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0302"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; KEGG:
FT                   gbe:GbCGDNIH1_0354 two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93956"
FT                   /db_xref="GOA:B2ID99"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2ID99"
FT                   /protein_id="ACB93956.1"
FT                   /translation="MLHGRAGQARQDPRGVLLRRSSHLKLGVISLEAITSISSQGNQGS
FT                   AGRPRIQAAKSSLRLALLVIPSAILCLAILIAIGVTLLDARGRIVTETASGLNLGDLVL
FT                   SHALHDLTRDPDPEAALIKLRRDLSRLRHISLRFVSDPALGGNEHEGDAPSGGKNQDTP
FT                   GPADTPLVPWPEPSRRATRAAPLWFEAMFEPARIVKTYPVVLSLAGDTEKIRGSFVMAT
FT                   RPGDEVAEVWRDLVFLTGLLGCLSLIIVGLIALCTHQALRLFHQLVEGLDRLGRGQFAA
FT                   MTEFPVQELAQIGMHFNQLAATLERSEVDKHHLIDRLISVQESERKELARELHDEYGAA
FT                   LFGIRAATSCILDSAHALQRPEPGENQNIQEISERAQAISQLADTIQKQNRRILERIRP
FT                   AVLHRMGLPEALRHLVEDWQTHHKGFSCALTLAVDSASFDEEVSLTFYRLVQECLTNIA
FT                   RHSQARSARITLALVAASAHPEEGVSEPGQNLCLRIEDDGIGLPPSFRFGFGFLGMSER
FT                   VRKLAGCLRIENALPHGTLIEALIPLPRSSYAKSHPWYEASNP"
FT   gene            complement(346582..347064)
FT                   /locus_tag="Bind_0303"
FT   CDS_pept        complement(346582..347064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0303"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:pRL110290 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93957"
FT                   /db_xref="GOA:B2IDA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA0"
FT                   /protein_id="ACB93957.1"
FT                   /translation="MIIRAAGTHDAPALWAIIEPVIRAGETYALPRDMPQQEAITYWMG
FT                   SDRETFVVEEDGRLLGTFYLRANQLGGGSHVANCGYITAPEATGRGIARMMCLHSLDLA
FT                   RAKRFRAMQFNFVISTNERAVRLWQALGFDIIGALPGAFAHPTLGDVDALVMFRKL"
FT   gene            347183..347872
FT                   /locus_tag="Bind_0304"
FT   CDS_pept        347183..347872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0304"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: gbe:GbCGDNIH1_0355 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93958"
FT                   /db_xref="GOA:B2IDA1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA1"
FT                   /protein_id="ACB93958.1"
FT                   /translation="MESLKAHQKPVTILIIEDHPIVREGCRRLFSRRPDIETHDAASAG
FT                   AGLACNKTLRPDVIILDVDLPDASGLDMIPALLQDNDTARIIVFSMYEARNFVTRALEL
FT                   GARGYVTKNDDPDMILQATDKVLSGALYLGQTVAQNLALAQIEPAQDPLRDLSEREREV
FT                   LHFMGEGKSLGEIARALSLGYKTVANIVSMLKQKLGVTTSPALIKFAVECRSHENRSNE
FT                   NRVKPGF"
FT   gene            348097..350514
FT                   /locus_tag="Bind_0305"
FT   CDS_pept        348097..350514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0305"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xau:Xaut_1786 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93959"
FT                   /db_xref="GOA:B2IDA2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA2"
FT                   /protein_id="ACB93959.1"
FT                   /translation="MMGRIFISLGLGAAFYSCLPASARAQTAQEPIALPTVDIVSTAPL
FT                   ASGAGIDSNKLPGLTQTLTPRDFQRTYSPNVTDALQQRTPTAVSIDVNGNPLSQDLYYH
FT                   GFVASPRQGTPQGLAVYQNGMRLNEPFGDTVNWDLVPPQAIERTDIFTNNPAFGLNALG
FT                   GAVSIQMKNGFTWQGFEAQTMGGSYGRVSGMLQYGKQIDNFSVYFSADATRDGGWRYNS
FT                   ASSQVRLYGDIGYRTPDAEVHFIANGGQSLLGVVGPTPFSLVSNDYRSVFTSPQTTDNQ
FT                   AGSLALTSRFPLSATWTVNSNFYMRAFKQIHTDGNDANVEGCSSRSSYPGQLCLQDDEF
FT                   EYLLNGGPKTTAFRNMFVIRNQNGQTIPFQGDDFAYGTIDRTYIHSLSVGTTLQATNTD
FT                   KILGHDNHVTFGGSIDRSQLSFSSYSTLGQITPDFSVQTTGFPGSGSVMRTDGNLAYVP
FT                   TYLNGNTTYYGVYVMDTFDVTPDISITGGGRLNIANIVTHDTTGQASELNINAAYTRIN
FT                   PIGGLTWRILPTLTAYAGYSEANRAPTPLELDCANPTRPCILENSLTSDPPLQQVVSRT
FT                   VEAGLRGSQPVLDDGSIDWKLGYFRTANSNDIITLASTIPGRGYYANVPGTLRQGLELG
FT                   IEFHTGDWLAYLNYGFVDATYQFSGALSSPNNPYADANGDVFVHPGNHIPGIPQQMLKF
FT                   GADYKVTPQFTVGGDVLIIGSQYYVGDNSNQNPKLPSYWVANLHASYQVNEHIQFFGLI
FT                   NNLFNQHYATYGTFYGTDTNAQLVSSIPFTNDPRTITAAQPISFYGGMKVTF"
FT   sig_peptide     348097..348174
FT                   /locus_tag="Bind_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.833 at
FT                   residue 26"
FT   gene            350657..351532
FT                   /locus_tag="Bind_0306"
FT   CDS_pept        350657..351532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0306"
FT                   /product="Chorismate mutase"
FT                   /note="PFAM: Chorismate mutase; KEGG: xau:Xaut_0395
FT                   chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93960"
FT                   /db_xref="GOA:B2IDA3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA3"
FT                   /protein_id="ACB93960.1"
FT                   /translation="MTPLPSSATASVQETLADLRVDIDRIDAELHQLLIARGEIIDRLI
FT                   AVKARQGGGSAFRPGREADMMRKIVSRHRGLLPVDTVESIWRIIISTFTYVQAPYSVHA
FT                   DISGGDAAMRDCCRFHFGFTVPYIVHQGTGGVVEAVASAKGDLGLVKVETSAAEGAWWR
FT                   RLAEPFAPKIIARLPFVERPDHPAGMPLFVIAKPLSDAASRETVVYAIGLERWHGSLPE
FT                   CLAAFGGDILGNAADGYGLSLLVAVPGSVTPQSLRDGLRQAGAGEARIAEVGSHAARFD
FT                   LETNAISSQK"
FT   gene            351685..352821
FT                   /locus_tag="Bind_0307"
FT   CDS_pept        351685..352821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0307"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: xau:Xaut_0394
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93961"
FT                   /db_xref="GOA:B2IDA4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IDA4"
FT                   /protein_id="ACB93961.1"
FT                   /translation="MTQSGSSPRPSSVRPMPHAGVLGIEPYVPGKSAAPGVAKIHKLSS
FT                   NETPLGPSPEAQKAFAASAEKLALYPDGAATLLRTAIASRHGLDPARIVCGAGSDELLS
FT                   LLAAVYLGPGEEGIFTEHGFLVYKIAILTAGGTPIVVPEKDLTTDVDAILAAVTPRTRI
FT                   VYIANPNNPTGTYLPFAEVKRLATSLPPNVLLVLDAAYGEYVTRNDYSAGLELVSTHEN
FT                   VVMTRTFSKIYGLAALRLGWCYAPLAVADALNRVRGPFNTSGPAIATGVAALADQAHID
FT                   RAIAHNETWLSWLGEEIGKLGFKVTPSVANFLLLHFEDQAEAQAVDAFLSSRGLILRAV
FT                   ASYGLPNCLRLTVGTEEANRLVVDGLKDFCRERMKQRG"
FT   gene            352814..353776
FT                   /locus_tag="Bind_0308"
FT   CDS_pept        352814..353776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0308"
FT                   /product="Arogenate dehydrogenase"
FT                   /EC_number="1.3.1.43"
FT                   /note="PFAM: Prephenate dehydrogenase; NADP oxidoreductase
FT                   coenzyme F420-dependent; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: xau:Xaut_0393 arogenate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93962"
FT                   /db_xref="GOA:B2IDA5"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA5"
FT                   /protein_id="ACB93962.1"
FT                   /translation="MADGLGARLETPLFEQLTLIGVGLIGSSLARVASRKGLARRIVAY
FT                   DNDPDVRAKVERLALADVVSPSPEKAVQGADLVILCAPVGAMGEIAKTIAPHLAPGTIV
FT                   SDVGSVKEAIIEAVAPALPGHVHFVPAHPVAGTEYSGPAAGFATLFLNRWCILTPTPDI
FT                   DPEIVARVESFWSAAGANVEIMKATHHDLVLAITSHVPHLIAYNIVGTAADLETVTQSE
FT                   VIKFSAGGFRDFTRIAASDPTMWRDIFLNNKSAVIEMLGRFTEDLIALQRMIRHEDGDG
FT                   LFKLFTRTRAIRRNIIEQGQETAAPDFGRGVAKDTDEER"
FT   gene            complement(353812..354711)
FT                   /locus_tag="Bind_0309"
FT   CDS_pept        complement(353812..354711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0309"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: atc:AGR_pAT_270 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93963"
FT                   /db_xref="GOA:B2IDA6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA6"
FT                   /protein_id="ACB93963.1"
FT                   /translation="MDLSTALRAFVRIVERGSMTAAATDLGISQPAVSKLLRNLEEHTG
FT                   ARLIERNPRAMRPTAQGLALYEAAGSALAVIDSAIESVRSDVGAIRGNLRLHGPTCIGE
FT                   RHLHQIVAEFQDRYAAVTVELILENRTVDLIHENVDLALRMGRPVDQNLIMRRIGLSRR
FT                   ILVASPEYLERCGPVRVCEDLSGHDMVVTNASLSGGVLPLHKGNQKIEISVRPRLITNN
FT                   AQVLVGALRTGKGIGTAQVLLVADELKNGSLIRVLPEYEIEPTEFFLVYPSSKFLRPTV
FT                   RAFVDFAAPALQRVEGIY"
FT   gene            354810..355784
FT                   /locus_tag="Bind_0310"
FT   CDS_pept        354810..355784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0310"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr8188
FT                   putative dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93964"
FT                   /db_xref="GOA:B2IDA7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA7"
FT                   /protein_id="ACB93964.1"
FT                   /translation="MRTMKAERRAFLIGTSGIIFGPALAMMCAPGAMAQSMALRKAPDA
FT                   TLPKGGTSQFVQINGIRLHYVSTGSGPAVILLHGWPQTWFAWRATMERLSSHFTVIAPD
FT                   LRGVGLSERTPTGYDKRTIASDIAALIGHAAGGRAHVVAHDMGGKVAYMLANLHPESVE
FT                   KLVLVDCLIPGTENMDALRGGAWHYGFHMAPEIPEMLTKGRERDYIAAQIRAWSYKKDA
FT                   VSEMAISEFARHYASPGGMTVGFAYYRALRDDAALAASFEGRSIDMPVLAIGGRHGVGT
FT                   KLADALSKQARDLTAVIAEDSGHFVADEMPDFFCDQLKRFLVA"
FT   sig_peptide     354810..354914
FT                   /locus_tag="Bind_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 35"
FT   gene            complement(355939..356919)
FT                   /locus_tag="Bind_0311"
FT   CDS_pept        complement(355939..356919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0311"
FT                   /product="K channel inward rectifier conserved region 2
FT                   domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein ; K channel
FT                   inward rectifier conserved region 2 domain protein; KEGG:
FT                   gdi:GDI2414 putative inward rectifier potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93965"
FT                   /db_xref="GOA:B2IDA8"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA8"
FT                   /protein_id="ACB93965.1"
FT                   /translation="MNKSLHMARETLASANASAKQAHAFLSAKYHKLEAKSHSDVIVTG
FT                   LRDHFWGDLYHHALTISWLAFLGWSILFFLGVNLSFSLLYAMAPQQIANIRPGHFEDFF
FT                   FFSIQTFSTVGYGGMTPVGAYANTIVSLEVFIAIMINSLGTGLIFARFSRPTARVLFSD
FT                   KAVINIFDATQTLNIRIANCRRSVILSMDMEMALSRLIQVGSGRYVRRFDPLPLVQAHS
FT                   PLLRFTTIATHVIDATSPLHNIKLEDLKRDEAEIIITVTGIDEVTSQSIFARTAYNFEK
FT                   VLHGHHFVDIIGMTKDGRLNVDFSRFHHTEDRELPDAVQEQNSAR"
FT   gene            357174..357392
FT                   /locus_tag="Bind_0312"
FT   CDS_pept        357174..357392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93966"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDA9"
FT                   /protein_id="ACB93966.1"
FT                   /translation="MRQPNISHAKRVYIEREPSGNVLHIVTDLMHDSSSPGYAPRAHAE
FT                   MMEAIAREMGYERLNYACYIVHSPDQK"
FT   gene            357643..358053
FT                   /locus_tag="Bind_0313"
FT   CDS_pept        357643..358053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93967"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB0"
FT                   /protein_id="ACB93967.1"
FT                   /translation="MSLLRLLLLALVALSLVSAPGAQAMGWLEGPAMHHEHGIHAHDEK
FT                   AQSETLPAEKSHVLMTAHDHAGAHQASKSCPNEAGKQGWLLCCATSLIMVLHVEEAGTN
FT                   LPFAAPFAHAPHRNEWVEGSAPTPMRRPPRLA"
FT   sig_peptide     357643..357717
FT                   /locus_tag="Bind_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            358441..359901
FT                   /locus_tag="Bind_0314"
FT   CDS_pept        358441..359901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0314"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   xau:Xaut_4826 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93968"
FT                   /db_xref="GOA:B2IDB1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB1"
FT                   /protein_id="ACB93968.1"
FT                   /translation="MTAVQKPPSRSLLAPCLAVGLLLGGCATFSPDGGLSPAREAAASA
FT                   LQGEVTKITDDTQEEGARARVAALLRAPLTPRAAVEIALLRNKGLQAAFNDLGVSEAQF
FT                   VQESLPPPPQFSISRLAGEGDVEVIRQLAVSLFALATLPSRTAIARENFTVAQWRAAEQ
FT                   VLALAASVRRQYYTAVAANAQVAFLQRSVASAEVAADLARKLGEAGNLNTLEQARAGAF
FT                   FAEMGAQLADARIQAQAERERLTRLMGLWGRDIAFKLPETLPALPKGIASAKDIEAKAL
FT                   SERVDLKAGRHELAGLAAQYGLTNATRYVSDITLAYQNDSEWAGNVGGSVLGTEFNNKL
FT                   IRNGFDVSFTIPIYDFGETNVRGARETYMASANRLAQRAIDVRSQAREAYLRYRGKYDL
FT                   ARYYAKNVLPLRKIIVDETALQLNGMIADITQLIVDGQMRITSNNAAITAQRDFFIASV
FT                   DLAAATYGGGFGGGGPSSVATSSTAAAN"
FT   sig_peptide     358441..358542
FT                   /locus_tag="Bind_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.226 at
FT                   residue 34"
FT   gene            359916..361274
FT                   /locus_tag="Bind_0315"
FT   CDS_pept        359916..361274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0315"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 2; multicopper
FT                   oxidase type 3; KEGG: bmu:Bmul_6291 multicopper oxidase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93969"
FT                   /db_xref="GOA:B2IDB2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB2"
FT                   /protein_id="ACB93969.1"
FT                   /translation="MAETKGVSRRHVLGGGGLVLASAAMIGSRAEAASLPEAPIMRETT
FT                   MQPPLHPASGPDYHPVVTLNGWSLPFRMNGDWKEFHLLAEPVVREMAPGMKANLWGYNG
FT                   QSPGPTIEAVEGDKVRIFVTNHLPEATSVHWHGIELPSGMDGVAGLTQPGIPPGKTFAY
FT                   EFVLPRSGTFMYHPHADEMVQMAMGMMGSFVVHPRDPDFRRVDRDFIFLLSTYAVDPGS
FT                   YTPRVNEMTDFSLWTFNSRVFPGIDPLPVRQGDQVRIRIGNLSMTNHPIHIHGTHFRVT
FT                   GTDGGWVDPAASWPEVTVDMAVGQMRAIEFSADNPGDWAMHCHKSHHTMNPMGHQVRTY
FT                   IGVDLKQTAKALRKLAPDYMPMGSTGGGSMAEMEMPLPRNTLPMMTGDGPFGSVEMGGM
FT                   FTTIKIRPDLAPGDYRDPGWYRHPQGTVAYEWRGDAPATPPTMPPRHGGHTKR"
FT   sig_peptide     359916..360014
FT                   /locus_tag="Bind_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.935 at
FT                   residue 33"
FT   gene            361306..361608
FT                   /locus_tag="Bind_0316"
FT   CDS_pept        361306..361608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_p0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93970"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB3"
FT                   /protein_id="ACB93970.1"
FT                   /translation="MSLRLLFTSAAIACLVFAAPASCFAAQLFHGEVRAVDAAQGKITL
FT                   KHEPIRKLDMEEGMTMVYRIKEPSLLQGVVPGEHVLFDAEKVDGRFTVTHLEKAK"
FT   sig_peptide     361306..361383
FT                   /locus_tag="Bind_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            361811..362329
FT                   /locus_tag="Bind_0317"
FT   CDS_pept        361811..362329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:glr3185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93971"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB4"
FT                   /protein_id="ACB93971.1"
FT                   /translation="MNDDKAAKEAAVVDRGETIGLMEPMLVSESSKHRTALTDLAIELA
FT                   SRAAGFRRSLPQGVMTSLSDLVRAMNCYYSNLIEGHDTHPIDIERALKNDYSADAEKRN
FT                   LQLEAKAHIIVQRWIDEGGLKGRRRAKMVSWKSIADFANCFPKICCGQKILTIVNCCKS
FT                   KRVSCASTM"
FT   gene            362710..362949
FT                   /locus_tag="Bind_0318"
FT   CDS_pept        362710..362949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0318"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG: nha:Nham_1233 30S
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93972"
FT                   /db_xref="GOA:B2IDB5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IDB5"
FT                   /protein_id="ACB93972.1"
FT                   /translation="MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGYYEKPSEKRAR
FT                   EKAEAVRRARKLARKKMQREGLLPMKPKPMPGMR"
FT   gene            363146..364051
FT                   /locus_tag="Bind_0319"
FT   CDS_pept        363146..364051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0319"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: mex:Mext_1964
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93973"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB6"
FT                   /protein_id="ACB93973.1"
FT                   /translation="MERFRIRSDMRQNQKCLAARAIAHVGRVRFGLIALSAGALAGCGA
FT                   NGISGMHGTGVAEVANQSPQEASANLASLSDVVSRNPRSSEAYDTRGVAYAKLGKYSEA
FT                   ISDFSQAIKLDPNNAPAYTNRALAYRQSNRNDAALADFNRAIEVNPRHAPAYLGRANLL
FT                   RVQGNLDEAKSDLDQAIKLNPENAQAFHARGLIYQREGNQPQAITDFDNAIDRDPFAGA
FT                   PYLARGQSLIATGKYDKAIEDFNAALHVDNKNPDAWAGLGLAYEKSGNRTKAAESYQRA
FT                   LTFDPSNGLAKEGSSRVGRG"
FT   gene            364293..364835
FT                   /locus_tag="Bind_0320"
FT   CDS_pept        364293..364835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0320"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   swi:Swit_2958 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93974"
FT                   /db_xref="GOA:B2IDB7"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB7"
FT                   /protein_id="ACB93974.1"
FT                   /translation="MAHLTISVEYGIHCLLWLVGSGDTAMSIRELAELQGISPSFLAKI
FT                   FPKLEKAGIVAASEGVRGGYRLGRSPEEISFLDIVDAIEGHKPLFDCQEVRERCALFAG
FT                   KPPEWAMKGVCAIHGVMLQAEKAMRDSLASQTLADVAATFGRKAPDAFLKDVRAWVDDH
FT                   AADRTGRRDKPAKDAPS"
FT   gene            364982..366190
FT                   /locus_tag="Bind_0321"
FT   CDS_pept        364982..366190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0321"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: swi:Swit_2959 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93975"
FT                   /db_xref="GOA:B2IDB8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB8"
FT                   /protein_id="ACB93975.1"
FT                   /translation="MTQKIIIAGSGFAGLWAALAAARAVSLAGKDGEVEVIVVSPTPNV
FT                   TIRPRLYEAALVNMRPDIAPLLDAVGVRHIAGRVEAIDAKSRQITVTTANGARETLAYD
FT                   RFILAAGSQTFRPPVPGLADYGFETDQLASAQKLHTHLKALAGLPETEARNTVVIAGGG
FT                   LTGLETATEMPGRLRASLGPDATLRVIIVDNAEPVGASLGAEALPFIEEALAEDGVETR
FT                   PGARVASIDADGVTLSSGERIATNTVVWTAGMRASPLAAQLPGEHDQLGRVVGDAYLRA
FT                   PEAEGIFVTGDTVKVATDDQGNFNVMSCQHAMSLGRVAGYNAAAELVGLPLHPYSQPKY
FT                   VTCLDLGPWGALYTEGWDRQVRFTRADGKKIKQDINTVWIYPPKPDRDTVFAIANPDYV
FT                   IVP"
FT   sig_peptide     364982..365056
FT                   /locus_tag="Bind_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.360 at
FT                   residue 25"
FT   gene            366384..366788
FT                   /locus_tag="Bind_0322"
FT   CDS_pept        366384..366788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0322"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: swi:Swit_3223 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93976"
FT                   /db_xref="GOA:B2IDC4"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC4"
FT                   /protein_id="ACB93976.1"
FT                   /translation="MAVQLNHTIVWSSDQTMSARFLAEILGRPAPTRFGHFDVVELDNG
FT                   VSLDFADAKGSIHPQHYAFLISDADFDAVLSRIRERGLEYWADPMRHRPGEINHNNGGR
FT                   GVYFPDPDGHFLEVITRPYGSSAAEPVASG"
FT   gene            complement(366749..367003)
FT                   /locus_tag="Bind_0323"
FT   CDS_pept        complement(366749..367003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93977"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC5"
FT                   /protein_id="ACB93977.1"
FT                   /translation="MAVHQSHSDCGVLRPLVVCPHDAASNVRCLIAFPKSGPTGIGLKQ
FT                   TEAVTRRAATGRWHYTDADGAPNLARYQPDATGSAALLP"
FT   gene            complement(367056..367769)
FT                   /locus_tag="Bind_0324"
FT   CDS_pept        complement(367056..367769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0324"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   xau:Xaut_3409 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93978"
FT                   /db_xref="GOA:B2IDC6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC6"
FT                   /protein_id="ACB93978.1"
FT                   /translation="MIMDGEIANASERDDVALLGLRSELLNRRSFLFGSAVSLGALGLA
FT                   GCATTDDAMIRAEAAKLYGPVPDKKFPIPAVDVAKIDPKYYRRTVRYDTHEAPGTIIID
FT                   PGNYYVYRIEGDGNATRYGANVGRKGFLWSGEAYVGRKGEWATWTPPKEMIERQPEARK
FT                   YAGGMPGGLDNPLGARTLYLYQKGVYTLYTIYSTSDPESIGTGVTSGCTGLLTQDMLDL
FT                   YSRTPVNTKVIVLPA"
FT   gene            368129..368392
FT                   /locus_tag="Bind_0325"
FT   CDS_pept        368129..368392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0325"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   mag:amb1606 glutaredoxin and related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93979"
FT                   /db_xref="GOA:B2IDC7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC7"
FT                   /protein_id="ACB93979.1"
FT                   /translation="MAEIEIYTTPTCDYCASAKKLFAKKGVTYTEIDVSGSKDLRKAMT
FT                   KRANGGDTVPQIFIDGKHIGGYDDMYALDRKGLLDPMLGKTA"
FT   gene            complement(368770..369747)
FT                   /locus_tag="Bind_0326"
FT   CDS_pept        complement(368770..369747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0326"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gdi:GDI2784 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93980"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC8"
FT                   /protein_id="ACB93980.1"
FT                   /translation="MADSFGATSTTDDVLAGVSLHGRRVLVTGVSAGLGVETARVLAAH
FT                   GAHVVGAARDLQKAEAATTQVRTDAAKGGGTFEIVELDLADLASVRACADALNTRLAPF
FT                   DLVIANAGVMATPFGHTKDGFETQFGTNHLGHFMLINRIAGSMKDGARLVNLASSGHRF
FT                   SDVNLDDPNFEHTPYEPFAAYGRSKTANILFAVAFDRRHRERGVRATAVHPGGIRTELA
FT                   RHMPPGQLEAMVAQINEQAAANGKPPLEFKTIPQGAATSVWAGVVAKADAVGGHYCENC
FT                   HVSHIVPDDQPIGLLDEGVRAYALDPQHAEALWAKSEAMTGETF"
FT   gene            369815..370450
FT                   /locus_tag="Bind_0327"
FT   CDS_pept        369815..370450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0327"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gdi:GDI2783
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93981"
FT                   /db_xref="GOA:B2IDC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC9"
FT                   /protein_id="ACB93981.1"
FT                   /translation="MLRLLICGGFLRLTRGRRLAEEKTSHRRPRRDGLLNREKLIEVAK
FT                   SAFRAGEADIRFDDIARRAGVGIGTLYRHFPNRDALIEAVYRAELDRLAQAAKRLAETY
FT                   PPVEALREWMLLFVDYIAAKQLIAPALNSLVSDCSSALYAASGEVIKTAIHDLVGRAVQ
FT                   NGDVRSDLEPLDLLRALVGVSNVAADPGWEASAKRLVDILIAGSRPVV"
FT   gene            370561..371913
FT                   /locus_tag="Bind_0328"
FT   CDS_pept        370561..371913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0328"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_0557 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93982"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD0"
FT                   /protein_id="ACB93982.1"
FT                   /translation="MIGPRQVEQGVLFYNFSLDVHVPPDHLLRAIDRFVDLSDLRQELA
FT                   PFYSATGRPSVDPELMMRMLIIGYCCGIRSERRLCEEVHLNLAYRWFCRLGLEGRVPDH
FT                   STFSKNRHGRFRECDLLRRLFETVLQRCIEEGLVGGEGFAIDGSLIKADASRQTCVPGA
FT                   EGLPADTMSRAVEEYLTVLDDAAFGAATSVKPKFISPADPAARWTGAQGGPAYFAYTVN
FT                   YLIDTDHAIIVDVEPTTAIRQAEVTAAKRMIERTMARFELYPESLAGDTGYGSGEMLGW
FT                   LVYEQGIEPHIPVFDKSTRTDGTFSRGDFVYDHEGDVYFCPAGKMLTSKGTLVNDGATL
FT                   LYLASKYDCDECALKSRCCPNTPARKVPRSIYEGARDMARDILQSKEGRTSQRLRKKVE
FT                   MLFAHLKRILHLDRLRLRGPNGARDEFHLAATAQNLRKLAKLIPIPQPKPV"
FT   gene            complement(372248..375550)
FT                   /locus_tag="Bind_0329"
FT   CDS_pept        complement(372248..375550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0329"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dsy:DSY3421
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93983"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD1"
FT                   /protein_id="ACB93983.1"
FT                   /translation="MPQDTDQRILTVLEQALNPQIDFLRERLRVGYAKEAENGLRKMLA
FT                   TLPGEASPYVIFRIKANIGNCLAQLGDISGALGWFDEAVETAPREPKAIATRAFALILR
FT                   KELKEAITFAQTELALDPNNEELAARLIDACISLDDGTDPEQMIPAGLKHREQVLLARC
FT                   LHALQRDQQERWWSLARLGAQTYPESHFFKVLATEADVDEIARATRHEKYRALTDVERG
FT                   KIQSSADVLEGIWLRIKGSEVPNREDGLSALTTCSVAYRLLEDGPKAIELAGELVDRSD
FT                   YEPALILAVQIALIFNDNELVSRGLAKLPSQGAAGFFKGVFEFNKGNWSEAAQILREAE
FT                   IPDIEKPFVAHILTLASLGISQDQGDEIVLDKARQEAVTEPRALIVIAKLAHRHGFGEV
FT                   ASRAYSDAVSLLGPKTSHPARITIASYAHSLGDYGIVISALDGHLDLGAITPELLQLSD
FT                   AHALERPTRQRNMKFYERLTPAVRSHLRIVRGYASILTDRRRYSEAEAVLKKAIEAFPK
FT                   DAYLLLKLIEIYRRTDRDEEIRKFIIERDETTFVGPPLYAMQWSHQLRDAGEFSRALSL
FT                   AYQTLQAHPDDPQLALGYVGLILGDNSQMIIPNQTNVGQDCWVMIKDDLGRTDSFIIGH
FT                   GPAILGIEVVSIHQERAKRLVGKKVNDSFETSDLGGQQRAWTIKEIKSKYLHVLHTVMQ
FT                   SFQTRFPSTPGLWGFTTVEGDIQPILDMVKAHADSQRKVVEELYLKGLPLAIMARSIGM
FT                   DVTRFAYFIRSLGLDIVTANGTSAEFDKGISTAKDYRNAGAVLDEYTAIVAAEVSSLPL
FT                   LKSWFGTLSVPASVIDELDAGITRAKADLGRTQLSLGFVRGEFVRHDINDEFLEQQINA
FT                   LKSVKQKIEDHCVIEPVTFPDTIPEEIADLYRMTGQRVLEPMYLAASRGDVLLSDDLHY
FT                   RQIAAVLTRVDGTWLQAVVLAAQSQGLVTPKDQTNITVGLAVRRHGNIWLNPQSLAMYF
FT                   DESTAEGFAALCHFIGNIGADMPGHTVVTARFLKILWLTRKATLERDARTSCILSALLR
FT                   HRADDWAYWIAYIWIHGDYYLKKYILAWLRGHFLPTQPFEDALNYWLVKVLS"
FT   gene            complement(375724..376209)
FT                   /locus_tag="Bind_0330"
FT   CDS_pept        complement(375724..376209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93984"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD2"
FT                   /protein_id="ACB93984.1"
FT                   /translation="MDFSLLLPAMIAGASTLAPKIGEIIGTEVIKEATKDAYESLKGAL
FT                   ITVCGRKVQRAAERLEEDASSQDAQNELASAIADIPPEDADEISQKLATLLTAVKEDKA
FT                   ALKAADTIASIKLNIDSGGHVKIDVIKGVQTIDVKSKSAGDFSFTNVDMKDGKPSGN"
FT   gene            complement(376501..377355)
FT                   /locus_tag="Bind_0331"
FT   CDS_pept        complement(376501..377355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0331"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   xau:Xaut_0052 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93985"
FT                   /db_xref="GOA:B2IDD3"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD3"
FT                   /protein_id="ACB93985.1"
FT                   /translation="MLEAEGPAPGRQSNGLMAGKRGLIMGVANDHSIAWGIAKALAAQG
FT                   AELAFTHQGESLGKRVRPLAEKLGSSLVLPCDVEDLASVDAVFASLQAHWTHLDFLVHA
FT                   IAYSDRNELKGRYADTTRENFTKTMLISAFSFTEVAKRAAVLMPKGGSMLTLTFGGATR
FT                   VMPNYNVMGVAKAALEASVRYLAADYGPQQIRVNAISAGPVRTLAGAGIADARFMFNFE
FT                   KKNAPLRRTVTIEDIGGSALYLLSDLASGTTGEVHFVDAGYNIISMPHPQDAQESDASD
FT                   AKA"
FT   gene            complement(377348..378571)
FT                   /locus_tag="Bind_0332"
FT   CDS_pept        complement(377348..378571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0332"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: xau:Xaut_0053
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93986"
FT                   /db_xref="GOA:B2IDD4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD4"
FT                   /protein_id="ACB93986.1"
FT                   /translation="MRRVVVTGMGIVSSIGNTSQEVLASLREAKSGIVRAERYAELGFR
FT                   SQVHGAPTLDPSAMLDRRAMRFHAGGTAWNHVAMDQAILDAGLEPSDVSNPRTGIIMGS
FT                   GGPSTRTIVESADITRDKGPKKVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYEMIRYGKQDVMFAGGCEELDWTLSVLFDAMGAMAAAYNDRPAVASRAYDK
FT                   NRDGFVIAGGAGVLVLEDLERAKARGAKIYGEIVGYGLTSDGHDMVAPSGEGAVRCMRM
FT                   ALEDVNIPIDYINPHATSTGVGDLKEIEAIREVFGAGDKSPPIAATKSLTGHSLGATGV
FT                   QEAIYSLLMMQNGFICESANIEELDPAFADMDIVRHRRDNVSLRAVLSNSFGFGGTNAT
FT                   LVFKHVDA"
FT   gene            complement(378669..379208)
FT                   /locus_tag="Bind_0333"
FT   CDS_pept        complement(378669..379208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0333"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: azc:AZC_4642
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase;
FT                   TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93987"
FT                   /db_xref="GOA:B2IDD5"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD5"
FT                   /protein_id="ACB93987.1"
FT                   /translation="MGENTSERRSSFEYEDLLACARGELFGPGNPQLPLPPMLMFDRIA
FT                   TISEEGGANGKGVIRAEFAIRPDLWFFDCHFKNDPVMPGCLGLDALWQLLGFYLGWLGL
FT                   PGRGRALGVGEVKFSDQVLPSVKRVIYGVDLKRVFKTKLVLGIADGWLEADGTRIYEAK
FT                   DLKVGLFRAEPAAAPA"
FT   gene            379626..380591
FT                   /locus_tag="Bind_0334"
FT   CDS_pept        379626..380591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0334"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bra:BRADO5022 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93988"
FT                   /db_xref="GOA:B2IDD6"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD6"
FT                   /protein_id="ACB93988.1"
FT                   /translation="MSLRQKFLNILLAGLLAFGLAGEAYARAGGGGSFGSRGGRTFSAP
FT                   SMTQTAPRGASPFERSMTSPNQGIFRPGMGAGMGARPGFFSGGFGRGLLGGFLGAGLFG
FT                   LLFGHGLFGGLGSGMSFLGLLVQIGLLFLLFKLVMGFLRNRQQPAYQGADQGGQAPGNQ
FT                   PQGGNFGFGGGPGPGRAGVNDQPLPIETADYTAFEQKLAAIQSSFSNEDLNGLRLLTTP
FT                   EMASYFAEEIAGNATKGFVNKISDVKLLQGDVAEAWREANGEYATVAMRFSLTDRMIER
FT                   ASGRIVSGGTPEQVTEIWTFFRPLGATPADWKLAAIQQQG"
FT   sig_peptide     379626..379706
FT                   /locus_tag="Bind_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.824 at
FT                   residue 27"
FT   gene            complement(380797..381672)
FT                   /locus_tag="Bind_0335"
FT   CDS_pept        complement(380797..381672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0335"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: mlo:mlr0116 integral membrane lipid
FT                   kinase-like protein; TIGRFAM: undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93989"
FT                   /db_xref="GOA:B2IDD7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD7"
FT                   /protein_id="ACB93989.1"
FT                   /translation="MASACTQGLDTGFVALGYAKVAFLGVVQGLTELLPISSTAHMRIV
FT                   PALLGWQDPGSAFSAAMQLAALAAVISYFWSDVRGLLFGSIGAVRRRDFRDWNFRFAVW
FT                   IVLATVPIMVAGVLLSPFLNACNSPLRTLTVIGLSCVVMGALLAVAEYYARHKRTLDQV
FT                   TLKDALIVGCAQVGALIPGVSRSGSTLTAALFRDLKREEAARFSFLLGLPAIAAAGFKE
FT                   LWELHKAHLDAQGWSMLAVGLIVASLSAFVAIWSLMHILERYSAWPFVIYRFLLGIVLL
FT                   VSVAVGFLPN"
FT   gene            complement(381746..381934)
FT                   /locus_tag="Bind_0336"
FT   CDS_pept        complement(381746..381934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93990"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDD8"
FT                   /protein_id="ACB93990.1"
FT                   /translation="MIVGPLLNFRYHFEKAKIQERNQRSFFTTFGMNMLPIRIFSQKNA
FT                   FYSCYKDRKQPSRSSFR"
FT   gene            complement(382025..382630)
FT                   /locus_tag="Bind_0337"
FT   CDS_pept        complement(382025..382630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0337"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: smd:Smed_0012
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93991"
FT                   /db_xref="GOA:B2IDD9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IDD9"
FT                   /protein_id="ACB93991.1"
FT                   /translation="MTDSTNNQGTSGRPDDDHTTEEVASVFNDPGAQAPAGEPDPFVVL
FT                   ENLQLENAGLKDKVLRTYADMENLRRRSEKEVADAKLYGVTSFARDMLTFADNLHRAIE
FT                   SLPAEAKQAVDGPLKTFVEGIELTERDFLSRLAKYGVKKIEPLGNKFDPNLHEALFEIP
FT                   DESVVSGTVKQVVEDGYVIGERVLRPAKVGVSRGGPKA"
FT   gene            complement(382804..383640)
FT                   /locus_tag="Bind_0338"
FT   CDS_pept        complement(382804..383640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0338"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: xau:Xaut_0977 putative transmembrane
FT                   anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93992"
FT                   /db_xref="GOA:B2IDE0"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE0"
FT                   /protein_id="ACB93992.1"
FT                   /translation="MNKLETRSNPPPCAEWVLPLHAYVDGQMDAIHAASCESHLTQCKG
FT                   CAAQVKKLEDIRTALDRDEVRWPMPEALQARVLAAIEQQQGSAEGQSLPATALVPRRSF
FT                   WREGLDFIGRWSLVPSSAVLALGLLLLLMPAKFTDSLPQELVASHVRSLLADHLTDVAT
FT                   SDQHTVKPWFTGKLDFAPPVEDLSSQGFPLVGGRIDYVMDRIVAALIFRRHNHVINLFI
FT                   WPTEGSAPPATAPSFTTREGYHLLHWTASGLAFWAVSDLNSAELSTFQQIFQAAAQ"
FT   gene            complement(383637..384380)
FT                   /locus_tag="Bind_0339"
FT   CDS_pept        complement(383637..384380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0339"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   xau:Xaut_0976 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93993"
FT                   /db_xref="GOA:B2IDE1"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE1"
FT                   /protein_id="ACB93993.1"
FT                   /translation="MMSVSMQSWPRPDPFWMVAGYAEGTGSFLPSLFSRVLALRRALAS
FT                   LSLSSAKDNAQCNARLDGATLIRFQQIILPHLDAAHNLARFLSRDADAAQDIVQDSVLR
FT                   ALNGFDKFRGDSPKAWLLTIVRNCHNDWRTKGRREPSTDQRRSFSQEIMSEEEDRFDPA
FT                   DLAIECETPETALLQRTEAERIRLILDALPEPFREILILRELEDLSYHEIALTIDLPIG
FT                   TVMSRLARARKVFADHWRDQEMDRP"
FT   gene            complement(384474..384866)
FT                   /locus_tag="Bind_0340"
FT   CDS_pept        complement(384474..384866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0340"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   xau:Xaut_0975 blue (type 1) copper domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93994"
FT                   /db_xref="GOA:B2IDE2"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE2"
FT                   /protein_id="ACB93994.1"
FT                   /translation="MTTLSFSRARLLLPALALAFAMTMPGLTAIAAPDTTKDPVKDAAA
FT                   NQAVTVVIDNFTFTPATVTVTPGTTVTFVNHDDIPHTVVETKHLFRSKVLDSDDTFSFT
FT                   FDKDGVYDFFCSLHPHMTGKIVVETR"
FT   sig_peptide     complement(384771..384866)
FT                   /locus_tag="Bind_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 32"
FT   gene            complement(384893..385900)
FT                   /locus_tag="Bind_0341"
FT   CDS_pept        complement(384893..385900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0341"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: xau:Xaut_0974
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93995"
FT                   /db_xref="GOA:B2IDE3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE3"
FT                   /protein_id="ACB93995.1"
FT                   /translation="MPNVGEMDLAQQSSREDKDEVHQEKQGLDRRGFLNCMKWAGTGVL
FT                   WSLSGGLPHSMKLDKAFAAEQKVEPFTFIQISDSHIGFDKPANPNALATLREAIDQIKA
FT                   LPHKPAFMIHTGDITHLSKDKEFDDADQILKEAGLPIFTVPGEHDLLDDSQGKAYLDRY
FT                   GRGPLVKALGAGWYSFDQKGIHYIALVNVTDLKAGGLGNLGAEQLAWLAADVALLSSST
FT                   PIVVFAHIPLWTVYAEWGWGTEDGAKALETLKRFGSVTVLNGHIHQIMQKVEGHVAFHT
FT                   ARSTAFPQPVPGTAPSPGPMKVPPGDLRKYLGIATIDVIHGGEPLAIIDRPLAG"
FT   gene            complement(386230..386607)
FT                   /locus_tag="Bind_0342"
FT   CDS_pept        complement(386230..386607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93996"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE4"
FT                   /protein_id="ACB93996.1"
FT                   /translation="MAEFTKLEHAVFASICEAQTEISDALRTLLLNVRITQRDNTGHGF
FT                   YTSFEVDRSHPPIQFPKRWIDWPDAEVMVGNRVLLMGFILWLEDGYPKCLEGFQYGTKS
FT                   GESIDLHREDLGALMLLGPIL"
FT   gene            386806..387963
FT                   /locus_tag="Bind_0343"
FT   CDS_pept        386806..387963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93997"
FT                   /db_xref="GOA:B2IDE5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE5"
FT                   /protein_id="ACB93997.1"
FT                   /translation="MSLPVREFRVRGYRSLKSITYPISGLDIFVGANGIGKTNLYHALE
FT                   LIRSAAANTLARDLVKEGGLQSALWAGPRHRSEPARIRLAVGLSDPARQRSGAIIYRYE
FT                   VAVGFPPPTSAAFLAEPQVKEEILTYRRGAKPLRLIDRNGSSVMARGEDGRPLQIDIDL
FT                   LPSETVLGRLEDPSRYPEMDALRRTFLQWRFYHGIRTDVASPLRQPCAAVATPSLASDG
FT                   SDLAAVFATLAHIRQDTADLDAAVDQAFPGARLIVPHPDRMARFGMTFPEFPQRVFEAN
FT                   ELSDGTLRFLALAGALLAYRLPPFIALNEPEASLHPDLMQPLARLIVQAAERTQVWLVT
FT                   HSTRLADAIAATGAGKVRSVMRQDGATQIEGLKGWGTFEDEDEDE"
FT   gene            complement(388461..389162)
FT                   /locus_tag="Bind_0344"
FT   CDS_pept        complement(388461..389162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0344"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mex:Mext_0824 response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93998"
FT                   /db_xref="GOA:B2IDE6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE6"
FT                   /protein_id="ACB93998.1"
FT                   /translation="MRVLLIEDDSATAQSVELMLKSENFNVYTTDLGEEGIDLGKLYDY
FT                   DIILLDLNLPDMSGYEVLRTLRVAKVKTPILILSGLAGIEDKVKGLGFGADDYLTKPFH
FT                   KDELVARIHAIVRRSKGHAQSVIMTGDLIVNLDQKTVEICGARVHLTGKEYQMLELLSL
FT                   RKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLANASQGRNYIETVWGRGYVLR
FT                   EPNDEEERITA"
FT   gene            complement(389585..390331)
FT                   /locus_tag="Bind_0345"
FT   CDS_pept        complement(389585..390331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0345"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   azc:AZC_0510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB93999"
FT                   /db_xref="GOA:B2IDE7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IDE7"
FT                   /protein_id="ACB93999.1"
FT                   /translation="MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKLGLPDPAM
FT                   NARLRAAVLAARAENMPKDNIERAIKKASAADGENYDEVRYEGYAPGGVALIVEALTDN
FT                   RNRTAGEVRSYFTKSGGSLAETGAVSFMFDHVGLIEFPASVASEEAMLEAAIEAGAEDV
FT                   QSNEETHEIITSLESLRDVAQALETKFGEPRKASLIWKAQNAIAVDDEAGEKILRLVNL
FT                   LEENDDVQNVYANFEVSDTLLAKLGD"
FT   gene            complement(390458..391153)
FT                   /locus_tag="Bind_0346"
FT   CDS_pept        complement(390458..391153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0346"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpt:Bpet2488 putative glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94000"
FT                   /db_xref="GOA:B2IDE8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE8"
FT                   /protein_id="ACB94000.1"
FT                   /translation="MIDLYYWTTPNGHKITLFLEEAELPYRIHPVNIGKGEQFEPAFLA
FT                   ISPNNRIPAIVDQAPVDGGAPVSVFESGAILLYLAEKTGKFIGSDLRGRVATLEWLFWQ
FT                   MGGLGPMAGQNHHFSQYAPEKIPYAITRYVNETNRLYGVMNKRLADHAFLAGDHYSIAD
FT                   MAAYPWIVPYERQGQKLSDFPHLQRWFDAIATRPATLRAYAKAEDINKVPSVNDEESRR
FT                   ILFGQTARQ"
FT   gene            complement(391322..392221)
FT                   /locus_tag="Bind_0347"
FT   CDS_pept        complement(391322..392221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0347"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: rpe:RPE_0818 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94001"
FT                   /db_xref="GOA:B2IDE9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDE9"
FT                   /protein_id="ACB94001.1"
FT                   /translation="MATALPMISGESGLTRYLNEIRRFPMLEPQEEYMLAKRWREHEDP
FT                   DAAQRLVTSHLRLVAKIAMGYRGYGLPIGEVVSEGNVGLMQAVKRFEPDKGFRLATYAM
FT                   WWIRASIQEYILRSWSLVKMGTTASQKKLFFNLRKAKSQISALDEGDLRPDQVALIATR
FT                   LGVTGQEVIDMNRRMSGDASLNAPLREEGEGEWQDWLVDDQANQEHVLADQEESANRLG
FT                   ALRQALDVLNPRERRIFEARRLADDPVTLEALSDEFDISRERVRQIEVRAFEKVQAAVK
FT                   AGVARIEASLALPAPAAA"
FT   gene            complement(393029..394069)
FT                   /locus_tag="Bind_0348"
FT   CDS_pept        complement(393029..394069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0348"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: xau:Xaut_1985 pseudouridine synthase, RluA
FT                   family; TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94002"
FT                   /db_xref="GOA:B2IDF0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF0"
FT                   /protein_id="ACB94002.1"
FT                   /translation="MVETTPTPPTDEALLIRCVVGAEEAGQRLDRFLAERTETGAAFLS
FT                   RMRIKTLIEQGHVSVDGEARLTASASVRAGQIIELAVPPAKEAVPVAQDLPLNIVYEDA
FT                   GLVVLDKPAGLVVHPAAGHAQGTLVNALMAHCGESLSGIGGVKRPGIVHRLDKDTSGLL
FT                   VAAKTDAVHQGLARLFADHGQNLHLVREYLAFVWGVPARQSGRIEAALGRHAQDRERQA
FT                   VVSEDVGRHAVTHWEVLEVFQRKGKPVASLIACQLETGRTHQIRVHMAHIGHPLLGDPL
FT                   YGKGFKSKSAILSPPAQEALRQLGRQALHAAQLGFEHPITGEEMLFESALPADLAALLN
FT                   TLRSGE"
FT   gene            394223..396025
FT                   /locus_tag="Bind_0349"
FT   CDS_pept        394223..396025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0349"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: azc:AZC_1003
FT                   putative beta-1,2-glucan ABC export system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94003"
FT                   /db_xref="GOA:B2IDF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017902"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF1"
FT                   /protein_id="ACB94003.1"
FT                   /translation="MSILSTYWRVLQFLGGERRLALILAFANLALAAAQFAEPVLFGRI
FT                   IDRLSSTEGAGRFPTFQELLPLIGAWVGFGLFSILAAVLVALHSDRLAHRRRMAVTGLY
FT                   FEHVLNLPLSFHASVHSGRLLKTMLDGSSGMFGLWLSFFRENCASLAALVFLLPLSLFL
FT                   NWRLGSLLIVLLVLFGCLIAFVLHRTHALQQSVEQYNSSLAEQASDALGNISVIQSFTR
FT                   IELEANALRQIIDHVLAAQMPVLNWWAVAAVGARASATLALLGIFLLGTWLNLRGLATI
FT                   GQIVTFMNLATMLIARLEQVIGFFNTLFLQAPKMQDFFKVLDTVPRVADSPKAIDPSRL
FT                   HGRVSFENVSFSYDGRKPAVSHLAFEVAAGETVALVGATGSGKSTTLGLLHRVFDPQEG
FT                   RVTIDGLDIRTMSLQGLRRNIGVVFQEPMLFARSIEENLRVGKPDATPAEIALALERSQ
FT                   AADFVARQENGLATIVGERGRSLSGGERQRLAIARALLKDPPIMILDEATSALDATTER
FT                   QLQEALETATKGRTTFIIAHRLATIREAKRIFVFDHGHIVETGSFDELVALGGRFATLA
FT                   KAQFMVGARPEDPETGGKPPKPSP"
FT   sig_peptide     394223..394336
FT                   /locus_tag="Bind_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.762 at
FT                   residue 38"
FT   gene            396270..396923
FT                   /locus_tag="Bind_0350"
FT   CDS_pept        396270..396923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0350"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   xau:Xaut_0103 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94004"
FT                   /db_xref="GOA:B2IDF2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF2"
FT                   /protein_id="ACB94004.1"
FT                   /translation="MASDDPSKPTITKADDLTVGGCAGSQIAANQGLYGAFIMRAKKVD
FT                   KIEPPPPVAAQPAPPSGDVYVICDRRDIRDRMGKSFPLMRLWDDGKLRPWDIFISRFGK
FT                   QYFAYENSCPHQNVRLDWEKNNFYEPNYLKVLMCGKHGAQFDPETGVCISGPCEGKRLT
FT                   QILCFLDGDDVCITGVNINLDVEVEATVATDPNADAVLENNGFKLQQTKREFFK"
FT   gene            complement(397055..398236)
FT                   /locus_tag="Bind_0351"
FT   CDS_pept        complement(397055..398236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0351"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ava:Ava_1119 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94005"
FT                   /db_xref="GOA:B2IDF3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF3"
FT                   /protein_id="ACB94005.1"
FT                   /translation="MNKPEFLPHKTIAPRLTELPLVSVIIVNYNYGRFLWQAVTSVFQQ
FT                   TYSNFECIIIDNASADESADVLTRIEETYPDTIIIRRKENSGQSSASIEGYAASSGEYI
FT                   VFLDADDCLLPDCLSTHIFVHLSLRIPVGFSSGDMLQSVGQRLVLGTVTGISDYIRSGK
FT                   GRTECLLRRIDYASGNIWPLPSPDDDFEADVHFVPPENVTSWAWAPTSGNCFRRDALQL
FT                   FLGNKRLQDLRSCTDAYLLRGIGSLMGSVLIDRAIAIYRLHGQNVFSKSPQLNGILIYE
FT                   RGTPSDNDLFARRLLIDYFIDNAALFMRKLPAQQTFLHVLKRLDAIDPKLPPAIPGCHS
FT                   YLASKLVLSFNPIAQAIGTRSLIMTLLSMRVPPSVIIRAYCKHWPARLMKQVN"
FT   gene            complement(398768..399910)
FT                   /locus_tag="Bind_0352"
FT   CDS_pept        complement(398768..399910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0352"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ava:Ava_1119 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94006"
FT                   /db_xref="GOA:B2IDF4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF4"
FT                   /protein_id="ACB94006.1"
FT                   /translation="MSFQLQPPLVSLIILNYNYGRFLRDAIASAQRQTYLHKECIIVDD
FT                   ASTDDSHEILDQAQHDWPDLQILKLNINSGQSAAALAGLARAKGDYILFLDADDILFPE
FT                   CVAHHLSVHMSSRRAVGFSCCDAMQIVGERMVIARNGNISASFLRLPMDMALISDSAVT
FT                   QLASHGIYLPATTPEMVRYIPPNHGGWPWSTTSSMFFRKEALDLIRDASGLHGLRIATD
FT                   NYLAHAINFLTGSLILNEQLVGYRLHGGNGFNKRPALDGFICHNRIDEHFDKTCRVFLD
FT                   DLMTRYAHYSAFMDVPERILEICLKVDVPDTEPGLPYWAARSRFAHLLMERYHELEPFV
FT                   GRTKMQEWMRRANIPIWIRKRCEPRASPQKWRPLLSLRRR"
FT   gene            complement(399939..400949)
FT                   /locus_tag="Bind_0353"
FT   CDS_pept        complement(399939..400949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0865 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94007"
FT                   /db_xref="GOA:B2IDF5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF5"
FT                   /protein_id="ACB94007.1"
FT                   /translation="MWDIFPHNLDVPQEHRMTHSLPVDDLRERALSQMRSPYEMKIICI
FT                   DITNKCDLACSNCTRLLENQDMHWEMTLENFRLAVRSLADYPGIVAIIGGNPVMHRNFT
FT                   EICEIFVEELPRKEQRGLWTNNVFKHSELAKEVFGIFNLNPHGVERGIKSLADLKDLGW
FT                   YHEGHSSHSPLLTAGKDLFDEEDMWERIAHCDVNQDWSASIVQNNGQLRAYFCEVAASF
FT                   DLARGTDHGIEPVPGWWRRSVSDFKDQVAHFCPGCGVPARLEGSMDFEKVDTYTSSNAD
FT                   LALKSLKKNRKIIELTSDQISKGIDHKVTQYSKNLRGIVDTKPTLMDRIRSMFGY"
FT   gene            complement(401158..402939)
FT                   /locus_tag="Bind_0354"
FT   CDS_pept        complement(401158..402939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0354"
FT                   /product="Shikimate kinase., 3-dehydroquinate synthase"
FT                   /EC_number="2.7.1.71"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: shikimate kinase; 3-dehydroquinate synthase;
FT                   KEGG: mex:Mext_1641 shikimate kinase, 3-dehydroquinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94008"
FT                   /db_xref="GOA:B2IDF6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF6"
FT                   /protein_id="ACB94008.1"
FT                   /translation="MSDGVNSISPPQQEYAPDDRRAHSIISSLGSRSLVLVGLMGSGKT
FT                   STGRRLAQRLGLPFVDADVEIESAAGMTISEIFARHGEDYFRDGERRVMARLLADGPKI
FT                   LATGGGAFMNEETRSRIAEKGVSIWLKADPDVLWRRVKKRPHRPLLQTREPEKTLHRLM
FT                   EQRYPIYARADIAVESRDGPHDAVVEDILTALEFFLRFSPNPPLPPPGTLNPSFLGQDS
FT                   ALTELVPVELGARAYEIHIGPDLIARAGSLIAALAPKAACAVITDDNVAREHLPRLEQA
FT                   LAQQGIRYETIKVRPGEGSKSFPVYAEVCDAVIAGKFERQDLILALGGGIVGDLAGFVA
FT                   ATVRRGMRFVQLPTTLLSQVDSSVGGKTGINSPHGKNLVGAFHQPSLVLADTTALETLP
FT                   KREFRAGYAEVVKYGLINDPDFFFWLDMHWPNVFQGGADRVHAIATSCRAKAAIVKRDE
FT                   LETGERALLNLGHTFGHAFEALTHFDNARLVHGEGVAIGMACAFRFSVKRGHCSPEDAA
FT                   RVDNHLRMVGLPTRIRDIKDFDADATAILAAMYQDKKVERGTLTFILARAIGHCFIEKK
FT                   IEGEEVKAFLEEELMLS"
FT   gene            complement(403024..403503)
FT                   /locus_tag="Bind_0355"
FT   CDS_pept        complement(403024..403503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0355"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: xau:Xaut_3765 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94009"
FT                   /db_xref="GOA:B2IDF7"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF7"
FT                   /protein_id="ACB94009.1"
FT                   /translation="MKGDEKVLDYLNRSLRSELTSINQYWLHFRVLNNWGFKDLAKKWR
FT                   EESIEEMQHADRFVDRILFLDGFANLQVLDPLKIGQTVEEIIACDLASELEARALYLEA
FT                   AEYCASVHDRVSKELYDSLLIDEEKHIDFLETQQELIRQLGVQLYSQKHIGELKD"
FT   gene            complement(403801..404094)
FT                   /locus_tag="Bind_0356"
FT   CDS_pept        complement(403801..404094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94010"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF8"
FT                   /protein_id="ACB94010.1"
FT                   /translation="MIVCSCNVLTDTKIRATLDSGTCPRTPGALYKCLGCNPNCRRCFA
FT                   TVRKLINEALGKAETQDLSPCTASCSVSEMAGDLTCAVAPDRDAILDETSSV"
FT   gene            404866..406482
FT                   /locus_tag="Bind_0357"
FT   CDS_pept        404866..406482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0357"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: mex:Mext_1220 serine-type
FT                   D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94011"
FT                   /db_xref="GOA:B2IDF9"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDF9"
FT                   /protein_id="ACB94011.1"
FT                   /translation="MSPFTPGPQSGLHRKGLRGHGTERPRRSLWQRFRLHRFSSRLLHG
FT                   GLAIAAVATTTLTDTAQAAPGLVIDLASGNVIYQSEATRPWYPASLTKLMTLYVALQAV
FT                   RDHRIGFDTPLVVSARAHAMPPSKMGFKPGTQVTLGNALKMLMVKSANDIAITVAEGIA
FT                   GSVEAFAEDMNAQAADLGLRQSHFVNPNGLHNEQHYSSARDMALLARALYLRFPQYASL
FT                   YNIGALRLGNQIIQNHNNLLGRYPGVDGMKTGYTCTAGFNIVASAEQSGRRVIVVVLGS
FT                   PNVETRTIKAAALFDRAFSNIDHAFVTLDNLPVPPDMLPSPYDVCRNRAQVMAEANAEI
FT                   DTLMTPLQAGAFTPQPERAFLFDADALGRAVPVASRITLVPRPVFDPQPVSVGPVAGYS
FT                   GPVAQARAPHTPIGSAPLPELASAYAPKAAARPLPLMPDLDAVPLKQTQTPIKPAVVLK
FT                   PAPVAHRMAHHAPVSPPPAHAAATVKPPVVKAKVVSVKPVVLLKTAAPLPPKTAEKPKT
FT                   AGKPAAKVSAKTATTEKTAVH"
FT   gene            406828..407607
FT                   /locus_tag="Bind_0358"
FT   CDS_pept        406828..407607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0358"
FT                   /product="acetoin reductase"
FT                   /note="TIGRFAM: acetoin reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   ilo:IL0792 acetoin(diacetyl) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94012"
FT                   /db_xref="GOA:B2IDG0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG0"
FT                   /protein_id="ACB94012.1"
FT                   /translation="MSLEGKVALVTGGGQGIGRGIALRLAQEGANIAIADVKADKAKAV
FT                   AEEIMALGRKATIFIADISDRAQIHAAIDHTEATLGGFDIIVNNAGIAQVQPILDVTQE
FT                   EVDRILKINLEGVLWGIQAAAKKFKATGRKGKIINASSIAGHDGFALLGVYSATKFGVR
FT                   ALTQAAAKELAPFGITVNAYCPGIVGTDMWVEIDKRMAEVTGAEVGATYQKYVGGIALG
FT                   RAETPDDVAALVAFLAGADSDYITGQAIITDGGIVYR"
FT   gene            407714..408877
FT                   /locus_tag="Bind_0359"
FT   CDS_pept        407714..408877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0359"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: mex:Mext_1219
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94013"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG1"
FT                   /protein_id="ACB94013.1"
FT                   /translation="MSESQRRPPPPIPLSILTGFLGSGKTTLLNKLLRDPALADTLVII
FT                   NEFGEIGLDHLLVEKVDGDLLVMSSGCLCCSIRGDLVSTLEDLLRRRDNDRIQPFQRVM
FT                   IETTGLADPAPVLHTIMYHPYLMLRFRLDGVITTVDAVNGNATLDAHAEAVKQVAVADR
FT                   LVLTKTDLARDPQALEALRQRLHTLNPAALFLDAVRGEAEASRLLDAGLYNAASKSLDV
FT                   QNWLRADAYPTPEHAHEHRHDHHHDRAHDHAHTHDVNRHDDAIRAFCLRDERPLDPDGW
FT                   SLFLDLLRQAHGPNLLRVKGIVALADAPDRPLVIHGVQHVFHPPHRLDRWPDADHSTRI
FT                   VFILKDMQPDFVAGLWKAVGNVPTVDRPDSSVLSDNPLSPKPGGLLA"
FT   gene            complement(408919..409953)
FT                   /locus_tag="Bind_0360"
FT   CDS_pept        complement(408919..409953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0360"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: rpe:RPE_0216 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94014"
FT                   /db_xref="GOA:B2IDG2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG2"
FT                   /protein_id="ACB94014.1"
FT                   /translation="MAKFVNRVFSGIQPTGHLHLGNYLGAIIKFIELQKTHDCLYCVVD
FT                   LHAITVAQNPDELRAHIRELTAAYIACGIDYEKQIIFNQSQVSGHAELAWVLNCVARVG
FT                   WLNRMTQFKEKAGKDRENASVGLYDYPILMAADILLYKATHVPVGEDQKQHLELARDIA
FT                   QKFNLDFASAIAAHGFEDAFFPLPEPLIQGPAQRVMSLRDGTKKMSKSDPSDNSRINLS
FT                   DDAEAIAQKIRKAKTDPEALPSEVEGLAKRPEAENLVGIYAALIGETKADVLKTFGGGN
FT                   FSTFKTALVDLAVDKLGPIGAEMKRLKAETAFIDQVLVNGATRARALAEPHMAAVKDIM
FT                   GFVR"
FT   gene            complement(410160..411386)
FT                   /locus_tag="Bind_0361"
FT   CDS_pept        complement(410160..411386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0361"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: nwi:Nwi_0316 cell division transporter
FT                   substrate-binding protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94015"
FT                   /db_xref="GOA:B2IDG3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG3"
FT                   /protein_id="ACB94015.1"
FT                   /translation="MAEDTTPKRSFLQRLFTRKEDQAEPLAPETEAKALENAAPEVDSA
FT                   ARTIEPQALEQAPPEAQAPPDEAMQNTPQPLAAPAPFAVTPPPAPGAMEEAPQGSWWTR
FT                   LRDGLSRSSSSIGTGLVDIFTKRKLDEAMLEDLEDILIRADLGTAVAQRITEAVGKGRY
FT                   NWDVDPREVKTILASEVEQVLTPYAKPLVIDTTKKPFVILVVGVNGSGKTTTIGKLAAQ
FT                   FSREGHKVMLAAGDTFRAAAIEQLQIWGQRLGCTVIARPQGSDASGLAFDAIKTARSEG
FT                   ADLLLMDTAGRLQNRAELMDELEKIIRVMRKQDEEAPHAVLLVLDATVGQNALNQVEIF
FT                   GRVAGVTGLVMTKLDGTARGGILVAITEKFKLPIHFIGVGEKVDDLEPFAASDFGLAIA
FT                   GLDKDESQH"
FT   gene            411599..412261
FT                   /locus_tag="Bind_0362"
FT   CDS_pept        411599..412261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0362"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: xau:Xaut_0022 cell division ATP-binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94016"
FT                   /db_xref="GOA:B2IDG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG4"
FT                   /protein_id="ACB94016.1"
FT                   /translation="MVRFENVGLRYGMGNEILKDISFAIEPQSFQFLTGPSGAGKTTLL
FT                   RLILLSLRPTRGLINLFGSDSTELDKDAITDLRRRIGVVFQDFRLLDHLTTYENVALPL
FT                   RVRGREEASYRAEVIELLRWVGLGERMHILPPVLSGGEKQRAAIARALIVRPELLLADE
FT                   PTGNVDPSLARRLLRLFTELHKSGTSVVIATHDLGLMDQFDGARRMVLGDGRLHIYD"
FT   gene            412269..413300
FT                   /locus_tag="Bind_0363"
FT   CDS_pept        412269..413300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0363"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mex:Mext_2864 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94017"
FT                   /db_xref="GOA:B2IDG5"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG5"
FT                   /protein_id="ACB94017.1"
FT                   /translation="MRFSPRLPLAFSSFLRFREETPPLPRDSTLDEATIEDGAAREAEH
FT                   RREVSLVPPTSIAGRALVTVIAIMTFLAAIGAGTAVLIADASHEWRGEVSREVTIQVHP
FT                   TANRDLDADTTAALTLTRATPGVADARAYTKAESESLLQPWLGSGLDLSDLPVPRLIVI
FT                   ALDNGVSLDVAALRQKLTAKIPTASLDDHRLWLERLDGMAQSVVVIAIIFFLLVLAAMS
FT                   FAIAFATQGAMAENRGIIEVLHFVGAADSYISRQFQYHFLRLGLRGGALGGACAIFLFL
FT                   FGEVFSSWWKATPAGDQMQLLFGSFSLSLKGYAIIVLISGFIALLTGFVSREIVYRHLR
FT                   GLN"
FT   gene            413757..416798
FT                   /locus_tag="Bind_0364"
FT   CDS_pept        413757..416798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0364"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: psa:PST_4184 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; GAF domain protein;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94018"
FT                   /db_xref="GOA:B2IDG6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG6"
FT                   /protein_id="ACB94018.1"
FT                   /translation="MAALQGSTMTVDAPGREDLSFAPQEAGDAISWRALADVLSAIAAV
FT                   QEPRAVMKLVCRAGCALVGADGASFILREGDFCHYAEQEGLGPLWQGLRFTLRECLAGS
FT                   VLAEGVPAIIPDVRRDDRAALYHMTGVESLMMIPLGAGLQPEPRLGTIGIYWACKREPT
FT                   EAEIHACELLAQAAARTLTNITEIATLRDSEAKLRLVLETGRFGIFELDGATRALDASP
FT                   IYKDHYGRDPHLPFTYADMISTIHPLDRHDLVTGLDRATMEGVIFDQEYRLVTADGDLR
FT                   RLHVHAHPIRDARGRSTRLVGASLDITERYQAECILQANERRMQLAQDAALVGTWEWDM
FT                   TTHDVVCSPEQSRLFGHEPIMRTLSEADFFASVHRDDRDMLKAAFGAMPRSGGFECEYR
FT                   IVQPDDDIRWVVGRGRVLHDAEGLQTRLIGIMMDVTERHRAEEILRASEDRYRNLVESL
FT                   PLLVWTCRPNADCDYLSPQWIAYTGRSADELLGLNWLEYVHPDDRERAEEHWRGARDDK
FT                   HPYHIDYRLRRHDGVYRWFKTRGTPVRDMDGRIIYWIKTCTDIEDLVVAREYVARHQYE
FT                   LEHLVAERTIELADINAQLKEEINERSKVQAQLAQAQRIEAIGQVTSGVAHDFNNLLTV
FT                   ILGNLDLLEKSVIDPVRGDPKTKRRLDNMRMAGERGAKLTGQLLAFSRRQRLQPKPIDL
FT                   NEAALAVKELLQGALGGSVLLEWNPKPDLWLALADLTQIELVLLNLAINARDAMQAGGT
FT                   LIIETANVILPYKSDRQMGEPVAAGEYVVLAVTDSGCGMSESVKARVFEPFFTTKPIGK
FT                   GSGLGLPQVYGFATQSGGGVTIDTQEGVGTTVKVYLPRAMTPVMGYEGIHPAPVENGHA
FT                   QRCKPITILLVDDDNAVREVAANILTDLGYAVIEAGSGSAALERLEEMPQIDLLLVDFA
FT                   MPGMNGVELARVVRERLPNLPILFVTGYADLAEIKNVGEDRIVQKPFERQGLAAKVSYV
FT                   LERGADTHVYPARDNNISLARGRM"
FT   gene            416990..418015
FT                   /locus_tag="Bind_0365"
FT   CDS_pept        416990..418015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0365"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /note="KEGG: mex:Mext_3338 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94019"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG7"
FT                   /protein_id="ACB94019.1"
FT                   /translation="MPLLTRRGLNLGLLTSSVLGMRPVQAESIAARAGIIPVLGASPVY
FT                   VAEKEGWFNEGGLKVNLLKFESGPDVMQAAASGTIDVHVAGIAPVAVGRAHGIDLRVVA
FT                   ATAIAENVLVAGSKFAAGLPQNVPPAEMFKQYRQKTGQPVRIATQPAGSVPSTNLNYWL
FT                   SEVAHVDPADVRIVSIGIDGATQALLSNSVEASTIREPILTVAKQRDPGIKILALGDDL
FT                   LPGQPGTVVAVSAAFAQKNPEAVRTLVKGVIRGVELLQKEPDRAAADIQTSLGKGMLDI
FT                   ALIRQALVSPATHFVADPHVILKATQVMLAFQKKIGTLDEVPELTSLFDTSFYDAVIAG
FT                   K"
FT   sig_peptide     416990..417070
FT                   /locus_tag="Bind_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            418390..420642
FT                   /locus_tag="Bind_0366"
FT   CDS_pept        418390..420642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0366"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: gox:GOX2077 ferric siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94020"
FT                   /db_xref="GOA:B2IDG8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDG8"
FT                   /protein_id="ACB94020.1"
FT                   /translation="MTLKPNPSIDCGERKYSAHRRVWWQRKGPLLTQASTFAVLMGMSA
FT                   VPVSAQSVPGATSKTNSNMTLPEVDISAVSTNVSPAGETFGVITPPKKFELGPAGNQKP
FT                   LDMPHSVQVISQEIIRSQQARNLADVLKFNPSVQMSRGADGGRISSRGFESGVVQNTRM
FT                   DGLNMISTTGYPIEQFDRIEMLNGVAGGMYGPTGPTGTFNFISKRPTDVPFQTISYGYD
FT                   SISNNTVFGDVGDRVEGLAFRFNFVHSGGQSYAPTSSLRRTLLDGAIDLHFGDSTVLEL
FT                   NGSYYDWHWFGFPGSFTYGNGIYNLPQAPSSSTAGFGVPGMGNQNETHTFSAKLKHEFN
FT                   QDWNLTIGLLDQTVERGLYQPTNVLNNNYGQFTSQINSQKAAKFTIISNLATLNGHVMT
FT                   GNISHDIFVGTTGFTWGTFSGIGTNSVTVGTANINNPFVFATPIYQTGGAVYKSARNDQ
FT                   QSLVGGDTIKFDEHWSLSLNSSFSWLTSKNYNALGQKTSSFQTGGEWSPTASVMYKPSE
FT                   NQTAYFTYANSLQQGDTAPTGTLNANQTLAPYRSTQYELGYKVALNDRFMITADGFRIS
FT                   QPWAYQNADKIYQNFGTQVNWGSEVMLTGQLTDDLSMMGGFMQLVPKLFNTGTPGIEGK
FT                   DVVNIPRVQANLFLEYTVPTIQGLALSTNFHYVGGRPGNETNTIWSGAYATLDFGLRYT
FT                   TVVDGHRITARFNVNNVTDKSYWTNIYPVSGVSTSAGSQAYLGLPRTFSAGLDFTL"
FT   sig_peptide     418390..418542
FT                   /locus_tag="Bind_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.818 at
FT                   residue 51"
FT   gene            420722..421485
FT                   /locus_tag="Bind_0367"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(420722..421045,421045..421485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Bind_0367"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: bcs:BCAN_A0546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94021"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDB9"
FT                   /protein_id="ACB94021.1"
FT                   /translation="MTRRRYELTDHEWWILSPLLPNKPRGVARVDDRRVLNGILWRFRT
FT                   GSPWAEIPERYGPPTTCYNRFVRWRKAGVWDRLLDAVSEAYDGDIVMIDSTCVRVHQHA
FT                   ATGKKGDGDDGGMGRSRGGLTSKIHALVDAEGRPVTLRLTGGQVADCTEADALTDGLGE
FT                   GDILLADKGYDSNAIRAKAAERKAWANIPPKDNRKGSFSFSRWVYRQRNLVERFFNRIK
FT                   QFRGIATRYDKDPANFLAAIKLVAIRIWCQSL"
FT   gene            422079..422807
FT                   /locus_tag="Bind_0368"
FT   CDS_pept        422079..422807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0368"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   xau:Xaut_3103 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94022"
FT                   /db_xref="GOA:B2IDC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC0"
FT                   /protein_id="ACB94022.1"
FT                   /translation="MSAIRPQKVVEGNKESSAFREKGLMEAFQEDWVKTMMKALAEGTI
FT                   RRLWACDMSHFRDHLLRLDPDSRFERFGAFTDDTQINHYVDSCYGPDEIIYGYVVDGEV
FT                   RGAGELRAMGASFLPEGAAEAAFSVEQGWRRQGVGTNFMKRIVLAARNRRIHTLYLSCL
FT                   AHNSKMVGLARKFATELTFETDEVTGKLIARTPSTTSLIEELIDNSVGFTEAMFDFQKR
FT                   ILTAAEEARHPSSERHSVTV"
FT   gene            complement(422900..425248)
FT                   /locus_tag="Bind_0369"
FT   CDS_pept        complement(422900..425248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0369"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; KEGG: azo:azo3844
FT                   putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94023"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC1"
FT                   /protein_id="ACB94023.1"
FT                   /translation="MAFHGGEIGLKQRGFLIHWSHLSVITLPCLAMEAHAQTAIVDNGL
FT                   ELPVVHVQAASNRPVLAGTIPDTPETAYEVSNKAINILSPGGSANAFRAVSILPSVYAP
FT                   AIDPYGLANIPGSNKGIRIRGEASSHGNSISTVEGIPLGGVNPGPGFQWLFPTENVDSM
FT                   QVYQGPIAPDKGSFFTTAGAINTQLRWGEDKPGAEITQGFGSFNFFRTFARVDSGALFN
FT                   GTTHAFASGSWTDAENWRGPGKAANGNTTASFGLSTKITDQFDARLYFSYANMQQNTYR
FT                   PLNYMQTQNLGLYRFYDYSANPNAGIAYFNNNRQSFEDWVILSELTYHFNENTQLTVKP
FT                   YYFSEKGAYYDGMANGMVRNWLLDHDSYGLTSEISTRLLETDMKLGYWWTTMQLPGPPN
FT                   AWKMYMPNAYGGLNFNMWSILAQATTRNEFQSAYAMMDKKIGPLHLQAGARYMWENIPG
FT                   INAFNTMGVSDTSYNAAIGMAPGINGMRSVSSHVFGAFLPYMAASYDLTPNLQANMSVG
FT                   ANYGAPSFDIFPAYQQNAATFQAKGISADQLWSTLKAETSTNIDVGLRWTYESPDIGTA
FT                   LLEPRFYYAKYANKGVSFDPGIGVAYSQNVADTHAIGGQLMAHWLPRPELDLFASVGYT
FT                   RNVFDANLPTLPGASAATIMAAAVKGTQFPDVPNWTMAAGLNWSTRDPWLGDGQLTISP
FT                   IINYISDRWGDTTRTQHLSGYATVDLNIGYDYQTPIGLFNASLTVTNLFDTSYIGYLNT
FT                   SYYQQAMGTNAYYYPGAPRAFLGRLALKI"
FT   gene            425554..427422
FT                   /locus_tag="Bind_0370"
FT   CDS_pept        425554..427422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0370"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: mex:Mext_2754 oligoendopeptidase,
FT                   PepF/M3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94024"
FT                   /db_xref="GOA:B2IDC2"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC2"
FT                   /protein_id="ACB94024.1"
FT                   /translation="MSLIHSLLSRNFLDFPRDPAQAGQGAPAVALGTLPEWNLADLYPA
FT                   PDSPLFARDLAHAVAEAKAFAEAYKGRLETLAMDPSSTGLIEAVRRYETVEELLGRLMS
FT                   YAGLHYYGDTSDAARAKFYGDTHEEITKASSDLLFFELELNRLDDALIEKALKGTPLEH
FT                   YRPWIEDIRKEKPHQLDDRLEQLFLDKSVTCRSAWNRLFDETISALRFKVDDQELTLEL
FT                   ALNLMQDEDTKVREKGANAIAETLKANLRTFTLISNTLAKDKEISDRWRGFQDIADSRH
FT                   LSNRVEREVVDALVAAVHAAYPRLSHRYYKLKAKWFGLDQLNHWDRNAPLPNIAAKTYP
FT                   WAEARDTVLDAYGAFSADMAGIAKRFFDNGWIDAPARPGKAPGAFAHPTVPSAHPYVLL
FT                   NYLGKPRDVMTLAHELGHGVHQVLAGPNGALMAPTPLTLAETASVFGEMLTFRTLLART
FT                   TNVTERRAMLAAKVEDMINTVVRQIAFYTFERKLHTARREGELTAEQVCELWMSVQAES
FT                   LGPSIKLGPGYETFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYEKSREGFAERYLAM
FT                   LSAGGTKHHAELLAPFGLDARDPSFWQIGLSMIEGMIGELESLEGQ"
FT   gene            427582..428589
FT                   /locus_tag="Bind_0371"
FT   CDS_pept        427582..428589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0371"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bpd:BURPS668_3127 oxidoreductase, zinc-binding
FT                   dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94025"
FT                   /db_xref="GOA:B2IDC3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IDC3"
FT                   /protein_id="ACB94025.1"
FT                   /translation="MRAVVVRTPGGLDHLALVEQPDPGAPGIGEIRVRLHANSLNYHDY
FT                   CVAIGVMPTEDGRIPMADGAGIVEAVGDGVGEFAVGDSVVSCFYPLWQEGAPVASGFAT
FT                   VPGDGVDGYARESVVRPASWFTKAPKGYSHAEAATLTTAGLTAWRALVGDGGLKAGDTV
FT                   LALGTGGVSIFGLQFAKMMGARVIITSSSDEKLERARALGADETINYKQELNWGEKVFA
FT                   LTGGRGVDHVLEVGGPGTLPQSIAAVRIGGHIAMIGILTGFSGEVPTLALLGKQARLQG
FT                   LIVGSRRQQIEMIRAIEENGLKPVIDKSFALADMAQSFLYEESGQHFGKIVLEF"
FT   gene            428599..431142
FT                   /locus_tag="Bind_0372"
FT   CDS_pept        428599..431142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0372"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases; KEGG: azc:AZC_0109 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94026"
FT                   /db_xref="GOA:B2IE02"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE02"
FT                   /protein_id="ACB94026.1"
FT                   /translation="MKRGLIQKEPLPPRFAAWFAARGWSPRAHQQHLLALAQQQENALL
FT                   IAPTGAGKTLAGFLPSLVDLEQKRNRDGLHTLYISPLKALAVDVERNLQMPIAEMGLKI
FT                   TVETRTGDTSTAKRLRQRRQPPDMLLTTPEQLTLLLATADAEHLFADVRRVIFDELHAI
FT                   APSKRGDLLSLGLARLRTLAPMMRTTGLSATVRAPEDLQRWLVSQQDANALATLITAPP
FT                   GAPADLRILDSDNALPWAGHSAAHALREIYAAIEAATMTLVFVNTRAQAEYVFQELWRI
FT                   NEKSLPIALHHGSLDAGQRRKVEAAMVQNRLKAVVCTSTLDLGIDWGAVDLVINVGAPK
FT                   GASRLAQRIGRANHRLDEPSRALLVPANRFEVLECHAAVEAARAGTQDTAAARAGALDV
FT                   LCQHLLGMACVGPFDPQRLYEEVITAAPYAGLSRKDFDAALNFAAHGGYALKAYERFAK
FT                   LKPMPDGRWRIANGRVAQAYRMNCGTIVEADMLRVRLVPGSEGGRRKSGQPLKTAYTGP
FT                   LRRGGRILGEIEDYFIETLRPKDTFLFGGEILALQGIAGDEALVVRSHAETPKIPSYAG
FT                   GKFPLSTYLAKRVRELLSTPEEWNQLPPQVVEWLALQKHVSRLPPPEALLVETFARGGH
FT                   FHLVAYPFEGRLAHQTLGMLLTRRMERAGLQPLGFVANDYALCVWSRADVGAWCEDNKY
FT                   ALNALFAKDMLGDDLEEWLHESALMKRTFRNCAIIAGLIERNFPGKQKAGRQESRRVTI
FT                   STDLIYDVLRRHEPDHVLLRAARADAATGLLDLERLGLMLARVRHKIIHQPLTHISPLA
FT                   VPIMLEIGRERVYGEAQDALLAEAAADLAAEAMAP"
FT   gene            431192..431923
FT                   /locus_tag="Bind_0373"
FT   CDS_pept        431192..431923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr1149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94027"
FT                   /db_xref="GOA:B2IE03"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE03"
FT                   /protein_id="ACB94027.1"
FT                   /translation="MCCKALSVSQNPARTTTRAALAIGDKDFVADPSGALFLEEERLLI
FT                   VADLHLEKGSAYATRAVFLPPYDTRQVLGNLAALMRFYAPRGLIALGDSFHDQGAGERL
FT                   HPADRERLAVLQQGREWIWISGNHDAERPLGIGGIFLDELRLGPFTLRHVPMEGRDGTG
FT                   ELAGHLHPVAKVRGRGGVVRRRCFLTDGRRCILPAFGAYAGGLNIRDEAFTALFSLKDA
FT                   EAHVLGQKGVYVFPARHCLEE"
FT   gene            431977..432050
FT                   /locus_tag="Bind_R0003"
FT                   /note="tRNA-Gly1"
FT   tRNA            431977..432050
FT                   /locus_tag="Bind_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(432423..433220)
FT                   /locus_tag="Bind_0374"
FT   CDS_pept        complement(432423..433220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_2586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94028"
FT                   /db_xref="InterPro:IPR027612"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE04"
FT                   /protein_id="ACB94028.1"
FT                   /translation="MSSLPSLSKKILWNLPVAAQLRRNGFLNSYFRKGFGRHWGRFETF
FT                   EEARDFLPSSKRVTYDNDEIVPINLESFATIHSFDWPVLFFLQRIFNENALRVITDFGG
FT                   HIGSKYYAYKDMLTLPADLCWQVVDVPAVVREGRRRLTETPTLHFYEKLEETQACDILL
FT                   CSGVLQYAELSIDEIVARLPKRPARIIVNKVALSENESFYTLEDFGKYRMPYHILAPDA
FT                   LKESRLRLGYTLLAHWPIPSRDFIVPSAKGKDHVSMVGEAWML"
FT   gene            433257..433546
FT                   /pseudo
FT                   /locus_tag="Bind_0375"
FT   gene            complement(433609..434124)
FT                   /locus_tag="Bind_0376"
FT   CDS_pept        complement(433609..434124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0376"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bbt:BBta_4630 integration host factor alpha-subunit
FT                   (IHF-alpha)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94029"
FT                   /db_xref="GOA:B2IE05"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE05"
FT                   /protein_id="ACB94029.1"
FT                   /translation="MHADYDAFWIERHGISHLLGYRLPLNPVSKTERKADYATSRKEGM
FT                   MPAEQQDTEAVADWRNIMPRGFSLITVTRKDLASSVYDCIGISRKDADRLVTEVLSEIT
FT                   EALVRGENVRLASFGNFEIRAKTQRIGRNPRTGVAAVIPPRRVLKFKASKVLLDRLNGD
FT                   CVTGNGKK"
FT   gene            complement(434557..435342)
FT                   /locus_tag="Bind_0377"
FT   CDS_pept        complement(434557..435342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0377"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: xcb:XC_0373 glycerol-3-phosphate
FT                   regulon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94030"
FT                   /db_xref="GOA:B2IE06"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE06"
FT                   /protein_id="ACB94030.1"
FT                   /translation="MSSDSPVLKPRQATILELAQKKGFVSIDELTQTFNVTQQTIRRDI
FT                   NELCESGQLRRYHGGASPSSTVENKDYATRQILCLEEKRRIARAVAQVIPDHASLLINI
FT                   GTTNEEVAKALCQHKGLHVITNNLNVASIMSSNPGFEVVIAGGIVRPRDRGIIGEATIE
FT                   FIRQFKVDFGIIGISGIDEDGQLLDFDYREVQVARAIIDNARQVFLVADHTKFGRNAMV
FT                   RLCHMSRIHALFTDKQPPTAISTILAESGGALYIAPAGS"
FT   gene            435676..437295
FT                   /locus_tag="Bind_0378"
FT   CDS_pept        435676..437295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0378"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rru:Rru_A1508 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94031"
FT                   /db_xref="GOA:B2IE07"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE07"
FT                   /protein_id="ACB94031.1"
FT                   /translation="MDRQAALKALQAGETFDLLVVGGGATGCGVALDAASRGLKVALVE
FT                   RNDFAEGTSSKSTKLVHGGARYLELAIRRLDRVQFNLVRDGLRERAIFLKNAPHLAHRL
FT                   ALLSPLYRWFDVPYVFAGLYLYDRLAGKLGLGGSRLLSRAEALRRFPMLKAEGLKAAVL
FT                   YYDGQFNDARMAVTLALTAVEQGAVIATRLDVVGLTHEKGKLRGATVHDRESRKSFEIK
FT                   ARAIINAGGPFADSLRLMADPETAPILTASSGIHIVLDRRFAPTETGLMIPETEDGRLL
FT                   FVLPWQGHALIGTTDEPARIEENPQARQEAIDYLLRHVRKYFNMNVTEADLLSVWCGLR
FT                   PLVSDPKAADTARLARDHIIEVSKSGLVTICGGKWTTYRKMAEQTVDHAIACFSLPTHS
FT                   KCRTLDLPLVGARHFDAAGGAAALTSTFGLSPETAAHLHQAYGDRAKQVLGCVDTSAMK
FT                   TLLHPLHPYLEAEVLYSARFEAALSAMDVLARRLPLALLDRQAAREAAPRVIAMLATEL
FT                   AWDEQRCANEAAEVEQRLSEAI"
FT   gene            437444..438172
FT                   /locus_tag="Bind_0379"
FT   CDS_pept        437444..438172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0379"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: tma:TM1429 glycerol uptake
FT                   facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94032"
FT                   /db_xref="GOA:B2IE08"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE08"
FT                   /protein_id="ACB94032.1"
FT                   /translation="MHATSIFLGEFLGTMILILLGDGVVANVLLEKSKGQNSGWMVIAA
FT                   GWGFGVAIAVYISGWISGAHLNPAITIGFLLVGKVTPALVPAYFAGQFAGAIAGAVLVY
FT                   LAYLPHWEKTKDGDLKLAVFCTAPAIRHSASNLLCELIGTAILVVGVLGIFNTNNGIGS
FT                   GFGPYAVGILVFSIGLSLGGPTGYAINPARDLGPRIAHAILPITGKRDSDWNYAWIPVI
FT                   GPLIGGGLGALLYYGFVGLL"
FT   gene            438366..439889
FT                   /locus_tag="Bind_0380"
FT   CDS_pept        438366..439889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0380"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: cau:Caur_3292 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94033"
FT                   /db_xref="GOA:B2IE09"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE09"
FT                   /protein_id="ACB94033.1"
FT                   /translation="MTKYVAVIDQGTTSTRCMVFNKQGEIVAQHQLEHEQICPQAGWVE
FT                   HDPLEIWERTKDVIHGSVAKAGLVAADIAAIGITNQRETTMIWNRKTGQPYGNAIVWQD
FT                   TRTDIVCNQMSAEGGQNRFQAKTGLPLATYFSGPKIRWMLDHYPGLRQDAEKGEALFGN
FT                   MDSWLIWKLTGGPGPAAVHVTDVTNASRTMLMNLKTLDWDEELLSAFAIPRAMLPSIRP
FT                   SSDPEFYGFTRQDGPFGGEIPICGDLGDQQAATVGQVCFDAGEAKNTYGTGCFMLMNTG
FT                   TEMVHSNHGLLTTVCYQFGHEKPHYALEGSVAIAGALVQWLRDRMRVINTAADIENLAK
FT                   LVPDNGGMYFVPAFSGLFAPYWRSEARGLIIGMTRFINRGHFARASLEAAAYQTREVVD
FT                   AMQADSNVSLKVLKVDGGMTANDLLMQIQADVLGVPVVRPKVAESTALGAAYAAGLAIG
FT                   YWKNSDDLCQNWGVDKSWKPSGDDTLRTKNYAMWKKAVTRTFDWLDESA"
FT   gene            440059..440922
FT                   /locus_tag="Bind_0381"
FT   CDS_pept        440059..440922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0381"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   sme:SMb21406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94034"
FT                   /db_xref="GOA:B2IE10"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE10"
FT                   /protein_id="ACB94034.1"
FT                   /translation="MTPRANWKGLLKIAEVTCQVALYTAVSTSERIAFHTLNRATGHRV
FT                   QRRFIDSETGSPVEKADQVKGYETGSRDYVILEPEEIAEAIPETDKILSVSAFIRCDDI
FT                   DDIYFDKPYYLAPADPHSEESYAVIHEGLRTKNVAALAQTVLFRRLRTVLIRVQGRGMI
FT                   ATTLNFDYEVLPAGKAFEDIPTLKVEGEMVELAEHIIQKKIGHFNPAEFDDRYEAGLAE
FT                   LVKAKLEGKEIQAPRKPQRGKVIDLMTALRDSAALVAKKAASSSSGKSKATAPKEKATP
FT                   RRRKAS"
FT   gene            440927..442861
FT                   /locus_tag="Bind_0382"
FT   CDS_pept        440927..442861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0382"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: mes:Meso_1150 ATP dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94035"
FT                   /db_xref="GOA:B2IE11"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE11"
FT                   /protein_id="ACB94035.1"
FT                   /translation="MAALDTHHQKRAKASPFLDSLAIQGAKKASLPEFVEPMLASLLTA
FT                   PPAGKDWIHEIKFDGYRLQARIEAGRVKLLTRRGLDWTQKFGPKIVTILQALPVETALI
FT                   DGELVVENSSGVSDFSALQAALSEGQFDRFLFYAFDLLYLDGYDLCDLSLSKRRDMLEH
FT                   LVGSDAGPLRMSQRFEEEGRLVLQHACRLGLEGIISKRKESVYRSGRGKDWIKSKCSAR
FT                   QEFVIAGYVPSSTSRKAIGSLVLGVYDGDRLDYVGRVGTGFTMAIAEDLFRKLEAMQID
FT                   KRPFAKPLASAEARHVRYVHPELVAEIEFSGWTADERLRHASFQGLREDKDAREVVREG
FT                   SRSLTFTAKPQRRRAVFTHSDRIYWPDEGVTKEGLADYYTEVWRFIAPFIVGRPLALLR
FT                   CPDGITGPQFFQKHAWKKVYSHLVLVNDPKEKSEPLLALHDLDGLLELVQSAVLEIHPW
FT                   QSTLTDWERPDRIIMDLDPGEGVPWEMVIAAAEEMRDRLQEVGLAAFVKTSGGKGLHVV
FT                   SPLKPLATWPMVKTFTKTLADAMAADNPDRFISTSTKSKRQGKIFIDYLRNQRGMTAVA
FT                   AYSTRARPGASVSVPLDWKELSPNIGPAYFTVENTPIRLAALTGDPWAEFQAAAVALEE
FT                   PRSTRRRHG"
FT   gene            442996..443799
FT                   /locus_tag="Bind_0383"
FT   CDS_pept        442996..443799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0383"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   sme:SMa0426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94036"
FT                   /db_xref="GOA:B2IE12"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE12"
FT                   /protein_id="ACB94036.1"
FT                   /translation="MAPRAFWEGYLKLSLVTCAVAMTPAISEREKVRFHTLNRKTGHRI
FT                   LSQYVDAETGKPVEEADEVKGYQRGENDYVMLEDAEIDAVRLESTHTIDIDMFVPHDSV
FT                   GLIWYDRPHYLIPNDTVGEEAFCVIRDAMTSTNMVGMSRLVLYRRERAVMLEPRDKGII
FT                   LWTLHYGDEVRREEDYFEGIKDSRPDPKVMTLVETLIDERTKPWDPAMVTDPVQDRLLE
FT                   IIASKKKGKKPIKPKAVAEAPSNVINIMDALRHSLASESKSPKKD"
FT   gene            complement(443898..444761)
FT                   /locus_tag="Bind_0384"
FT   CDS_pept        complement(443898..444761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0384"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: bhe:BH13400 putative cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94037"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE13"
FT                   /protein_id="ACB94037.1"
FT                   /translation="MPNYIYADGDTLKNKFGLTTRAALAGQETRHVAMRAVELAAGFGP
FT                   QGSFDGAHLKAIHAYLYQDVYEWAGHTRDEPMTLSDGTIARESSMETPGGREFMIGRFI
FT                   PLALDQMATNLAPIESWRALTREDFAGKAAAIMADLCTLHPFRAGNEPTLRMFMRQLAE
FT                   ACGHTFDFSVVSREGMKQAEISAYELDDFTVMRRLFLEISDPARIKLLRQGIALLESEG
FT                   FDWNDYYLITADPGVPTMVTMNRIVGDLFFCKLPLEMVVGWTADLPEPQPEAGVEFAYV
FT                   PSKGVE"
FT   gene            complement(444768..444998)
FT                   /locus_tag="Bind_0385"
FT   CDS_pept        complement(444768..444998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94038"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE14"
FT                   /protein_id="ACB94038.1"
FT                   /translation="MQHKPAAVATAPSGEAATLEREDILEREEQVRVGATEVRLAGQER
FT                   DPASHALFEAYICGEISAKEMITRFLALPQN"
FT   gene            445207..445824
FT                   /locus_tag="Bind_0386"
FT   CDS_pept        445207..445824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0386"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: azc:AZC_2257 ATP corrinoid
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94039"
FT                   /db_xref="GOA:B2IE15"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE15"
FT                   /protein_id="ACB94039.1"
FT                   /translation="MPRTLEEEAEHHRAKMAKRKAVQDAEVASKPILEKGLLIVHSGPG
FT                   KGKSTAAFGLVLRALGHGWPIGVVQFIKGAWETGERRALSRFEDLVSWHTMGEGFTWET
FT                   QDKERDKAAAGAAWEKARELMARPDLRLLVLDELNIALRYDYLALDEILSVLTHRRPDL
FT                   HVVVTGRNAKPDLIAAADLVTEMGLVKHPFAAGVRAQAGIEF"
FT   gene            445849..447315
FT                   /locus_tag="Bind_0387"
FT   CDS_pept        445849..447315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0387"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: azc:AZC_2258 cobyric acid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94040"
FT                   /db_xref="GOA:B2IE16"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE16"
FT                   /protein_id="ACB94040.1"
FT                   /translation="MAKALMLQGTGSDVGKTLIVAGLCRAYMRRGLRVRPFKPQNMSNN
FT                   AAVTLDGGEIGRAQALQAQACGVPPSVHMNPVLLKPQSGTGSQIILQGRLSGQAEARTY
FT                   QAMKKHWLAIVLESFQHLKDEADLVLVEGAGSASEINLRANDIANMGFARAADVPVIVI
FT                   GDIDRGGVIAQIAGTKLVITPQDAEMVVGFLVNRFRGDPDLFKEGMRQIEHFSGWRGLG
FT                   LIPHCPAARDLPAEDAMALGRHLNGERSAHTKFKIVVPVLPGIANFDDLDPLRMERGVE
FT                   LIMIRPGTYLPVEADLVLLIGSKTTIADLVAFREAGWDVDLAAYVRRGGKVFGLCGGYQ
FT                   MLGENLRDPLGLEGPPSEVRGLGLLALETVFTQEKTLVAVEGVSLPDEVPFTGFEMHVG
FT                   HTSGDDCARPFLRLTDGRQDGAVSKDGRIAGCYVHGLFGMDTQRRAFLARFGVAAGDFS
FT                   YLEKVEAALDAVADHLAQHIDLDHLLTLAR"
FT   gene            complement(447299..448312)
FT                   /locus_tag="Bind_0388"
FT   CDS_pept        complement(447299..448312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0388"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: bbt:BBta_3137
FT                   cobalamin biosynthetic protein (anaerobic pathway of
FT                   cobalamin biosynthesis, CobD)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94041"
FT                   /db_xref="GOA:B2IE17"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE17"
FT                   /protein_id="ACB94041.1"
FT                   /translation="MSLFPSLSHPWLLAPLALAIEAVIGYPPRLFAAIGHPVTWIGSLI
FT                   AWTDRNFNRLHDSFATRRLAGFLILTALLFFVFLVASFVQDLLLHGGMPFVIGFPLLAL
FT                   CASSLLAQRSLHDHVQAVGDALANEGIEAGRSAVARIVGRDVTQLDEAGILRAAVESLA
FT                   ENFSDGIVAPAFWLALGGLPGLCLYKTINTADSMIGHRTERHEAFGFSAAKLDDVVNWP
FT                   AARLAALWLCGAAALLSYTSPELSARRAFAITRRDARGHPSPNAGWPEAAMAGALGRRL
FT                   GGPRAYAGTIIEDKWIGDGMAPMTQTDLGRALTLYRLACFLNGAGLTLLCLVIALA"
FT   gene            448356..449366
FT                   /locus_tag="Bind_0389"
FT   CDS_pept        448356..449366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0389"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /note="TIGRFAM: L-threonine-O-3-phosphate decarboxylase;
FT                   PFAM: aminotransferase class I and II; KEGG: xau:Xaut_5025
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94042"
FT                   /db_xref="GOA:B2IE18"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE18"
FT                   /protein_id="ACB94042.1"
FT                   /translation="MAVCGHGGNLALAAELFPGAPQPWLDLSTGLNPFAYPFQMPDEHS
FT                   FTRLPDLPEALEACAARAYEAPPPIQIVAAPGSQALIQALPRLHRLDGKPSPRIGILGM
FT                   TYAEHALNWRAVGARVQEDMDLDALATMDVAIVVNPNNPDGRLLPPAALLDLAARLSKH
FT                   GGLLIVDEAFMDFEAPETHFVPVMPENGVLVLRSFGKAYGLGGLRLGFALTGPKLAADL
FT                   RAWFGPWAVSGPAIAIGRQALGDSLWLVEARKRLETMGTALDRLLCEAGFAVLGGTRLY
FT                   RLVTHEKAAAWFARLGEAGIFVRRFAERPLWLRFGIPGDAPALSRLAEALKVGIR"
FT   gene            449704..450255
FT                   /locus_tag="Bind_0390"
FT   CDS_pept        449704..450255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcs:BCAN_B0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94043"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE19"
FT                   /protein_id="ACB94043.1"
FT                   /translation="MRPNWRRSAGFLWVLLALTSTNVLAKEYPVGQPQQREGMELAAVY
FT                   LQPIEMDPPNMMAPAKESDIHLEADIKAAKDNRNGFAEGDWIPYLAVDYEVIKLDDKQT
FT                   KKGVFMPMVANDGPHYGDNVKLMGPGKYRLVLHIAPPGGEGHEHFGRHVDKETGVGDWF
FT                   KPFSVEYDFTYAGIGKKGGY"
FT   sig_peptide     449704..449781
FT                   /locus_tag="Bind_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            450257..450607
FT                   /locus_tag="Bind_0391"
FT   CDS_pept        450257..450607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94044"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE20"
FT                   /protein_id="ACB94044.1"
FT                   /translation="MFKRGFGCHLLALIMMVASNSAGFALAEDTPTFLIEFNDGKVNPL
FT                   RLEVPANQRFRIELKNSGVTPAEFESTELRKEKVLAPGSVSVLVIHTLDPGEYPFFDDF
FT                   HPEAPKAVLVAK"
FT   sig_peptide     450257..450340
FT                   /locus_tag="Bind_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            451025..452479
FT                   /locus_tag="Bind_0392"
FT   CDS_pept        451025..452479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bov:BOV_A0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94045"
FT                   /db_xref="GOA:B2IE21"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE21"
FT                   /protein_id="ACB94045.1"
FT                   /translation="MAASLSSVGSGERRDESTLSPSMPPLVRQSFAHGLGEWLRRHQRM
FT                   IQTTQWGVVLVYLVLVAVPAFLPLPDRTAHVWNNLTVFAQFAFWGLWWPFVLLSMVLVG
FT                   RTWCGVFCPEGALTEAVSRVGLGLSVPRWIKWKGWPFVAFVCTTVYGQMLSIYQYPMPV
FT                   LLILGGSTAGAMAVGALYGRNKRVWCRYLCPVNGVFGLLAKLAPVHFKVDQDAWADSQK
FT                   NGDAGIRALNCAPLVPIRTMRGAADCHMCGRCSDFRGAVSYSLRSPAEEIVDVAGQTAK
FT                   PWETMLIVFGLMGVAVGAFHWTASPWYVDMKEAVATWLIDHSILWPLQIEPPWWILTHY
FT                   PDLNDSMTLLDGAVLLFYIFATALVLGGAISLCLAVGTLCLGGWSSARFHHLAQSLVPM
FT                   AGCGVFLGLSATTVTLLKAEGITIASLSLLRGGLLLGAFLWVVWLAFAISGRETGHIIR
FT                   RMGATLALAGAAGVGVASWVVMFWIW"
FT   gene            453040..454923
FT                   /locus_tag="Bind_0393"
FT   CDS_pept        453040..454923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0393"
FT                   /product="transcriptional regulator, NifA, Fis Family"
FT                   /note="KEGG: bra:BRADO5449 Mo/Fe nitrogenase specific
FT                   transcriptional regulator, NifA; TIGRFAM: Nif-specific
FT                   regulatory protein; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type; GAF
FT                   domain protein; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94046"
FT                   /db_xref="GOA:B2IE22"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010113"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE22"
FT                   /protein_id="ACB94046.1"
FT                   /translation="MNDQDHAEAAKTMPSHRIQLSEIALIGVYEISKILTAPTRLETTL
FT                   ANVLNLLSSFLQMRHGTIVLLADDGAPEVAVGAGWTEEAMPAPQRYPERAIGQIVATAV
FT                   PLVVHNVADHELFDANDVAALASGGAKVSFMGVPIRAGDRVVGTLTVDRIWDGESVFRF
FT                   DSDVRFLVMIANLIGQTVKLHRVVARDRDRLIEESHRLQKEITKLQPMPVSKARASGII
FT                   GESPAIRAVLDKISIVARSNATMLLRGESGTGKELFARALHEMSPRASHAFVKVNCAAL
FT                   AESVLESELFGHEKGAFTGAVATRKGRFELADGGTLFLDEIGEISLSFQAKLLRVLQEG
FT                   EFERVGGTKTLKADVRLITATNKNLEEAVRNGEFRADLYYRISVVPVILPPLRERSSDI
FT                   PLLAARFLEQFNEVNGRDLVFSKQAMEVLKSCYFPGNVRELENCVQRTATFAVGESIVA
FT                   TDFACGQDQCLSATLWKGKTSAEAWPSKAIGGLGPFGLPGGLTEPPHQSHPHHLEAQHL
FT                   AHPQAYSAPPLAPPPVAVPHMPASPVPASSHPHVPLPPVTPKPAPNVQDVWDEGGVLVD
FT                   VGGGGDTERARLLEAMEKAGWVQAKAARIMGLTPRQIGYALRKHGIEIKKF"
FT   gene            455322..455516
FT                   /locus_tag="Bind_0394"
FT   CDS_pept        455322..455516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0394"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: azc:AZC_1043 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94047"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE23"
FT                   /protein_id="ACB94047.1"
FT                   /translation="MSYKIIASQCTVCGACEFECPNAAISFKNETYVIDPKKCTECEGE
FT                   FDHPQCDSVCPVPQTCVPA"
FT   gene            455603..456409
FT                   /locus_tag="Bind_0395"
FT   CDS_pept        455603..456409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0395"
FT                   /product="LRV FeS4 cluster domain protein"
FT                   /note="PFAM: leucine rich repeat variant; LRV FeS4 cluster
FT                   domain protein; KEGG: gdi:GDI0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94048"
FT                   /db_xref="InterPro:IPR008665"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE24"
FT                   /protein_id="ACB94048.1"
FT                   /translation="MDAENDPALDWLGLPVDCHTCPHRAFLEDGQCRPAHTCILDRRIK
FT                   HMDRFLRKHQSMADGFLDHPYFELRAVAAKHASLFRIAPMVNDLEPEVRMTVVARLPYE
FT                   RVKHLANDPDRRVRIGVALKMEGQALIARLGDSDYHVRVVIVRKLSPDLLPIAMHDPEP
FT                   TVRRWVARRIVENRLIDMRHDKHPMVRLDVAERMAPESLSLFVDDPDLRVRFVAAERIG
FT                   LDQVALFKDDSESIIRDLVAQRLREGEQSTALKIVLSPGDPLSPLA"
FT   gene            456878..458461
FT                   /locus_tag="Bind_0396"
FT   CDS_pept        456878..458461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0396"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="TIGRFAM: nitrogenase cofactor biosynthesis protein
FT                   NifB; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; Radical SAM domain protein; KEGG:
FT                   mca:MCA0204 nitrogenase cofactor biosynthesis protein NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94049"
FT                   /db_xref="GOA:B2IE25"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE25"
FT                   /protein_id="ACB94049.1"
FT                   /translation="MDLTEREVAEAAIKAGANADEIMKKMAEHKGCETDSDGGKKASCG
FT                   TAAGENDLPPEIWEKVKNHPCYSEEAHHHYARMHVAVAPACNIQCNYCNRKYDCANESR
FT                   PGVVSERLTPEQAAKKVLAVASTIPQMTVLGIAGPGDPLANPEKTFKTFDLIAKTAPDI
FT                   KLCLSTNGLTLPDHVDTIARYNVDHVTITVNMVDAEVGAKIYPWIFYKHKRYTGKEAAQ
FT                   ILTDRQMQGLEMLTERGILSKINSVMIPGINDEHLKEVNKAVKGRGAFLHNIMPLISAA
FT                   EHGTVFGLTGQRGPTAQELKRLQDSCEGEMNMMRHCRQCRADAVGLLGEDRSAEFTTEK
FT                   IMEMDVNYDLATRQAYQARVEEERNAVAGAKAAELQILADVESDIKILVAVATKGSGRI
FT                   NEHFGHASEFQIYELSTGKGAHFIGHRRVDLYCQGGYGEEDALETVIRAIKDCHAVFVA
FT                   KIGGCPKKDLLAAGIEAIDEFAHEFIEKSAITYFKRYLEGVKDGSITHVEKGDAEIRPG
FT                   EVAVDVVAAE"
FT   gene            458553..458771
FT                   /locus_tag="Bind_0397"
FT   CDS_pept        458553..458771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0397"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: azc:AZC_3415 2(4Fe-4S) ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94050"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE26"
FT                   /protein_id="ACB94050.1"
FT                   /translation="MSLKIAVSCVNCSACEAECPNEAISAGEGIYVIDPAKCTECIGFH
FT                   DDPQCALVCPVEETCVIDDNYPRYQAA"
FT   gene            458774..459130
FT                   /locus_tag="Bind_0398"
FT   CDS_pept        458774..459130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0398"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   azc:AZC_3416 HesB/YadR/YfhF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94051"
FT                   /db_xref="GOA:B2IE27"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE27"
FT                   /protein_id="ACB94051.1"
FT                   /translation="MDDLNVTITPAADKFVRRMLRFDGGPNSGLRLSVAPGGCSGLSAE
FT                   FAVVDKPTASETVHETNGLRFFIDAQSKVLLQGVTMDFVETPTSAGLKFHDPKAVSTCG
FT                   SHSAPSLDLHDHKH"
FT   gene            459142..459666
FT                   /locus_tag="Bind_0399"
FT   CDS_pept        459142..459666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94052"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE28"
FT                   /protein_id="ACB94052.1"
FT                   /translation="MSMATGYGEQAPVQDVEALLGAGLPKEAAQHLDLAASLYHKDDVA
FT                   LDHLRQAERIAPAHPAVLIGLYRFYFYKGRLAECLEVALVCLSEAAHHNNLPDDWRQVQ
FT                   RGDAEFSSYDMMPRFFLFVLKGYAYLQMRLGNLDEGLAAVMKLLDLDPSDKIGATLLLE
FT                   VHQRMGQDDDD"
FT   gene            459656..460456
FT                   /locus_tag="Bind_0400"
FT   CDS_pept        459656..460456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0400"
FT                   /product="LRV FeS4 cluster domain protein"
FT                   /note="PFAM: leucine rich repeat variant; LRV FeS4 cluster
FT                   domain protein; KEGG: bra:BRADO5416 conserved hypothetical
FT                   protein (superfamily of ARM repeat); LRV protein Fes4
FT                   cluster in N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94053"
FT                   /db_xref="InterPro:IPR008665"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE29"
FT                   /protein_id="ACB94053.1"
FT                   /translation="MTTEADEARDWQGRELTCEGCPHQALQAEGKCQLKQACVRDRYAR
FT                   RIDRFFNWNPSLANEHLNDPFFEVRAVAAKHADVFRLPALLNDPDETVRWAAAARLPDS
FT                   YMARLRNDPHREVRIRVVSRLDEAGLVSMIHDPDYYVRTMVARRLSPSTLPLMINDPEI
FT                   EVRRTVVHRIDPSQLMRMAKDKEPAIRLEVAQRLSNEQLIELKDDPDWRVRYEVAERID
FT                   VKALGSLVNDPDPLVSELARQRLHEAEGAQAAEGEASDRFGTAS"
FT   gene            460540..460875
FT                   /locus_tag="Bind_0401"
FT   CDS_pept        460540..460875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0401"
FT                   /product="NifZ family protein"
FT                   /note="PFAM: NifZ family protein; KEGG: azc:AZC_3419
FT                   iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94054"
FT                   /db_xref="GOA:B2IE30"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE30"
FT                   /protein_id="ACB94054.1"
FT                   /translation="MTNISRDSDVVELNEPPRFNYGQRVRTKRTVRNDGTYCGKDVGDV
FT                   LAKKGEEGYVMNIGTFLQQHYIFGVEFILTGNKVGMKTRELEAVDDDDDAPAPKKKAPK
FT                   ASTEGEE"
FT   gene            460875..461123
FT                   /locus_tag="Bind_0402"
FT   CDS_pept        460875..461123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0402"
FT                   /product="NifZ family protein"
FT                   /note="PFAM: NifZ family protein; KEGG: rpd:RPD_1069
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94055"
FT                   /db_xref="GOA:B2IE31"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE31"
FT                   /protein_id="ACB94055.1"
FT                   /translation="MEPGGGHPPRFQWGQRVQATEDLYNDGSYPDQPLDALLVKEGDLG
FT                   EIVNVGVISETNRPLYLVEFDGQRLVVGCLEEELAPV"
FT   gene            461390..462526
FT                   /locus_tag="Bind_0403"
FT   CDS_pept        461390..462526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0403"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   mca:MCA0212 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94056"
FT                   /db_xref="GOA:B2IE32"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE32"
FT                   /protein_id="ACB94056.1"
FT                   /translation="MIYLDNNATTAVAPEAIEAMAECMRSGPTNPSSKHKAGECSKESV
FT                   MQARGEVARFLSCSPPEIVFTSCGTESNHMAILGALALNPDKKHIVASAVEHPSCLELL
FT                   RHLEKQGVAVSYVPVDAQGQLDAAAVASSIRPDTALVTVMWANNETGVIFPIEAIAAIT
FT                   KEKGVLFHTDAVQAVSKIPVDLKQVPVDLLSLSGHKLHGPTGIGVLFVRKGIKLPSQIF
FT                   GHQERARRGGTENVPGIIGLGKAAVLAQKELAEQQVQLAALRDRLEAAVLAAVPIATVN
FT                   GAGAKRVSNTTNIRFGNLEAELLLERLDRAGICASAGAACTSAGTEPSHVLLAMGVDER
FT                   GALSSIRFSLGRDNTAADIDTLLEVLPGIVNEAAAIAA"
FT   gene            462662..462874
FT                   /locus_tag="Bind_0404"
FT   CDS_pept        462662..462874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0404"
FT                   /product="nitrogen fixation protein FixT"
FT                   /note="TIGRFAM: nitrogen fixation protein FixT; PFAM:
FT                   NifT/FixU family protein; KEGG: mca:MCA0213 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94057"
FT                   /db_xref="GOA:B2IE33"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE33"
FT                   /protein_id="ACB94057.1"
FT                   /translation="MKIMLRKDGAGQLSVYVPKKDLEEPIVSMEKPDMWGGIVTLGNGW
FT                   QLELPEAGPGTVLPCTVEARKLNDD"
FT   gene            462883..463158
FT                   /locus_tag="Bind_0405"
FT   CDS_pept        462883..463158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_4465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE34"
FT                   /protein_id="ACB94058.1"
FT                   /translation="MANLSTENLAEIETMLAGPEADPSVLQDFRQRFPGVSLTRCDPSD
FT                   VDGEKPYKEFPRFTLYLVSAANHCVTITRDPEIATGIIVVQNRKKS"
FT   gene            463155..464306
FT                   /locus_tag="Bind_0406"
FT   CDS_pept        463155..464306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0406"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: xau:Xaut_0120 DegT/DnrJ/EryC1/StrS
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94059"
FT                   /db_xref="GOA:B2IE35"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE35"
FT                   /protein_id="ACB94059.1"
FT                   /translation="MSANLIPLCDPDMSQAELDAVLEVLQSANITSGDTVEAFEEAFAR
FT                   YLGRKYAVATSSGTMGLMLVLDAYGLGPGAEVITSPHSFREIAHAISLRGAFPIFADID
FT                   YWSGCMQPAKAENKLSDKTRALLVSNVNGHPAAWTEFRELADKYKLILIEDSSEAIGST
FT                   YKNSLVGTFGDCSVFDFSQPGPLVCGQGGMVVTDDIDVYMALRRYRNHRLDERSSVVVG
FT                   RAPAYNGTMSNLSAALGLVQLQRLELILERRKRTEFWYFDYVKSFEGIKDPYIGPDVTE
FT                   VHWFLYIVHLGTRFSRSSRDGIIEDLIKEEIEAAAYSVPMHLQPHYFDLGYRKKDFLVT
FT                   EKVADRAVALPFHAHLTEDQIAFIVGSMKDASINIGAGAEITL"
FT   gene            464379..464681
FT                   /locus_tag="Bind_0407"
FT   CDS_pept        464379..464681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0407"
FT                   /product="2Fe-2S ferredoxin"
FT                   /note="KEGG: azc:AZC_3424 2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94060"
FT                   /db_xref="GOA:B2IE36"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE36"
FT                   /protein_id="ACB94060.1"
FT                   /translation="MPIVTIKPQDKTQEGAEGTTLREVIIAAGIPLNECTCAKGYFDNC
FT                   HAFITEGKKSLGKATREENERLDQIVGVGSKSRLICEAKLGPENVTVELLGALSG"
FT   gene            464724..464948
FT                   /locus_tag="Bind_0408"
FT   CDS_pept        464724..464948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94061"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE37"
FT                   /protein_id="ACB94061.1"
FT                   /translation="MHNAEVVIQVRYNPKGECVFCGEAPAGVSPQDWHNHLSNNLPIHP
FT                   LAGGRAAFYTTNEDLARFKAMEGAKLEAF"
FT   gene            464948..465802
FT                   /locus_tag="Bind_0409"
FT   CDS_pept        464948..465802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_4534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94062"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE38"
FT                   /protein_id="ACB94062.1"
FT                   /translation="MNQQSLEEIHAALVGGLLIPYVGPGALTLVPGECPLPVGPEVLVE
FT                   KLTAKATVPHKIRKNLSAAAQFIENFKHRKTINAVMTAAFEPHVEPTDLHRFIASWPKL
FT                   PLVVHAWYDDLMLQALAARDNWGFVQAVSQAEHLATWVHYFNKDGSKIETEQELAVAET
FT                   WDTMLYEPWGSVRPEGNFLVSDSDYVEVLTEIDIQTPIPEKVKEIRKNRHFLFLGCRFQ
FT                   TQLERIFAFQILKRSSDKHWAVMPEKPTKNELKFFEKYNVELIDTPLAEFLGQLVQKEA
FT                   LPA"
FT   gene            465959..466393
FT                   /locus_tag="Bind_0410"
FT   CDS_pept        465959..466393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0410"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: bra:BRADO5406 putative
FT                   hemoglobin protein (truncated hemoglobin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94063"
FT                   /db_xref="GOA:B2IE39"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE39"
FT                   /protein_id="ACB94063.1"
FT                   /translation="MVSSFVSSPQDSSTPFDRIGGQARIDALVDSFYRRMDTLPEAKVI
FT                   RDMHADDLGPVGEVLKRYLGEWLGGPKLYSQERGHPRLRMRHRHFQIGPAERDAWMLCM
FT                   QGAVEEVIDDPALRSQLLNSFYKLADWVRNDDGNPHDAHN"
FT   gene            466377..466967
FT                   /locus_tag="Bind_0411"
FT   CDS_pept        466377..466967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_2347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94064"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE40"
FT                   /protein_id="ACB94064.1"
FT                   /translation="MTLTIDKTVFAPLDAEGRLTHAIIKEEISPGRFGFRGELALKFQQ
FT                   TMADEKRPPELSAWQVFVTAREGEPAFELFMCYMLSFEYLSIMLDVVGHLFKPGGKYFI
FT                   YSNNQDLLQKYRITINGVLFYCLPIGEATAYNEFLELLFIDKNDIKKLNTAGKMEYIVN
FT                   EAMKFDADWEEISYEEGIKRMGPVRNPNENRPV"
FT   gene            complement(467032..467679)
FT                   /locus_tag="Bind_0412"
FT   CDS_pept        complement(467032..467679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0412"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase; KEGG:
FT                   xau:Xaut_2059 nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94065"
FT                   /db_xref="GOA:B2IE41"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE41"
FT                   /protein_id="ACB94065.1"
FT                   /translation="MEMDKSVHELRPRQDKYLARVPPHGDGQSIGLFGGSFNPPHEAHR
FT                   LASLIALRRLRLDRIWWLVSPGNPLKDHAGLPSVEARMRMAETVKQHPRIHVSGVEAGI
FT                   GTAYTHETLRYLVRHYPKIHFVWIMGADNFRQFHLWRHWREIAHLLPMVIIDRPGSTLK
FT                   ASQAPAALALARYRRPENQCAGLARAKPPAFVFLHGPRSSLSSTLLRQQTKP"
FT   gene            complement(467654..468949)
FT                   /locus_tag="Bind_0413"
FT   CDS_pept        complement(467654..468949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0413"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   nha:Nham_0520 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94066"
FT                   /db_xref="GOA:B2IE42"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE42"
FT                   /protein_id="ACB94066.1"
FT                   /translation="MDALQLVSNRSETDVPALMHALGQQARASAHALSLASTEAKNLAL
FT                   RVAAEQLRKRTQDLLLANARDLEGAKAQDANAAFLDRLTLDDKRIEAIARGLDEIAALP
FT                   DPVGRMLARYERPNGLVIERVATPLGVIGIIYESRPAVTADAGALCLKAGNAAILRGGS
FT                   ESFFSATIIHACLTEGLRAAGLPEAAVSLVPTRDRAAVGEMLKGLDGTIDVIVPRGGKS
FT                   LVARVQAEARVPVFAHLEGVNHIFVHRAADLEKAAIIIRNAKLRRPGVCGAAEILLVDE
FT                   ACMATHLAPLTRMLLDAGCAIRGDAATQTIDPRVTAAMESDWRTEYSDAIIAVRVIDGL
FT                   NKAIAHIETHGSHHTDCIITEDQEAADRFLAEVDSAIVMHNASTQFADGGEFGFGAEIG
FT                   IATGRLHARGPVGLEQLTSFKYRVHGNGQIRP"
FT   gene            complement(469034..470167)
FT                   /locus_tag="Bind_0414"
FT   CDS_pept        complement(469034..470167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0414"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: bbt:BBta_0422 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94067"
FT                   /db_xref="GOA:B2IE43"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE43"
FT                   /protein_id="ACB94067.1"
FT                   /translation="MPSPALPSLGGFRRIVIKVGSSLLVDRGQGGVKRAWLDALAQDIA
FT                   KLHGAGADVLVVSSGSIALGRTVLGLPDGALRLEDSQAAAAVGQIALARTWAEVLGDRG
FT                   ITAGQILVTLGDTEKRRRYLNARATIGRLLDLRAVPVINENDTVATSEIRYGDNDRLAA
FT                   RVATMASADLLILLSDVAGLYTAPPADDPTAELIPLVPRINAEIEAMAGGAASAFSRGG
FT                   MRTKIEAAKIATTGGTHMVIADGRVEHPVSRIAAGAPCTWFLTGSNPVTARKKWIAGSL
FT                   EPRGVLHIDAGAAQAIANGNSLLPAGIVRVDGHFARGDCVLIRDPQGAEIGRGLTAYDA
FT                   SDAILLAGRNSKDIESLLGMPGRTALIHRDDMVLAGD"
FT   gene            complement(470191..471237)
FT                   /locus_tag="Bind_0415"
FT   CDS_pept        complement(470191..471237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0415"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP-binding protein HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: xau:Xaut_2055 GTP-binding protein Obg/CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94068"
FT                   /db_xref="GOA:B2IE44"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE44"
FT                   /protein_id="ACB94068.1"
FT                   /translation="MKFLDQARIYIRSGDGGAGCLSFRHEKFIEFGGPDGGDGGRGGDV
FT                   VALCVEGLNTLIDYRYQQHFKAKTGTHGMGKNRAGARGADCILKVPAGTQIFDEDGETL
FT                   IADLTEIGQSVCLARGGNGGFGNAHFKTSTNQAPRRANPGQEGEEMTLWLRLKLIADAG
FT                   LVGLPNAGKSTFLSTVSAARPKIADYPFTTLHPQLGVVAYGDREFVLADIPGLIEGAHE
FT                   GVGLGDRFLGHVERCRVLLHLVDAGCEHAGKAYKTIRKELAAYGNGLDEKPEIVALSKI
FT                   DTVDAETLKNQMARLKRAAKRTPLKLSAATHTNLTETLQSLLAAIDAAGAAQEAAAEPA
FT                   ATSWHPCD"
FT   gene            complement(471367..472023)
FT                   /locus_tag="Bind_0416"
FT   CDS_pept        complement(471367..472023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0416"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mex:Mext_4412 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94069"
FT                   /db_xref="GOA:B2IE45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE45"
FT                   /protein_id="ACB94069.1"
FT                   /translation="MFPDLTSDDIFRIETKRLWLRWPRVADAAAISTFASLPETAKMTA
FT                   AIPHPYPVGEAERFIFQARADNANGKGLILAITLKRPERPLIGLVSATLAGHHDLELGY
FT                   VIAPTSSGKGYATEAVKGMVNSLFSVTSAHRILANVRAINPASHRVLEKSGFTYVDSGL
FT                   DYLPARGGLHPCDRFEFDRKTWVQQHPPRGMPPMIHQTKDRQDALRASFQPSVES"
FT   gene            complement(472421..472696)
FT                   /locus_tag="Bind_0417"
FT   CDS_pept        complement(472421..472696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0417"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: azc:AZC_4093 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94070"
FT                   /db_xref="GOA:B2IE46"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE46"
FT                   /protein_id="ACB94070.1"
FT                   /translation="MAHKKAGGSSRNGRDSDGRRLGVKKFGGEAVIGGNIIVRQRGTKW
FT                   HPGSNVGIGKDHTLFALTAGQVFFQTKANGRSYISVIPPKAAEAAE"
FT   gene            complement(472737..473048)
FT                   /locus_tag="Bind_0418"
FT   CDS_pept        complement(472737..473048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0418"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: ret:RHE_CH04062
FT                   50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94071"
FT                   /db_xref="GOA:B2IE47"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE47"
FT                   /protein_id="ACB94071.1"
FT                   /translation="MFAVIKTGGKQYSVAADDIITVMTLQGEPGDAVTFDSVLMLAGEG
FT                   EPKIGAPFIAGATVSGEIVEQTRGPKVISFKKRRRQNSKRKRGHRQDLTLVKITGINA"
FT   gene            473624..475711
FT                   /locus_tag="Bind_0419"
FT   CDS_pept        473624..475711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0419"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: mex:Mext_1023 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94072"
FT                   /db_xref="GOA:B2IE48"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE48"
FT                   /protein_id="ACB94072.1"
FT                   /translation="MHFYGGVMRMRSLAAYRSTDRRGGAVELGNEPAIDTDGEQHDIFD
FT                   RRQVSLRWLAGTILTGLSGAGLIGAAIYAAFDHQSHFAEAPMLAAPPHRETAQESGING
FT                   RKGDRLVKSVDIVAAKQSFRAPMTLKIGEKEVVKTHSFTRVETTLLQASAGYGDDIPPF
FT                   NPLKLLADARNPVDVPQEPVQDDAEVSWALRDLVGQPVSTQAVLSGDEVQAQLAEQIKN
FT                   PMNAGTKLLTLPPQMLLMKTSRANPLGNGIGHNFGRSGAAAVLAYANPEDTGLNAPFSS
FT                   IDVRMVPENVTVVARSSASPQSTQSGEKLVVLRHGEAVEDILRNAGLSKDRIAAIIQAF
FT                   GARRGEAAVAEGRKLKLQFADFDGSGGEAILARLSVYADETLETTIAMTDQGRYMRVIS
FT                   RNEEPVARRRSEDTDDDDAGGMRLYESLYETALKQDIPRRIVDELVRIFANDVDFQRTV
FT                   AAGDSFSAFYDEAEEGDHLPELLYATVTTRNETFRYYRFQTPDDNGVDFYDPNGRSTRK
FT                   FLVRVPLAAEKMTSGFGTRFHPILGYSRPHTGVDWAAPIGTPIFAAGNGTVLKAGWDSG
FT                   YGRRVEIQHANGYITTYNHMSGFAKGMSEGMRVRQGQVIGYLGQTGLATGPHLHYEVIV
FT                   NGHFVDPLRVKLAQTREFDGPMLATFKRERERIDGLLALAPNATSSIVADRRGNRNRAI
FT                   P"
FT   gene            475886..476440
FT                   /locus_tag="Bind_0420"
FT   CDS_pept        475886..476440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0420"
FT                   /product="protein of unknown function DUF925"
FT                   /note="PFAM: protein of unknown function DUF925; KEGG:
FT                   psa:PST_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94073"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE49"
FT                   /protein_id="ACB94073.1"
FT                   /translation="MRFLKELTALLSCDPVRMAVLRTVRSLDLPDSWVGAGFVRDAVWD
FT                   HLHGYANRTIEGDVDVVWFDDGALSPELDRELERRLSLVDPAFKWSVKNQARMHLRNGD
FT                   AAYTSVSQAMSYWPETATAVAARIGDDGRLHINAPLGLDDLYAMHLRPTQMFISARRCI
FT                   FDQRVKEKRWLERYPLLRIVP"
FT   gene            complement(476488..477147)
FT                   /locus_tag="Bind_0421"
FT   CDS_pept        complement(476488..477147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A1314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94074"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE50"
FT                   /protein_id="ACB94074.1"
FT                   /translation="MRNHGSILGILMALLPALVTAGHAETLARKTTHMVFDIIRQGDKI
FT                   GTNSVDIDKQGDTTKVRIETSIHVKVMFIEAYRYEHVCDETWKGEQLIAFASKTDDNGT
FT                   PHRITFSMAGDRPSLDVDGTRKDVPKDIVPASLWSRTLLHRPDWFNPANGQSLRIAFHD
FT                   LGEDQVQIHGAAVKAHHYKISAQGSAFDRDLWFDGDNVLRIQLQGSDNSTIISDRR"
FT   sig_peptide     complement(477073..477147)
FT                   /locus_tag="Bind_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 25"
FT   gene            complement(477217..477939)
FT                   /locus_tag="Bind_0422"
FT   CDS_pept        complement(477217..477939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0422"
FT                   /product="protein of unknown function DUF1345"
FT                   /note="PFAM: protein of unknown function DUF1345; KEGG:
FT                   dar:Daro_0590 protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94075"
FT                   /db_xref="GOA:B2IE51"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE51"
FT                   /protein_id="ACB94075.1"
FT                   /translation="MKPVAPRAKSAALWLYTLLRPYRIGRAHPRLFIGFLTGIATGFLL
FT                   PSSLLANTRLLLAWNIGIWVYFFLSLRMIHKATPATMRQRAKETDEGKFLILVLTAVAA
FT                   FAAIASIVLELSTIKSMAASHAGWYFALTGVTILNAWFFIHLSFALHYAHEYYDAFEAE
FT                   PDQKPEDRGGLVFPGTIDPDYYDFLYFSYVIGVASQTADIGLSSRLMRRTALVHCILSF
FT                   FFNSAVLALTVNIVAGLL"
FT   sig_peptide     complement(477784..477939)
FT                   /locus_tag="Bind_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.654 at
FT                   residue 52"
FT   gene            complement(477978..478910)
FT                   /locus_tag="Bind_0423"
FT   CDS_pept        complement(477978..478910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0423"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: xau:Xaut_0205
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94076"
FT                   /db_xref="GOA:B2IE52"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE52"
FT                   /protein_id="ACB94076.1"
FT                   /translation="MTGGTLAEDFQQRLTQIAEATEKTLDHLLGPSPLPGETLRPPRFL
FT                   EAMRYASLGGGKRLRPFLLVETARLFGIEGEGVLRAASALEMIHCYSLVHDDLPALDND
FT                   DLRRGRPTTHKAYDEATAILVGDGLLTYAFDVLADPATHKDPAIRIELVLALARAAGVG
FT                   GMVGGQVLDIEAEQAKTPHTAEAVIELQSMKTGALLHYAVIAGAIFAGVSKQTREALSA
FT                   YGQALGAAFQVADDILDVEADTEALGKKAGKDADRNKATLVASLGLEAARKRRDTLSAE
FT                   AIAALDSFPEGREAHILKEAARFAATRKN"
FT   gene            478979..479689
FT                   /locus_tag="Bind_0424"
FT   CDS_pept        478979..479689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0424"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: mex:Mext_2530 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94077"
FT                   /db_xref="GOA:B2IE53"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE53"
FT                   /protein_id="ACB94077.1"
FT                   /translation="MAFLPFSRLFSIRSGRFARFVFGVLLTLGLVLGSLLVAYRFLAPV
FT                   STLMAWHEIKGDEVDRHYQPLARIAPILAASVIASEDARFCQHHGVDWQSLSEVMDKAK
FT                   ARADGPSRGASTITMQTAKNLFLWPSRSVLRKTLEIPLALLIDAVWPKRRILEIYLNIA
FT                   EWGDGLFGAEAAARHYFGKSADALDRREAALLATALPNPMRRNPASPTRLHRLLAARIA
FT                   ARAGAMGADITCLK"
FT   sig_peptide     478979..479095
FT                   /locus_tag="Bind_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.493 at
FT                   residue 39"
FT   gene            479834..480025
FT                   /locus_tag="Bind_0425"
FT   CDS_pept        479834..480025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0425"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: smd:Smed_3119 ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94078"
FT                   /db_xref="GOA:B2IE54"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE54"
FT                   /protein_id="ACB94078.1"
FT                   /translation="MAVPKRKTSRMKRGFRRSADAIKAPTYIEDKDSGELRRPHHVDLK
FT                   TGMYRGRQIFTPKVREEA"
FT   gene            complement(480156..480881)
FT                   /locus_tag="Bind_0426"
FT   CDS_pept        complement(480156..480881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0426"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="TIGRFAM: acetoacetyl-CoA reductase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   rpd:RPD_0305 acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94079"
FT                   /db_xref="GOA:B2IE55"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE55"
FT                   /protein_id="ACB94079.1"
FT                   /translation="MARVAVVSGGSRGIGAAISKALKASGYQVAATYAGNDEAATKFKD
FT                   ETGIPVYKWDVGSYKACSEGLEQVSKDLGPIEILVNNAGITRDGMFHKMTPEQWYDVIN
FT                   TNLNSLFNMTRPVIEGMRERGFGRIVNISSINGQKGQMGQANYSAAKAGDLGFTKALAQ
FT                   ENANKGITVNAICPGYIATEMVKAIPQEVLEKAILPQIPVRRLGEVEEIARAVVFLVAE
FT                   EAGFITGSTLSINGGQYFI"
FT   gene            complement(481259..482434)
FT                   /locus_tag="Bind_0427"
FT   CDS_pept        complement(481259..482434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0427"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: mex:Mext_3469 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94080"
FT                   /db_xref="GOA:B2IE56"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE56"
FT                   /protein_id="ACB94080.1"
FT                   /translation="MSSDVVIVGAARTAVGSFSGAFGNTPAHELGATVIKATLERAKVE
FT                   AADVDEVILGQVLTAASGQNPARQTAIKAGIPDSKTAWTVNQVCGSGLRAVALGLQQIN
FT                   NGDAKIIVAGGQENMSLSPHAAFLRGGTKMGDVKFTDTMMRDGLTDAFANYPMGNTAEH
FT                   IATKWQISREEQDQFAVASQNKAEAAQKEGRFNEEIIPFTVPGKKGDIIVDKDEYIRIG
FT                   ATIEAMAKLKPAFVKDGTVTAGNSSGINDGAAAVVLMSADEAKARGLTPLARIASWATA
FT                   GVDPSIMGSGPIPASRKALEKAGWKVKDLDLIEANEAFAAQAIAVNKDMGWDTSLVNVN
FT                   GGAIAIGHPIGASGARVLVTLLHEMKRRDAKKGIATLCIGGGMGIAMTIER"
FT   gene            482778..483395
FT                   /locus_tag="Bind_0428"
FT   CDS_pept        482778..483395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0428"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="TIGRFAM: polyhydroxyalkanoate synthesis repressor
FT                   PhaR; PFAM: PHB accumulation regulatory domain protein; PHA
FT                   accumulation regulator DNA-binding protein; KEGG:
FT                   bja:blr0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94081"
FT                   /db_xref="GOA:B2IE57"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE57"
FT                   /protein_id="ACB94081.1"
FT                   /translation="MDQSNNMSADKPQAQPVTIKKYANRRLYNTGTSAYVTLEDLASMV
FT                   KTGEDFVVFDAKSGEDITRSVLTQIIFEQESKGGQSLLPITFLRQLIRFYGDSMQMLVP
FT                   SYLEFTIDKLTHEQGKFRDQMMSAPLAANPIFNSLEEQTRKNMAMFNQALAMFSPFGGT
FT                   GMPLVPETSEPPAPAPEKNDIDDMKRQLDELQKKIEGLSRKP"
FT   gene            complement(483433..483867)
FT                   /locus_tag="Bind_0429"
FT   CDS_pept        complement(483433..483867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0429"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   bja:blr0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94082"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE58"
FT                   /protein_id="ACB94082.1"
FT                   /translation="MILADRTAQDIITALALKPHPEGGHFRETFRDPRSDAEGRSFSTL
FT                   IYFLLAAGETSAWHRIDAAEVWHFYAGAPLDLRITEAGKSTSHRLGADVLNGEEPQIVV
FT                   PALAWQSARSLGAWTLIGCSVAPAFQFSTFEMAPAGWQPD"
FT   gene            complement(483869..484639)
FT                   /locus_tag="Bind_0430"
FT   CDS_pept        complement(483869..484639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0430"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="KEGG: rpe:RPE_0164 hydroxyacylglutathione hydrolase;
FT                   TIGRFAM: hydroxyacylglutathione hydrolase; PFAM:
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94083"
FT                   /db_xref="GOA:B2IE59"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE59"
FT                   /protein_id="ACB94083.1"
FT                   /translation="MSAHIHQFLCLKDNFGVLVHDPESRHTAAIDAPEAGPILEALAAR
FT                   EWTLTEILITHHHQDHIGGIPGLKAEFPEARIIGPAREADKIGHLDQAVREGDQVKVGQ
FT                   LEAMVLEVPGHTSGHVVYWFEQDDILFTGDTLFAMGCGRGFEEPANILYNSLMKLAALP
FT                   GELQVYCGHEYTLSNAEFALTIEPDNVLLRDRVAEVRQLRAENRFTLPTTITIELGTNP
FT                   FLRVDEPSVQAAVGMPGGDPAAVFAELRERKNRA"
FT   gene            484897..485670
FT                   /locus_tag="Bind_0431"
FT   CDS_pept        484897..485670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0431"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: mex:Mext_2509
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94084"
FT                   /db_xref="GOA:B2IE60"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE60"
FT                   /protein_id="ACB94084.1"
FT                   /translation="MPLDVVDLRSFYTTPLGSAARRFIGQVIRQRFANCCGQSILGVGY
FT                   ATPYLEPFRADSLRVLAFMPAEQGVVNWPSSGLSSSALVSPTMMPLPDACIDRVLLIHA
FT                   LELTEHPRELMAEIWRILTPGGRILAVTPSRTGLWARLDTTPFGHGQPYSRGQLRDLMR
FT                   VTLFSPTRWTEALYMPPFQSRLVLRGAPMLERIGASLSLPGAGVQIVEATKQLYRPVIL
FT                   RQAMPQAIPQALPGLRPVLVPQAARTEKTSKAIVQ"
FT   gene            complement(485862..486563)
FT                   /locus_tag="Bind_0432"
FT   CDS_pept        complement(485862..486563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0432"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   xau:Xaut_3842 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94085"
FT                   /db_xref="GOA:B2IE61"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE61"
FT                   /protein_id="ACB94085.1"
FT                   /translation="MVTRIDGPRVAAKSRTTKQLIVFLHGYGADGNDLIAIAQQWQNVL
FT                   PDTTFVSPHAPEICALAPQARQWFPLGFPLSEDDPEAHWAGLEKARPVLDAFLDAELKR
FT                   YGLSDANLLLVGFSQGTMLALHAGLRRPQAPAGILGYSGMLVGPEHLASAPARLVNGQR
FT                   PPILLIHGSQDDVISAEAMFVAADQLAEAEIPCQWHLSTGIGHGIDGGGLQHGAFFALQ
FT                   SLKIKRPNAAV"
FT   gene            487082..487984
FT                   /locus_tag="Bind_0433"
FT   CDS_pept        487082..487984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0433"
FT                   /product="glutamyl-tRNA synthetase class Ic"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   rpc:RPC_4885 glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94086"
FT                   /db_xref="GOA:B2IE62"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE62"
FT                   /protein_id="ACB94086.1"
FT                   /translation="MTHACPQSAFRFAPSPNGYLHLGHAFSALENERLARLNGGRLFLR
FT                   IENIDVDRCRPEYERAILEDLTWLGIALEPEVRRQSEHFDDYAQALDRLARMGLIYPCF
FT                   CSRTDIMQKIRERAFWARDPDGSPLYPGTCKHLPKDKIQERLEAGEPASYRLDMGKALN
FT                   LIGYRLGWTEFGSGMVGRFVQASPQKWGDTILARKDIATSYHIAVVVDDALQRITDIVR
FT                   GEDLFQATSLHRLLQSLLGLPEPAYHHHGLLRDASGQKLSKSLRAKSLRALREEGLSPK
FT                   AVRAKLAPLPPLIAALQTV"
FT   gene            complement(488008..489309)
FT                   /locus_tag="Bind_0434"
FT   CDS_pept        complement(488008..489309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0434"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="KEGG: bbt:BBta_7633 4-hydroxy-3-methylbut-2-en-1-yl
FT                   diphosphate synthase; TIGRFAM:
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase;
FT                   PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94087"
FT                   /db_xref="GOA:B2IE63"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE63"
FT                   /protein_id="ACB94087.1"
FT                   /translation="MTTDSDTALLFDPALALPSGPAPRRTSVGVRVGSGPGSVQVGGGA
FT                   PIVVQSMTNTDTADIDSTVEQVAALARAGSELVRITVDRDPAAAAVPYIREKLDKMGCL
FT                   VPLVGDFHYIGHRLLTEYPACAEALAKYRINPGNVGFREKRDRQFSTIVEIAAKYDKAV
FT                   RIGANWGSLDQELLTSLMDKNAGSAAPLSVGAVTREAMVQSALLSAARAEELGLKRDRI
FT                   ILSAKVSSVQDLITVYRMVAARSDYALHLGLTEAGMGSKGIVASSAALGILLQEGIGDT
FT                   IRVSLTPQPGGDRTLEVTVAQEILQTMGFRTFVPLVAACPGCGRTTSTVFQELARDIQT
FT                   YIREEMPLWRSRYPGVESLNVAVMGCIVNGPGESKHADIGISLPGTGETPSAPVFIDGE
FT                   KTTTLRGEGIAAEFKTIVQDYIERRFGGAKSAAE"
FT   gene            490212..491099
FT                   /locus_tag="Bind_0435"
FT   CDS_pept        490212..491099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0435"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   mex:Mext_3274 UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94088"
FT                   /db_xref="GOA:B2IE64"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE64"
FT                   /protein_id="ACB94088.1"
FT                   /translation="MTTPIRKAVFPVAGLGTRFLPATKSVPKEMLTVVDRPVLQHVVDE
FT                   AREAGIEHFIFVTGRNKAVIEDHFDIAYELQDTLLKRNKIKEYDALIADLPKPGATSFT
FT                   RQQAPLGLGHAVWCARDIVGHEPFAVLLPDMITLKDDGKGRCLAQCIAAYNKHGGNIIA
FT                   TEEVPADETHQYGVVGLGKDYGDTFEITGMVEKPAKGTAPSNLIISGRYVLGPEIFEIL
FT                   EHGEKGAGGEIQLTDGMKTLAESQAFHGVRFSGRTFDCGSKLGFLAANVAFALANPEIG
FT                   PGFAADLKKIVGTL"
FT   gene            complement(491257..491640)
FT                   /locus_tag="Bind_0436"
FT   CDS_pept        complement(491257..491640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94089"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE65"
FT                   /protein_id="ACB94089.1"
FT                   /translation="MAKNGDEKDLPHTFSQRGKGLGHPHPPSVIGSSGDAYTSDAWIFS
FT                   PTGQSETQVSRQGFDRVPASGFEKPAFENLTTAFVRKVPLAMSLGQKLRDLYPLPETND
FT                   QASKLSVPFDVLIQRLAAKLGES"
FT   gene            492069..492773
FT                   /locus_tag="Bind_0437"
FT   CDS_pept        492069..492773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0437"
FT                   /product="Spore coat polysaccharide biosynthesis protein F
FT                   CMP-KDO synthetase-like protein"
FT                   /note="KEGG: mag:amb3806 spore coat polysaccharide
FT                   biosynthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94090"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE66"
FT                   /protein_id="ACB94090.1"
FT                   /translation="MRPVALVPVTLTEEDCGKLVLYEVEGQPLLTHLFGRIGLAKNPDG
FT                   LLVVTTQEEADDALAALCAAHEIPCYRGESGDRLRLLVEALKASGKKGAVLIHPDSPLI
FT                   DPAVIDHVANLVELTDGMLDFIGTTLTPTYPLGMDVEGFTLAALQDSDHRCADAEERAQ
FT                   GTFYLRSHSKLYRILSVKPEDGLHRPDLSLAVRSHEDLPKFAAILAHFKGRQDYTMAEL
FT                   IAFLDQSEALER"
FT   gene            complement(492805..493110)
FT                   /locus_tag="Bind_0438"
FT   CDS_pept        complement(492805..493110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94091"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE67"
FT                   /protein_id="ACB94091.1"
FT                   /translation="MALSAIPVLSPERLEELRVKIVPYLYTTGAPPDHAVQAAKIEQDL
FT                   GLTRDEIRAIHHHILLLGYVAERARSGFIGLSGKGQRIARQLIDPTIEEPEDDLDD"
FT   gene            complement(493213..494298)
FT                   /locus_tag="Bind_0439"
FT   CDS_pept        complement(493213..494298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0439"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: azc:AZC_2414 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94092"
FT                   /db_xref="GOA:B2IE68"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE68"
FT                   /protein_id="ACB94092.1"
FT                   /translation="MSLTLTPNATIGILGGGQLGRMLALAAARLGLKSRIYAPEADSPA
FT                   FVVAAGHMLAAYEDEEALAQFAAQVDVITYEFENVPARTAAVLAKIAPVLPGEAALAAS
FT                   QDRLVEKDFMASLGIATAPYRQVDDVDTLKRALAEFGRPAILKTRRFGYDGKGQVLIGD
FT                   DADPAAAFHALGGQPAILEGFVPFSKEISVVAARGVQGEFAAFDVCENIHRHHILQSTH
FT                   VPARVDAITATKAVNMAKTIADALDYVGILAVELFLVEDPASETQLLVNEIAPRVHNSG
FT                   HWTEGGAVTSQFEQHIRAIAGWPLGSTKRHGSAVTMQNLIGDDVENYLHILAEPGACLT
FT                   LYGKQEARTGRKMGHVTRIIP"
FT   gene            complement(494305..494802)
FT                   /locus_tag="Bind_0440"
FT   CDS_pept        complement(494305..494802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0440"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bra:BRADO1206 phosphoribosylaminoimidazole
FT                   carboxylase catalytic subunit (AIR carboxylase) (AirC);
FT                   TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94093"
FT                   /db_xref="GOA:B2IE69"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE69"
FT                   /protein_id="ACB94093.1"
FT                   /translation="MSDKAKLIALIMGSQSDWDTMRHAARVLNELEISFEPLIISAHRT
FT                   PDRLVQFATGAKAKGFKVVIAGAGGAAHLPGMTAAFTTLPVLGVPVESKALSGQDSLYS
FT                   IVQMPGGIPVGTLAIGKAGAINAALLAASILSLSDNALDQRLTAWRAAQTDAVALSPRD
FT                   ES"
FT   gene            complement(495190..498447)
FT                   /locus_tag="Bind_0441"
FT   CDS_pept        complement(495190..498447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0441"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   cph:Cpha266_1840 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94094"
FT                   /db_xref="GOA:B2IE70"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE70"
FT                   /protein_id="ACB94094.1"
FT                   /translation="MNTMLRKDNVARENASSCGKPEKDVPPGPHAPVESRPSSDRTLSQ
FT                   KFLMTALDYHRAGRLDQAADLYQRILLAEPDHFLCLHHLGLIAHQKGDLDTAIAWIEKA
FT                   IRVKPDYAEALANLAALYRAKGLLTQAVETGRTAVLHGQDHVPAHCNLGGALEDQGEWE
FT                   AALACYRRAVAINPAFIEGAMNAANVLRRLHRHEEALQTCEALIACRPDAAEPHMVLGN
FT                   ILRDLGQFDAALAAYEQALALRPDFAPVYNSLGNLLQRRGQYQEAHDAYATAIQLQPNL
FT                   AQAHAGLGVTLDSLGHPDQAIEAFRMALVYDPKRIDLRLWLHHRRRAICDWTGIMEEEA
FT                   ELLRLFKTEPHVGAPFPLISMDTSAAEQYRLCRAFGQSYDNKRQAYTHSPRPRGSRKVR
FT                   IGYLSNDFYRHATALLMVELFERHDRDQFEIIAYSHGPDDSSELALRTREAFDRFVDIR
FT                   ALSDTEAAALIHREEIDILVDLKGYTNDARTAILGLRPAPIQVNFIGFPGTMGVDFIDY
FT                   IIADAFVLPMDQQPFFSEKIVHMPFSYQPNDTRRMIADLTPTRADCGLPEDGFVFCCFN
FT                   NSYKLTPVFFDLWMRLLQAVPGSVFWLLESGPLVRENLQHEAEKRGIDPNRLVFAPRIA
FT                   IPDHLARHRLADLFLDCLPYNAHTTTSDALWAGLPVLTCAGETFAGRVAGSLLQAVGLP
FT                   ELITTSLADYEARALHLARNPEDLRILRQTLLRQRKSAPLFDIALYTRHLESAYRQMWT
FT                   RFEDGLAPEAFAVAPAAPEKDTASDAYKEAHIAKTATVARITFETCPLCQGSHHEPLLV
FT                   ADVTRDPLYRSILPDKVEWRRCQDCGHVFAEGHFSPIVQSTHFARTLPAEAVGHDMEKR
FT                   RLQSGAIVERMDHWLPAAKGAWLDVGFGDASLLFAAEEWGFDPVGLEHRKAHADILAGL
FT                   GYEAHQGEIIDHDWPERFSVISLSRSLERMADPRLGLRTARRFLRRDGALFLSMRNRGT
FT                   MVWRLLEINQDNPYWGDLRAVHLFDRERISAVLIEENFRPLSFMIDERYPLGMGIIAVR
FT                   DDFPLHADQTMNTPASRGSAPDFALMDTERDTDERPH"
FT   gene            complement(498528..498746)
FT                   /locus_tag="Bind_0442"
FT   CDS_pept        complement(498528..498746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0442"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   rpb:RPB_1449 protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94095"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE71"
FT                   /protein_id="ACB94095.1"
FT                   /translation="MVDRLSEDERISLQTELEHLRQEHRDLDAAIEALLHLSTTDRLQV
FT                   QRLKKRKLVLRDRIVFIEDLLTPDIIA"
FT   gene            499167..499352
FT                   /locus_tag="Bind_0443"
FT   CDS_pept        499167..499352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0443"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   xau:Xaut_2598 protein of unknown function DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94096"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE72"
FT                   /protein_id="ACB94096.1"
FT                   /translation="MSLENHLAMLEQRHDALEKELAQETLHPATDPLKLAELKRRKLLL
FT                   KDEITKLKGEPLSAVS"
FT   gene            complement(499499..500317)
FT                   /locus_tag="Bind_0444"
FT   CDS_pept        complement(499499..500317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0444"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: xau:Xaut_0194
FT                   exodeoxyribonuclease III Xth"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94097"
FT                   /db_xref="GOA:B2IE73"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE73"
FT                   /protein_id="ACB94097.1"
FT                   /translation="MRLSLATWNINSVRLRIDLVTRFLTEQAPDVLCLQETKCRDSEFP
FT                   LAAFHKLGYSHIAINGQKGYHGVAIVSKIPFAESGKRDFCAKGDARHITVTLLPETTPA
FT                   RPINLHNFYVPAGGDEPDPEINPKFAHKLAFLDEMAEWMRTDLIAHRDAIIVGDLNIAP
FT                   LETDVWSHKALLKVVSHTPIEVEKLGRVINAGPWIDALRHHVPPEEKLYTWWSYRSPDW
FT                   SKADKGRRLDHIWVSASLKQHLDGLTILRDSRGWDRPSDHVPVTVQLNLD"
FT   gene            complement(500692..501498)
FT                   /locus_tag="Bind_0445"
FT   CDS_pept        complement(500692..501498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0445"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: mex:Mext_4033 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94098"
FT                   /db_xref="GOA:B2IE74"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE74"
FT                   /protein_id="ACB94098.1"
FT                   /translation="MKRTMAILARRQASPFIGQATAGLLLCSALLGLFGGVPAWAEANP
FT                   PRPDKPLPEKASPAKPATPKPPVPTAPTTKPVAAQTAASAAPKPFVPLDQATAIQKANA
FT                   YFSSAITMVGDFVQVGSDGRRTEGKLYVQRPGRLRFEYAAPATLEIVADGLSLAVHDRR
FT                   TATKDVYFISQTPLKFLLKDQVDLAQDVKVVEVQSDPSAVTIIIEDKATFGGTSRINLV
FT                   FDPVKFTLKQWKVTDPQGYETLVSLFNLDLTKKPDPALFQLTQDHL"
FT   sig_peptide     complement(501373..501498)
FT                   /locus_tag="Bind_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 42"
FT   gene            501734..502465
FT                   /locus_tag="Bind_0446"
FT   CDS_pept        501734..502465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0446"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   xau:Xaut_1494 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94099"
FT                   /db_xref="GOA:B2IE75"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE75"
FT                   /protein_id="ACB94099.1"
FT                   /translation="MDETAPDIVKPGLSRPDLEGRSYAPLSCGKTVYLVVLLHGLGVDG
FT                   DDLIDIAVNWQPSLLKAEFLAMHAPFPFDQGPTGRQWYSVADRSPEKIMEGLRKAEGIL
FT                   NQFLDESLAKRRLDDRHLALVGFSQGAMVALHTGLRRRKIGAIVSFSGALHGAELLPAE
FT                   IRSRPPVLLIHGNEDQVVPYERMTEAKAALKALDVPVKSMTRKGLGHSIDEVGIAAVGD
FT                   FLHDSLVPKKAAHDEHDDHDH"
FT   gene            complement(502598..503755)
FT                   /locus_tag="Bind_0447"
FT   CDS_pept        complement(502598..503755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0447"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sfu:Sfum_2255 glycosyltransferases probably involved in
FT                   cell wall biogenesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94100"
FT                   /db_xref="GOA:B2IE76"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE76"
FT                   /protein_id="ACB94100.1"
FT                   /translation="MVIVPVKGAEPTTRSFFAKLRGQSYEDFHILAAIESAEDPAFELI
FT                   ASLPRSDPQDNTIALPQVTAVIAGKSEYGGQKVANLLAALDHIDPCDDIVVFTDADTWP
FT                   DPHWLERLVAALVNTNYEAVTGYRWMVPTNSNLATQLVAAANTSIVTLPRLPEIANMCW
FT                   GGTMALRRETLEKLDLRRYWTGAVSDDLQMTRACADHGIKIFSPRESLLLSPISFTWQS
FT                   ALAFGTRQYRIIFTHAPLLWTFAAFCLLVPILAAVLACLLAVRGDIGAIAMLAIAMLAG
FT                   EIRFWCRRRIATALWQADDSHDYPLTSRADRLLRPLWWMFHALCILAAPWSRRIKWAGI
FT                   DYLIKGPQDVSILHRDYPNPSGQPKRSPCEPAGHRALPSLRDSNP"
FT   gene            504108..505031
FT                   /locus_tag="Bind_0448"
FT   CDS_pept        504108..505031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0448"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bra:BRADO5242 hypothetical protein; putative
FT                   SAM-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94101"
FT                   /db_xref="GOA:B2IE77"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE77"
FT                   /protein_id="ACB94101.1"
FT                   /translation="MDIPLCPITGEPARRLVQWVDARLLTDLWRITFKTDSRPSFRGVE
FT                   RFGLWESPCGLYFFDPLREGDAGFYHDFYTRLRALSLFGTEDQRAEFAIAAKSIAEGAR
FT                   VLDVGCGLASFRHCVPQAHYTGLDPNLSLTIPGVDLRKESITDHVVTHPGEYDAVCAFQ
FT                   VIEHLDDPRTFFHRMIEAVKPGGLVIIGVPHVPSPMTRIPNFILNAPPHHLTWWTVEAL
FT                   ATLAKGGGLDVESIEEMPWSDPDAPIYWIEKSSFIKGRDQHFRGHWLWHAAAFGGLIGG
FT                   YLLNALFKTPSTVKGGGLLLIARKPG"
FT   gene            complement(505107..505814)
FT                   /locus_tag="Bind_0449"
FT   CDS_pept        complement(505107..505814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0449"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: osa:4352850
FT                   Os12g0628400"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94102"
FT                   /db_xref="GOA:B2IE78"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE78"
FT                   /protein_id="ACB94102.1"
FT                   /translation="MYRIGPKSGAVFGTDPILLKGARMQNTAQNLANDPDHLSASPRLF
FT                   ENALLDKLSRVHWSVPLFVYVPIVLGLAALSLHLLPVLTVIGGMVLGYAIWTITEYLGH
FT                   RFLFHWQYPGAIGKRIHFLIHGVHHVHPNDPLRLVMPILLSGPIMLAVHGILTNIFPLP
FT                   FAYPVLAGFITGYLIYDMTHYYLHHAEPKTSLGIFMRRFHMLHHFRDPNRGFGVSVPWM
FT                   DYVFGTQHIRPKS"
FT   gene            complement(505981..506937)
FT                   /locus_tag="Bind_0450"
FT   CDS_pept        complement(505981..506937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0450"
FT                   /product="peptidase U6 penicillin-insensitive murein
FT                   endopeptidase"
FT                   /note="PFAM: peptidase U6 penicillin-insensitive murein
FT                   endopeptidase; KEGG: xau:Xaut_3098 peptidase U6
FT                   penicillin-insensitive murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94103"
FT                   /db_xref="GOA:B2IE79"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE79"
FT                   /protein_id="ACB94103.1"
FT                   /translation="MPAISARNEKLWWPRLFTRPMALTAFMVLANFANAQDRGSIDPKP
FT                   LAPLEHISASTPAKELFGRERTPTPVAARTIGFYSHGCLSGGQALPVNGPAWQVMRLSR
FT                   NRNWGHPALLAFLESFARKVPSVSHWAGILVGDMSQPRGGPMITGHASHQIGLDADIWL
FT                   APMPNHELTRQERENMSSTNVVRADRLDIDPATWTPDHLAVIRAAAQSSEVQRIFVNAA
FT                   IKKAICRQATGDRSWLNKVRPYFGHDYHFHVRLACPAGEPACRDQDPVPPGDGCDASLA
FT                   WWFSDEVLHPPPRPYKPKPPLTLAQLPAECALVLRMQ"
FT   sig_peptide     complement(506830..506937)
FT                   /locus_tag="Bind_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            complement(506970..508244)
FT                   /locus_tag="Bind_0451"
FT   CDS_pept        complement(506970..508244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0451"
FT                   /product="Ceramide glucosyltransferase"
FT                   /EC_number="2.4.1.80"
FT                   /note="KEGG: mlo:mlr5650 ceramide glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94104"
FT                   /db_xref="GOA:B2IE80"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE80"
FT                   /protein_id="ACB94104.1"
FT                   /translation="MDTVLKGTYRETAILDTTDEAKGQVTTIVWMVLVYGAALWWVLSW
FT                   FVLFVNLCGALIQPFIQRRRLPQQPPGFCPPVSVIAPIKLLDPGFERAFGSLFGLDYPD
FT                   YEILVGAAEADSPALQAAQTIAARHETRACRFLQSESTEAVSPKLNVLSRPLAEARHDF
FT                   ILTKDSNITFTPDTLRALMRMVTPDIGLVVMVPVAVRAKSLAGEIEAFLINGHARLLLT
FT                   ASAFGQGFGVGKVMLFRRSDLAKAGGFASISHSLAEDSALSKGLAAIGLRTVFAPITVE
FT                   QETGARGFRDIYERQSRWAIIRRKEEPASFPLEPLSSPLPAALAAIPAASLLGLSGGFG
FT                   FGMTLLVWFVLEVLCAKIKGWEVSAWTPLAFLGREILALAAWLRAWTTHDVVWAQGRYD
FT                   ARHGARAATPKTQSDGIKPKLGIKI"
FT   gene            508434..509300
FT                   /locus_tag="Bind_0452"
FT   CDS_pept        508434..509300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0452"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: bbt:BBta_0080 formamidopyrimidine-DNA
FT                   glycosylase/DNA-(apurinic or apyrimidinic site) lyase MutM;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94105"
FT                   /db_xref="GOA:B2IE81"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IE81"
FT                   /protein_id="ACB94105.1"
FT                   /translation="MPELPEVETVRRGLAPVMVGASFTTVEQRRADLRFPFPDNFAARL
FT                   EGRRVEALGRRAKYLLADLDDAQVLVMHLGMSGSFRIEKAGDLASPPPGKNAAHDHVVF
FT                   GLSTGTRIIYNDPRRFGFMHLIARQDLAGHPLFRNVGIEPLGNELEGALLARLFAGKTT
FT                   PLKTALLDQTLIAGLGNIYVCEALHRAGLSPRRAAGTLAGKKGQPTERAHRLSEIIRAV
FT                   LEEAIEAGGSSLRDHRQADGALGYFQHRFRVYDREAEPCPREGCGGTIKRIVQAGRSTF
FT                   FCAKCQR"
FT   gene            complement(509389..510165)
FT                   /locus_tag="Bind_0453"
FT   CDS_pept        complement(509389..510165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0453"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mex:Mext_0302 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94106"
FT                   /db_xref="GOA:B2IE82"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE82"
FT                   /protein_id="ACB94106.1"
FT                   /translation="MSSLVSRRLLLLGTASLSALALAGCAEDQEQPEASLATPNPIVSN
FT                   PLAAPANKSTAAGPAKPGDFAAMYGPINDDKFPIPGTKLSEIDPAFLRKEVDYKTNEPV
FT                   GTIVIDPQHHYLYHVEEGGKAMRYGVGVGREGFAWSGEATINFKREWPDWYPPKEMLQR
FT                   QPELKKKMAQLQSGLGMAGGPGNPLGVRAMYLWQGNVDTLFRIHGTVEPWSIGKSVSSG
FT                   CIRMVNQDVVDLYQRVPVGTRVIVLGNKQPATVARL"
FT   sig_peptide     complement(510085..510165)
FT                   /locus_tag="Bind_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.896 at
FT                   residue 27"
FT   gene            complement(510452..512272)
FT                   /locus_tag="Bind_0454"
FT   CDS_pept        complement(510452..512272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0454"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: xau:Xaut_2798 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94107"
FT                   /db_xref="GOA:B2IE83"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE83"
FT                   /protein_id="ACB94107.1"
FT                   /translation="MNLRNIAIIAHVDHGKTTLVDRLLQQSGAFRENQRVAERVMDSND
FT                   LEKERGITIMAKATSIAWKDTRINIVDTPGHADFGGEVERILSMVDGAIVLVDAAEGPM
FT                   PQTKFVVGKALKIGLKPIVAVNKVDKPDARITEVVNEVFDLFAALDATDEQLDFPILYG
FT                   SAKQGWMAESPEGPKDGMGPLFDLVLKHVPAPTIGEGGFRMLGTLLESNPYLGRLITGR
FT                   IFSGSVKPNQAVKVLDRNGNVVEQGRVSKILAFRGIERAPIEEAEAGDIVAIAGLEKFN
FT                   VADTLCAPEISEPLQAQPIDPPTLSMTFLVNDSPLAGTEGDKVTSRMIRARLMKEAEGN
FT                   VALKVEDSPGGESFIVSGRGELQLAILIETMRREGFELGVSRPKVVYQRGEDEKQLLEP
FT                   IEEVVIDVDEEHSGVVVQKMAERKADMIEMRPSGGDRLRLVFHAPTRGLIGYQGELLTD
FT                   TRGTAIMNRLFHSYLPWKGEITGRRNGVLISNDNGESVAYAMWKLEDRGPMMIDPGQKV
FT                   YRGMIVGEHTRDNDLEINVLKGKQLTNIRAAGKDEAVKLTPPIRMTLERALAYIEEDEL
FT                   VEVTPKSIRLRKTLLDPNDRKRASRTKESA"
FT   gene            complement(513147..514844)
FT                   /locus_tag="Bind_0455"
FT   CDS_pept        complement(513147..514844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0455"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /note="TIGRFAM: Na/Pi-cotransporter II-related protein;
FT                   PFAM: Na+/Picotransporter; KEGG: azc:AZC_2290 putative
FT                   Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94108"
FT                   /db_xref="GOA:B2IE84"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE84"
FT                   /protein_id="ACB94108.1"
FT                   /translation="MDATLTLLNLAGAVALLLWGVHMVQSGVQRGFGPNLRRGLSQAFS
FT                   NRLKAFATGVGVTAVLQSSTATGLMTASFAAEGLIGLVPALAIMLGANVGTTLIVQVLS
FT                   FDIGPLAPLLLCIGVVMFQRHGTATRTHDLGRVAIGLGLMLMALGNLLTIITPYEDVPS
FT                   LRLFLGAIATAPVIALLVGALVTWAIHSSVAVVLLVMSFASKDVIPLSTALAMVLGANI
FT                   GSALNPVLETTTAKDVTGRQVAMGNLLNRLAGAIVVMPFLDTISVWMLLLDPASSRAVA
FT                   NFHTLFNGAIALILLPLLDLVAKALRLLLPPRFEAQDPSRPLYLEETAKETPAIAIAGA
FT                   TREALRMADVLEEMLRGAMQGMQQNDYRRITETRRMEDVVDALNTAIHNYLTDLDAESL
FT                   SEEDDQRLFSILTFTTNLEHAGDTLDRDVMALAVKKLKRGIVLSSQGTADLQALFERLS
FT                   TNLRLATTVFMTHDLREARTLAHEKTLFRDFEREASEAHIQRMRSQKSESIEASALHLE
FT                   LLRALKAVNDKLVAAAAYPRLEAEGELHNSRLRTRPGSVPPTPENDEK"
FT   sig_peptide     complement(514764..514844)
FT                   /locus_tag="Bind_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.701 at
FT                   residue 27"
FT   gene            complement(515013..515738)
FT                   /locus_tag="Bind_0456"
FT   CDS_pept        complement(515013..515738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0456"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   mex:Mext_4827 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94109"
FT                   /db_xref="GOA:B2IE85"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE85"
FT                   /protein_id="ACB94109.1"
FT                   /translation="MTPDPIIDVALNAEDLTERVALWIANCVALAGRPVSLCLSGGSTP
FT                   KRLYALLGSEGFRAAIDWTQLHIFWGDERFVPYDHPDSNYKMTHEAWLAHVPIPRDQIH
FT                   PIPTDAGSPQKAAALYAKTLQNFYGATQFDKDRPLFDINLLGIGEDGHTASLFPGTIAL
FT                   DEREAWVTAIEGAASHPRISLTYPALGSSRTIVFLAAGKAKQTILKRVLAHDQTLPAAR
FT                   IETHGRILLYTDKDAVAEA"
FT   gene            complement(515796..516644)
FT                   /locus_tag="Bind_0457"
FT   CDS_pept        complement(515796..516644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0457"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: nha:Nham_3274 Cof protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94110"
FT                   /db_xref="GOA:B2IE86"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE86"
FT                   /protein_id="ACB94110.1"
FT                   /translation="MSDTVTPISLFISDVDGTLLTPDKSLTPATIAAVQRLHALGLPFT
FT                   LVSSRPPQGFAMLIEPLELNAGLKLPLAAFNGGMIIDPQLTCLGIDLLPRECTQETIET
FT                   MRAQGLEVWLYTETGWYVTEPDGAYVTHEIHAIKAKPITVADFSGLIDKAAKLVGSSKD
FT                   FAKVVACEQVLAQKLQGKANAHRSQAYYIDVTPLGADKGHAVEKIASICGIPLAEVAVL
FT                   GDMENDLPMFATAGVAIAMGNATEAVKAKADAVTSDNQHDGFAEAVTSFILPRVRSRPK
FT                   I"
FT   gene            complement(516715..518322)
FT                   /locus_tag="Bind_0458"
FT   CDS_pept        complement(516715..518322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0458"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: mex:Mext_2523 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94111"
FT                   /db_xref="GOA:B2IE87"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE87"
FT                   /protein_id="ACB94111.1"
FT                   /translation="MNGAAPRSPVSECSPETVTAPACVFVIFGASGDLTRRLLMPSLLN
FT                   LAREGLLSSDFCIIGVDHHEKTDESFREAIVSTITKTSQAGAEKDEGATTADATALAFL
FT                   RQRLYYHTGDFTDPATYAGLEKKLASLAGTMHGQAAQNPANAVFYLATAPRFFETIIAQ
FT                   LGASGLARQRDRAFRRIIIEKPFGRDLASARALNAAILHEVDEAQIYRIDHFLGKETVQ
FT                   NIMVLRFANFMFEPIWNRDHIDMIEITAAETVGVEGRGRFYETTGALRDMVPNHMFQLL
FT                   SMIAMEPPNSFDADAIRTEKAKVIEAVRRYSPQEAMANAVRGQYGEGEILGQKITAYRA
FT                   SETVDPASMTETYAALKLWIDNWRWQGVPFFIRTGKALAHRRTEIVVHFKKAPGVLFRE
FT                   LDACDYSPGRMILHIQPDEGVSLRFVAKRPGRKVTLANVEMDFSYADYFKANPSTGYET
FT                   LLYDCLIGDPTLFQRADNVEAGWAVVQPFLDGWADRELGTLSPLEIYPAGGEGPAKADA
FT                   LLAASGHAWRALESSHQS"
FT   gene            complement(518319..519323)
FT                   /locus_tag="Bind_0459"
FT   CDS_pept        complement(518319..519323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0459"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; KEGG: bra:BRADO5810 6-phosphogluconate
FT                   dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94112"
FT                   /db_xref="GOA:B2IE88"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE88"
FT                   /protein_id="ACB94112.1"
FT                   /translation="MQLGIIGLGRMGGNIARRLTRAGHQCVVYDAKPEIAQGLAKEGMT
FT                   PARDLAELVQLLAPPRAIWIMLPAGPITEEAVETLGRLLSSGDALIDGGNTYYKDDIRR
FT                   AAALATRGIHYLDVGTSGGVWGLERGYCMMIGGPKDAVAGLDPIFKTLAPGIGDITRTP
FT                   HREGRDPRAEQGYIHAGPAGSGHFVKMIHNGIEYGLMQAYAEGFDILRNKASEALPENE
FT                   RFDLDLADIAEVWRRGSVVASWLLDLTAISLAESGDLAHYEGAVADSGEGRWTLEAAIE
FT                   EAVPANVLAASLFARFRSRQDHTFGDKLLSAMRFQFGGHVEVKEPGTAADAPK"
FT   gene            complement(519488..521584)
FT                   /locus_tag="Bind_0460"
FT   CDS_pept        complement(519488..521584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0460"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: mex:Mext_4501
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94113"
FT                   /db_xref="GOA:B2IE89"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE89"
FT                   /protein_id="ACB94113.1"
FT                   /translation="MSSVQNPATESLSPANTAQALDQLCINTIRTLTIDAVQKANSGHT
FT                   GAPMGLAPVAYTLWQKFLRYDPTDPTWPNRDRFVLSVGHASMLLYSLIHLGNIRIPGTQ
FT                   EPAVSLEDIKNFRQNGSRTPGHPEYGFTIGVETTTGPLGAGCGNSVGMAIAGRWQAARY
FT                   NKPGQTLFDYDVYTLCSDGDLMEGVACEAASLAGHLQLSNLCWIYDSNHITIEGKTDLA
FT                   FSEDVAKRFESYGWNVLHVEDANDCDATTAALTTFKQTNDKPTLIIVHSIIGYGSPHKQ
FT                   NTSAAHSDPLGEEEVRLTKRFYNWPEDAQFLVPDGVLEHFAGSFGQRGKTMHAQWSNLF
FT                   DQYRQADPQTAGQLDTMFARQLPENWDKNLPTFPADAKGMATRDASGKVLNVLAENCPW
FT                   LVGGSADLAPSNKTKLVFEGAGALEPGNPGGRNVHFGIREHAMGAIVNGLALCDLRAFG
FT                   ATFLVFSDYLRPALRLSALMELPVFFVFTHDSIGVGEDGPTHQPIEHLASLRTIPHLIT
FT                   LRPADANETVEAYRVIFNQTARPAALALSRQALPVIDRTIYGSAEGVARGAYILADTEG
FT                   DAPKVILLASGSEVSLCLEVFERLKKDGKGARVVSMPSWELFEQQESTYRDTVLPPAIS
FT                   ARVAVEQASTFGWERYVGRSGEIIGMHGFGASAPYKALQNRFGFTVDKVLEAALAQLAS
FT                   TPAS"
FT   gene            complement(522152..522874)
FT                   /locus_tag="Bind_0461"
FT   CDS_pept        complement(522152..522874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0461"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /note="KEGG: scl:sce0923 haloacetate dehalogenase; TIGRFAM:
FT                   haloacid dehalogenase, type II; HAD-superfamily hydrolase,
FT                   subfamily IA, variant 2 (HAD-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94114"
FT                   /db_xref="GOA:B2IE90"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE90"
FT                   /protein_id="ACB94114.1"
FT                   /translation="MGATSLLARTKIVQAAPSPIRAIAFDGFPIFDPRSVPMLARDMLG
FT                   ERGELLAAQWSNKIFSYSWLLTAAGHYQDFRTLADTTLSYTAHAMDLTLDDNTRQRLIN
FT                   QYESLDIWPDVKPALERLRTANIRLAFLSNLGATTLMANMNRNGIASYFEAPISTDRVK
FT                   RFKPAPEAYKMAVDAFGLPREQIGFAAFGGWDAIGATWFGYRTAWVNRLGLPAEPFDIR
FT                   PEITSRGMEGVLTLAGLT"
FT   gene            complement(523013..523630)
FT                   /locus_tag="Bind_0462"
FT   CDS_pept        complement(523013..523630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0462"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   scl:sce6962 probable glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94115"
FT                   /db_xref="GOA:B2IE95"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE95"
FT                   /protein_id="ACB94115.1"
FT                   /translation="MPESPNLTLYGLRLSGHSHRAELMLSLLNLSYHFHAVDLAAGEQH
FT                   TDEFHRLNVFETVPVLQDGDVTIADSVAILVYLALRYDPSRMWLPSEPSAAAQVQRWLS
FT                   VAQGPVFNGPCTARLIKIFGLPGDYEHAAAESKRLLERLDETLTQSPFLTGTTITLADV
FT                   AIYSYIAKAPEGEVSLEPYQNVCAWLNRVEALPFFLPMPAAN"
FT   gene            523752..524654
FT                   /locus_tag="Bind_0463"
FT   CDS_pept        523752..524654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0463"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mex:Mext_4490 LysR
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94116"
FT                   /db_xref="GOA:B2IE96"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE96"
FT                   /protein_id="ACB94116.1"
FT                   /translation="MDRLDNLSTFVAVAEQGSFIAASRQLGRSTTAVSRAVAVLEDVLG
FT                   TQLLTRTTRAVALTQAGQRTLEQARRILADYAQLRDAADGNATPSGLITITAPEMFGRL
FT                   HVLPLVESFMAAHSNVEISLLLLNRMVSLIDEGVDLGVRIAHLSDSSLRAIRLGSVRQV
FT                   LCASPDYLAMAGTPLHPKDLANHRVIAIMGARPLPFRWRFRSSTNPRSVLVKPQLVVNS
FT                   VQAALEAASRGAGITRVLSYQSAPLEEIGALRRLLIAHEPPSIPIHLVYPVGRYLPSRI
FT                   RMFIDHAVAALRGRFPEVE"
FT   gene            complement(524717..527383)
FT                   /locus_tag="Bind_0464"
FT   CDS_pept        complement(524717..527383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0464"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mex:Mext_2101
FT                   cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94117"
FT                   /db_xref="GOA:B2IE97"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE97"
FT                   /protein_id="ACB94117.1"
FT                   /translation="MRTTSHYTALDHIPEPVRIFTARRSAELAGLALIGGIVGLALALT
FT                   SWSVQDPSFNHAADGPIRNFLGAPGAVAADLLMQMLGLGVLACLLPPGFWGWRLLTTHK
FT                   LDRLGLRLVLWLAGMACAAGLASLLPPTHSWPLPTGLGGVLGDAVLFLPQKLFASFRPG
FT                   LFIIGAMLAAGALLFLAASIGLRPHPLDAEDLDEEPVPTLANASKDEDAAGEPGLLLVA
FT                   LTGLIQLGLALKSWASRFLARRVRPVTAKPAPWQAGWRETHGDFDPPLDLAGEPLQWLE
FT                   PAPEPPPFDASAYAPRATREAVRRERAAASSTETRPAREVHVEEEQDDYDFAAELPPLS
FT                   VTPPAPPPKPSARALQEKAPAPQSAPMFRVSNRNTNQVFELPPLAMLSEPKKQGTRLSD
FT                   DALQQNARVLEGVLEDFGVKGEIINVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSM
FT                   SALSARVAVVQGRNAIGIELPNLRRETVFLRELLSAHDFEESKHKLAIALGKNIGGEPI
FT                   IVDLARMPHLLVAGTTGSGKSVAINTMILSLLYRLKPDQCRLIMVDPKMLELSVYDGIP
FT                   HLLTPVVTDPKKAVVALKWAVREMEDRYKKMSKVGVRNIDGFNARVAEATAKGEVITRV
FT                   VQTGFDRETGEAIYEQEEMNLSVLPYIVVIVDEMADLMMVAGKDIEGAIQRLAQMARAA
FT                   GIHLIMATQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEQGAEQLLGQGDMLYM
FT                   AGGGRISRVHGPFVSDGEVEKVVAHLKTQGQPDYLDAITAEDEEGEDGEAPAPGSMDAE
FT                   EGGDLYDRAVAIVLRDKKCSTSYIQRRLSVGYNKAASLVERMEKEGVVGAPNHAGKRAI
FT                   LVGGGVDRGAFDLAAEG"
FT   gene            527600..527818
FT                   /locus_tag="Bind_0465"
FT   CDS_pept        527600..527818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94118"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE91"
FT                   /protein_id="ACB94118.1"
FT                   /translation="MGLVEGRLGPNNKPGPNVSGPGFELSFHACVLAASLAPARPHEMP
FT                   TEQILAKLFRHVYVTADKNEKNFIGRA"
FT   gene            527790..528017
FT                   /locus_tag="Bind_0466"
FT   CDS_pept        527790..528017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94119"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE92"
FT                   /protein_id="ACB94119.1"
FT                   /translation="MKKISLGERRANVLAAFEHPSTGIVTVGIGAEIDYGRSMAVLQAL
FT                   DDPLAGPHDTKVAASGSWFLPLILLFHGHP"
FT   gene            528094..528495
FT                   /locus_tag="Bind_0467"
FT   CDS_pept        528094..528495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nha:Nham_2959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94120"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE93"
FT                   /protein_id="ACB94120.1"
FT                   /translation="MFRDDSGNGGRRPSRNVLGEPLESCSFDPLTGFFRNGCCDTSAED
FT                   VSSHTVCIVATEEFLAFSKARGNDLSTPLPQYGFPGVKPGERWCLCAPRWQEAFEAGKM
FT                   PRVVLKATHEGALAFCALDDLKRYAVDLS"
FT   gene            complement(528578..529024)
FT                   /locus_tag="Bind_0468"
FT   CDS_pept        complement(528578..529024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94121"
FT                   /db_xref="UniProtKB/TrEMBL:B2IE94"
FT                   /protein_id="ACB94121.1"
FT                   /translation="MASPLTILADSTDGKHFEITLEKSEGDNAVLRLEIWGSNLDHRRD
FT                   EPSRDDFLKLYEIRFDRVQRLICKAKMNGSYPTITVMFSPAKEDQKATLRTVVANTFAS
FT                   LGDGTYDYPMETTDYEALKQFLIEADFPLIEASVIKNEKAVLRR"
FT   gene            complement(529130..529948)
FT                   /locus_tag="Bind_0469"
FT   CDS_pept        complement(529130..529948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0469"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; Ankyrin; KEGG:
FT                   xau:Xaut_0147 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94122"
FT                   /db_xref="GOA:B2IES8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2IES8"
FT                   /protein_id="ACB94122.1"
FT                   /translation="MATYRRITIDEARSLMDAETKPVVIDVRDPASYQKGHIDGALRVD
FT                   LTNLDTLLKETPKTKPVLIYCYHGNSSQAYAKAFGAADFADVFSMDGGYEEWRKAEMRQ
FT                   NAAPIEEAPTVEGLSDALEAFLKEHGYPKGGVNAVTPTDRMTPLMRACHLNAKAIVTEL
FT                   LQAGARVDASNNDQNQALWLACVGDDPDIVDMIIAAGADLNHANVNGSTALIYAASAGK
FT                   AKALARLLAAGADLDYQVDGFSAIDMASTLECLNMMREAKRRAKAAKAGS"
FT   gene            complement(530008..531978)
FT                   /locus_tag="Bind_0470"
FT   CDS_pept        complement(530008..531978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0470"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bbt:BBta_2171
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94123"
FT                   /db_xref="GOA:B2IES9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2IES9"
FT                   /protein_id="ACB94123.1"
FT                   /translation="MTIGLPPANAADVILAYHQRTKHKMDRYAAGPETLDWSEQPNPFR
FT                   DFAGAESKLLPLGAENITTPFANIYNPDRTPAAALDETSVGALLQLSLALNAWKEYGPD
FT                   RWAMRSNPSSGNLHPTEAYVLARNIPGLADGVHHYAPRNHSLEHRGSLSNATSGEPALW
FT                   IGLSSIHWREAWKYGERAFRYCQLDVGHAIGALRYAAGTLGWRLQMVEGLSSAEIASLL
FT                   GLDRDADFTAGVEREAPDLILRVVTGPGVTALKGGDAGFLLDQLSVWQGRANVLDRHHM
FT                   YKWPVIDEASAATKKTAPHEETPYRGNFPGIGEGSPEPAAKVILNRRSAQAFDRSARMG
FT                   SGSFYHLIDRLLARPVAPWDVWTYAPRLHPVFFIHRVDGLEPGLYILLRNPDAEMRLKQ
FT                   ATHQDFVWKRPEHVPPQLNFFQLLPTDCTKVARTLHCHQAIASDSCFALGMLAEFDELV
FT                   HAEPWRYKQLHWEAGLIGQVLYLEAETLGFRGTGIGCFFDDAMHEILGLKDTRFATLYH
FT                   FTVGLPLIDTRMLTLPPYGDRTEVEDTTQTQGIQTMAEEASFERIGIDIARQLIADDKT
FT                   LVLDMRDPGSYESGHIEGAEHVTESNLFHFLSTTPKDTPVLIYCYHGNSSQVYAKTFAD
FT                   FRFKTVYSLDGGYEGWRKANS"
FT   gene            complement(531993..532418)
FT                   /locus_tag="Bind_0471"
FT   CDS_pept        complement(531993..532418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0471"
FT                   /product="nitrogenase-associated protein"
FT                   /note="TIGRFAM: nitrogenase-associated protein; PFAM:
FT                   arsenate reductase and related; KEGG: ter:Tery_3773
FT                   nitrogenase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94124"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET0"
FT                   /protein_id="ACB94124.1"
FT                   /translation="MQIIFYEKPGCSNNSRQKALLEAAGHELDVRNLLVEKWTAENLRS
FT                   FFGDRPVADWFNKAAPQVKSGAVDPQNTDAETALALMLAEPILIRRPLIEAAGQRAVGF
FT                   DPAEMEAWVGLQAPRVQGVDLETCRRPKETAACPDKP"
FT   gene            complement(532883..533344)
FT                   /locus_tag="Bind_0472"
FT   CDS_pept        complement(532883..533344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0472"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bbt:BBta_5880 putative transcriptional regulatory protein
FT                   (protein CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94125"
FT                   /db_xref="GOA:B2IET1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET1"
FT                   /protein_id="ACB94125.1"
FT                   /translation="MQIGVDNDRRVENKRVFVIDNDGVTGSILQFMLEDHNETHEFASV
FT                   QEAFDSSEKVVYGKTEKSVPNLLIVGVNILEEKGPDVLKEISAKFPEAKIVVLADNAEN
FT                   EFAKQALAKGGGAHGILTKPLTVEVVRRKVDMLLGRLKSEFVQLTDFSF"
FT   gene            533912..534784
FT                   /locus_tag="Bind_0473"
FT   CDS_pept        533912..534784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0473"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: xau:Xaut_0143 nitrogenase iron protein;
FT                   TIGRFAM: nitrogenase iron protein; PFAM: NifH/frxC-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94126"
FT                   /db_xref="GOA:B2IET2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET2"
FT                   /protein_id="ACB94126.1"
FT                   /translation="MRQIAFYGKGGIGKSTTSQNTLACLAQMGHKILIVGCDPKADSTR
FT                   LILHSKAQDTILSLAAAAGSVEDLEIEDVMKVGYLDIKCVESGGPEPGVGCAGRGVITS
FT                   INFLEENGAYEDVDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMAMYAANNIS
FT                   KGILKYANSGGVRLGGLVCNERQTDKELELAEELAKRLGTKLIHFVPRDNIVQHAELRR
FT                   MTVVEYAPDSKQADEYRTLANKVHANKGNGIIPTPITMDELEDILMAHGIMKQVDESQV
FT                   GLTAAQLSA"
FT   gene            534854..536314
FT                   /locus_tag="Bind_0474"
FT   CDS_pept        534854..536314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0474"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: azc:AZC_1040 nitrogenase molybdenum-iron
FT                   protein alpha chain; TIGRFAM: nitrogenase molybdenum-iron
FT                   protein alpha chain; nitrogenase component I, alpha chain;
FT                   PFAM: oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94127"
FT                   /db_xref="GOA:B2IET3"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET3"
FT                   /protein_id="ACB94127.1"
FT                   /translation="MSLSAPETIEEIKQRNKELIAEVLEAYPEKSKKNRAKHLNQFQEG
FT                   GKDCSVKSNIKSVPGVMTIRGCAYAGSKGVVWGPIKDMIHISHGPVGCGQYSWAARRNY
FT                   YIGTTGVDTFVTMQFTSDFQEKDIVFGGDKKLAKIMDEIMELFPLNHGVTVQSECPIGL
FT                   IGDDIEAVSKQKSKEYGGKTIVPVRCEGFRGVSQSLGHHIANDAVRDWVFDKMEGKPAR
FT                   IELTDYDVAIIGDYNIGGDAWSSRILLEEMGLRVIAQWSGDGSIAELEATPKAKLNVLH
FT                   CYRSMNYISRHMEEKYGVPWVEYNFFGPSKIAESLRTIASHFDDKIKENAEKVIAKYRA
FT                   LSDAVIEKYRPRLHGRKVMLFVGGLRPRHVIGAYEDLGMEVVGTGYEFGHNDDYQRTTH
FT                   YVKDGTLIYDDVTGYEFEKFVEKIQPDLVGSGIKEKYVFQKMGVPFRQMHSWDYSGPYH
FT                   GYDGFAIFARDMDMAINSPVWGLTKAPF"
FT   gene            536398..537960
FT                   /locus_tag="Bind_0475"
FT   CDS_pept        536398..537960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0475"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: xau:Xaut_0090 nitrogenase molybdenum-iron
FT                   protein beta chain; TIGRFAM: nitrogenase molybdenum-iron
FT                   protein beta chain; PFAM: oxidoreductase/nitrogenase
FT                   component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94128"
FT                   /db_xref="GOA:B2IET4"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET4"
FT                   /protein_id="ACB94128.1"
FT                   /translation="MPQNADHVLDHFDLFRQPEYREMLANKKKNFENPVAEAEVQRVVE
FT                   WTKTPEYREKNFAREALTVNPAKACQPLGAVFAAVGFEGTIPFVHGSQGCVAYYRSHFS
FT                   RHFKEPSSCVSSSMTEDAAVFGGLNNMIDGLANTYNLYKPKMIAVSTTCMAEVIGDDLN
FT                   AFIKTAKDKGSLPMSYDVPFAHTPAFVGSHITGYDNALKGVHEHFWGGKAGTVEKLQRV
FT                   PNETINFIGGFDPYTVGNLREIRRIFDMMGFEYTIIADNSDVWDTPTDGTFRMFDGGTT
FT                   IDEMVAAVNSKATVSMQEYCTEKTMKYIEEEWKHETVAFNHPIGVKATDDFLLEISRLT
FT                   GKAVPEQIKLERGRLVDAMADSSSHIHGKKFAIYGDPDLCIGLAQFLMENGGEPTHILA
FT                   TNGSPKWAEKVQAMLDANPFGKNCHVYPLRDLWHMRSLLFTEPVDFLIGNTYGKYLERD
FT                   TGTPLIRIGFPIFDRHHHHRYPVWGYQGGLNVLVWILDKIFEEIDKNTIVPAHSDFSYD
FT                   IIR"
FT   gene            538252..540141
FT                   /locus_tag="Bind_0476"
FT   CDS_pept        538252..540141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0476"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: xau:Xaut_0091 nitrogenase MoFe cofactor
FT                   biosynthesis protein NifE; TIGRFAM: nitrogenase MoFe
FT                   cofactor biosynthesis protein NifE; PFAM:
FT                   oxidoreductase/nitrogenase component 1; BFD domain protein
FT                   [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94129"
FT                   /db_xref="GOA:B2IET5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET5"
FT                   /protein_id="ACB94129.1"
FT                   /translation="MSSVSATIQDVFNEPGCAKNAGKSEKEKKKGCTKQLQPGGAAGGC
FT                   AFDGAKIALQPITDVAHLVHGPIACEGNSWDNRGAFSSGSTLYRTGFTTDINETDVVFG
FT                   GEKRLYKSIKEIIEKYNPPSVFVYQTCVPAMIGDDIDAVCKAASKKFGKPIVPVNSPGF
FT                   VGPKNLGNKLAGEALLAHVIGTIEPEYTTPYDVNIIGEYNLAGEMWQVEPLLKEIGFRI
FT                   ISCISGDAKYNEVAQAHRAKATMMVCSKAMINITRKLEDKYGIPYFEGSFYGIGDMSDS
FT                   IRQLAQLVIDQGAPPEFMDRAEAVIAREEKKAWERMAAYTPRLKGKKVLLITGGVKSWS
FT                   VVAALQEVGLEIVGTSVKKSTKEDKERIKELMGEDAHAFDDMSPREMYKMLKDAKADIM
FT                   LSGGRSQFIALKASMPWLDINQERHHAYAGYEGMVDLVREIDKALYNPIWEQVRKIAPW
FT                   ENPAESWQAKADAEAAREAAELAANPAKAEEKRRSKKICKCKSVDLGTIEDAIKANNLT
FT                   TAKQVTEITHAGGGCTGCVGTIEGIIEELLKPADAVALDPAQAEEKRRAKKVCNCKEVT
FT                   VGTIEDAIRDKGLSTAAQVTAATEAGSGCGSCGETIEEILGEVLASIPPIAAE"
FT   gene            540154..541533
FT                   /locus_tag="Bind_0477"
FT   CDS_pept        540154..541533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0477"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: mca:MCA0234 nitrogenase molybdenum-iron
FT                   cofactor biosynthesis protein NifN; TIGRFAM: nitrogenase
FT                   molybdenum-iron cofactor biosynthesis protein NifN; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94130"
FT                   /db_xref="GOA:B2IET6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET6"
FT                   /protein_id="ACB94130.1"
FT                   /translation="MAIVKFNKKACTVNPLKMSQPVGGALAFMGIKDAMPLFHGSQGCT
FT                   SFGLVLFVRHFKEAIPLQTTAMSEVATVLGGYENVEQAIVNISNKQKASLIGICSTGVT
FT                   ETKGDDVDAYIKLVRQQHPELDHVSLVYVSTPDFKDAFQDGWEKTVAKIIETLVKPRPA
FT                   DAPRNSRKIAVLPGSHLTPGDLDELRDIIEAFGFDPLFLPDLAGSLDGHIPEDFTPTTL
FT                   GGISLDEIADLGDAFYTIAIGSHMRTAAEALKEKAGVPYQLFDRMIGLLPTDDFIAFLT
FT                   QISGKPVPNKIKRQRGQLVDAMLDGHFHTGGKKIAIGLEPDFLYDLSNFLADMGCQIEV
FT                   AVTTNQTAILDQVRSEEVLVGDLEDFETLAPGCDLLITHAHGRQASERLHIPLFRMGLP
FT                   IFDRLGAGHITSVGYRGARDLIFKIANIFIENMHVAKPDTWYPHPGAEEGHASADKLTT
FT                   H"
FT   gene            541570..541974
FT                   /locus_tag="Bind_0478"
FT   CDS_pept        541570..541974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0478"
FT                   /product="nitrogen fixation protein NifX"
FT                   /note="TIGRFAM: nitrogen fixation protein NifX; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; KEGG: bbt:BBta_5920 nitrogenase molybdenum-iron
FT                   protein NifX"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94131"
FT                   /db_xref="GOA:B2IET7"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET7"
FT                   /protein_id="ACB94131.1"
FT                   /translation="MKVAFATQDLERVDAHFGWAKNISIYDVTPGGNQFLETIAFNGDL
FT                   QEDGNEDKLEPKIAAIKDCAILYVAAIGGSGAARVVANNIFPMKVKEPESITDLLDKLQ
FT                   DVLKAPAPPPWLRKALAKSGEKIETDYDDD"
FT   gene            541983..542453
FT                   /locus_tag="Bind_0479"
FT   CDS_pept        541983..542453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0479"
FT                   /product="nitrogen fixation protein"
FT                   /note="TIGRFAM: nitrogen fixation protein; PFAM: protein of
FT                   unknown function DUF269; KEGG: rpc:RPC_4457 protein of
FT                   unknown function DUF269"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94132"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET8"
FT                   /protein_id="ACB94132.1"
FT                   /translation="MSEAAVATPDLAAMDTVFVKELVKQWRAQDMHGTWEGKSDFDLIE
FT                   PYIVDKVKRKEIPMVGDPDPETIWRLELFYNAIGLTIERETGCMVSPMIKMSHEGFGRI
FT                   ILMAGRLIVVNKMLRDVHRYGYDNLNKLADEGAKAVAAGVAMIEKFPEVAKY"
FT   gene            542480..542680
FT                   /locus_tag="Bind_0480"
FT   CDS_pept        542480..542680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0480"
FT                   /product="protein of unknown function DUF683"
FT                   /note="PFAM: protein of unknown function DUF683; KEGG:
FT                   bra:BRADO5433 conserved hypothetical protein (DUF683)"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94133"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/TrEMBL:B2IET9"
FT                   /protein_id="ACB94133.1"
FT                   /translation="MSEVDELKAEIKKLSAKAMQAKMDLHDLSEELPINWQQILSVAQR
FT                   AHEAFETLESKRAELNNSSAS"
FT   gene            542707..543018
FT                   /locus_tag="Bind_0481"
FT   CDS_pept        542707..543018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0481"
FT                   /product="ferredoxin III, nif-specific"
FT                   /note="TIGRFAM: ferredoxin III, nif-specific; PFAM: 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   azc:AZC_1034 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94134"
FT                   /db_xref="GOA:B2IEU0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU0"
FT                   /protein_id="ACB94134.1"
FT                   /translation="MEEKNTRDGRMWEPEFLTAIDPETCIGCGRCYKVCGRDVMTLKGV
FT                   NHDGDIVELEDEDDDDFDRKVMAMNDIGACIGCGACARVCPKDCQTHTKASEAEPLGA"
FT   gene            543029..543676
FT                   /locus_tag="Bind_0482"
FT   CDS_pept        543029..543676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0482"
FT                   /product="NifQ family protein"
FT                   /note="PFAM: NifQ family protein; KEGG: rpd:RPD_1082 NifQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94135"
FT                   /db_xref="GOA:B2IEU1"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU1"
FT                   /protein_id="ACB94135.1"
FT                   /translation="MQHVDGACVPLDLAVSADRSTPEESFDRQVLGRLVLHILVEIKTG
FT                   VLPHSQDFGLDEPLYRELLAFLHLDHLQHSTGSDPEAPEADEEELMLRGLLLQHTSEGD
FT                   RIGVWLAGIIAHRSLKDNHLWEDLGLAERSDLRRLLEQHYYSLASKNTRNMRWKRFLYR
FT                   SLCEAEGFTMCPSPTCDSCSEFTVCYGDESGEAVLARNARAARLGLQEDIAH"
FT   gene            544187..544510
FT                   /locus_tag="Bind_0483"
FT   CDS_pept        544187..544510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0483"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   rpd:RPD_1083 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94136"
FT                   /db_xref="GOA:B2IEU2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU2"
FT                   /protein_id="ACB94136.1"
FT                   /translation="MISLTDSALSAVKSALMRSGKEGAGFRVKAEAGGCAGYKYQIGLD
FT                   AQSREGDTIVDAGDDVRVFVDSLSQPLLSGMQIDFVESLEGAGFVFENPNATNSCSCGK
FT                   SFS"
FT   gene            544521..544841
FT                   /locus_tag="Bind_0484"
FT   CDS_pept        544521..544841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0484"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   rpb:RPB_0980 nitrogen-fixing NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94137"
FT                   /db_xref="GOA:B2IEU6"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU6"
FT                   /protein_id="ACB94137.1"
FT                   /translation="MLNPAEKIVEKAPEEGAAEVVSDAVAAARRQLIAETIESIRPNLQ
FT                   RDKGDCELIDVQGDKVFVKMTGACVGCQLSSMTLNGVQAKLVEATGRMIRVIPVSPNLP
FT                   KL"
FT   gene            544916..546118
FT                   /locus_tag="Bind_0485"
FT   CDS_pept        544916..546118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0485"
FT                   /product="homocitrate synthase"
FT                   /note="TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase; KEGG: rpa:RPA4607 putative homocitrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94138"
FT                   /db_xref="GOA:B2IEU7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU7"
FT                   /protein_id="ACB94138.1"
FT                   /translation="MVASMTRSVMDLAKTPIILNDTTLRDGEQAPGVAFSPEEKIAIAR
FT                   ALALAGVPEIEAGTPAMGEREIAAINAVVAEGLPSKIIAWCRMVPQDIDAAVASGVGMI
FT                   NLSLPVSDIQLKAKFGAGRAYARELIGRFIPYARDKGLEVALGCEDASRADVDFLLEVA
FT                   ELGASLGVRRMRFADTLGVLDPFMTFAMIERLRQASDLEIEIHAHDDLGLATANTLAAL
FT                   RAGATHASVTVVGLGERAGNAPLEEVAVAVEALYGFTTGVDLTALAQVAQVVTNAAGRS
FT                   IPEAKAIVGEAVFTHESGIHVDGLLKDLHCYQALDPALLGRSHHVVLGKHSGLRAVTNA
FT                   LAEQGLSVSADEAKFVLARIKLYAEQEKASVPGDILLDFYREAKVASGHAVDAWTSLVI
FT                   N"
FT   gene            546891..547220
FT                   /locus_tag="Bind_0486"
FT   CDS_pept        546891..547220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0486"
FT                   /product="nitrogen fixation protein NifW"
FT                   /note="PFAM: nitrogen fixation protein NifW; KEGG:
FT                   rpd:RPD_1087 nitrogenase stabilizing/protective protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94139"
FT                   /db_xref="GOA:B2IEU8"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU8"
FT                   /protein_id="ACB94139.1"
FT                   /translation="MSDTLKTLQTMSSAEDFFKVLDVPYDPNKVNVVRMHIMKRMGQYL
FT                   ATEDFEGLPDDEVKARCKATLERAYDDFQKSDPMKERVFKVLKEAVQEKTVAPPPIVPF
FT                   TDLLK"
FT   gene            547376..548230
FT                   /locus_tag="Bind_0487"
FT   CDS_pept        547376..548230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0487"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: mlo:mll5862 nitrogen fixation
FT                   protein,FixA"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94140"
FT                   /db_xref="GOA:B2IEU9"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU9"
FT                   /protein_id="ACB94140.1"
FT                   /translation="MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFSLEEA
FT                   LRLRDKFGGEVTVVTMGPPMADASLRKCLTFGADRAVLLTDRFFAGSDTLATSYALSYL
FT                   IKKVGEEWGAPDIIFCGKQTIDGDTAQVGPGIAKRLNLLQLTYISKIDEFDLAKREITL
FT                   QRRAEGGIQVLKTKLPCLVTMLEGTNDMRRGSIEDALRGARSEIVTWSAAEAGIPDLAL
FT                   CGLRGSPTIVKKVFAPAPRDEKAFQIDVQDKSANDISEALIAEINQRQPGLEQDIQKLA
FT                   AGF"
FT   gene            548256..549368
FT                   /locus_tag="Bind_0488"
FT   CDS_pept        548256..549368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0488"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: azc:AZC_3448 FixB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94141"
FT                   /db_xref="GOA:B2IEV0"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV0"
FT                   /protein_id="ACB94141.1"
FT                   /translation="MNQKAPAKAPAAAGNSRANTKKELPEHLKSYKHVWVLVELERGVV
FT                   HPVSWELLGEGRKLADKLKVDLAAVVLGAPGGTADAIKDSFGYGADLCYVVENPSLVDY
FT                   RNEPYTTAMTELVNKYQPEILLMGATNLGRDLAGSVATTLLTGLTADCTELDVDSDGSL
FT                   AATRPTFGGSLLCTIYTLNYRPQMATMRPRVAAMPVYQPGRTGRVINHEVSLPEDSIIT
FT                   KVLSFLPDSATGKANLPYADVVVAGGLGMQNAENYQLVRNLAEVLGAEWGGSRPLVQKG
FT                   WIPSDRQIGQTGKTIRPRLYIAAGISGAIQHRVGVEGADLIVAINTDPNAPIFDFAHVG
FT                   IVADATKILPALTEAFRKRLALAAARPAAE"
FT   gene            549380..550681
FT                   /locus_tag="Bind_0489"
FT   CDS_pept        549380..550681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0489"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: azc:AZC_3449 protein FixC"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94142"
FT                   /db_xref="GOA:B2IEV1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV1"
FT                   /protein_id="ACB94142.1"
FT                   /translation="MADEKFDAIVVGAGPSGNACAYTLATRGLKVLQLERGEYPGSKNV
FT                   QGAILYADALEKIIPDFREDAPLERHIIEQRLWMMDDKSYCGAHYRSEDFNEDKPNRYT
FT                   IIRAPFDKWFSRRVSEAGALILCETTVTELVRDAHDKVIGVRTDRDGAAIYADIVVLAE
FT                   GVSGLVGARAGLRSIPKPDTVALAVKEMHFLPRETIEARFNLQGDEGVVIESAGTITKG
FT                   MAGTGFLYTNKECISIGIGCLISDFTNSDQTPYGLLEAFKQHPSVKPLLAGSEVKEYAA
FT                   HMIPEGGYKAIPQLFGNGWLIVGDAGQFVNAIHREGSNLAMTTGRIAAETILDLKTRNA
FT                   PMTANNLAAYKTRLDESFVMKDLKKYKNLPNAFHNKHLFTTYPQLISKAAQTWFRVDGV
FT                   DKKAKENEILKSFFRTRRVKGLLGDVLGMARGWR"
FT   gene            550739..551041
FT                   /locus_tag="Bind_0490"
FT   CDS_pept        550739..551041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0490"
FT                   /product="putative ferredoxin protein, FixX"
FT                   /note="KEGG: xau:Xaut_0139 putative ferredoxin protein,
FT                   FixX"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94143"
FT                   /db_xref="GOA:B2IEV2"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV2"
FT                   /protein_id="ACB94143.1"
FT                   /translation="MSTETETNVRVEDKLFQNRYLVDAGRPHITVTPHTVPSPRLLALT
FT                   HVCPAGCYTQADSGQVEISTDGCVECGTCRVVAEPYGEITWNYPRGGFGVLFKFG"
FT   gene            551248..551733
FT                   /locus_tag="Bind_0491"
FT   CDS_pept        551248..551733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0491"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: azc:AZC_0367
FT                   putative Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94144"
FT                   /db_xref="GOA:B2IEV3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV3"
FT                   /protein_id="ACB94144.1"
FT                   /translation="MIRALSDAFVTPSAATQQHRSLLEKYGLRATRQRLGLAKLLFSKG
FT                   DRHVTADTLAAEANALRMSTSLATVYNVLNLFAHVGLVRGLAIEGTKTVFDTNTTDHGH
FT                   FYFEETGEIEDIGQATAQFADHIVPPEGYEVSRVDVVVRLRRIGAPEVKVTETSLCD"
FT   gene            complement(551872..552183)
FT                   /locus_tag="Bind_0492"
FT   CDS_pept        complement(551872..552183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94145"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV4"
FT                   /protein_id="ACB94145.1"
FT                   /translation="MNKPDIDDYMDLFKRYGKDFGAAYLEPEDERFRFLFDQILRLLVQ
FT                   PSDFNLSLPEPFRTTAHRYLAGDEMTVAHMRIVENRHFMLSDLYDYVHLRQTMGGKPW"
FT   gene            552377..552676
FT                   /locus_tag="Bind_0493"
FT   CDS_pept        552377..552676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94146"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV5"
FT                   /protein_id="ACB94146.1"
FT                   /translation="MSVQTSATCSNCRFWEQGAAMDPSAFDDRPRGTCRRSPPQTRSDF
FT                   DRIIADYLAAIARHLNPESEEEAFAIHDSDAASETYWPLTVGEDWCGEYQQRPS"
FT   gene            552873..553496
FT                   /locus_tag="Bind_0494"
FT   CDS_pept        552873..553496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0494"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase; KEGG: bbt:BBta_0198
FT                   phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94147"
FT                   /db_xref="GOA:B2IEV6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IEV6"
FT                   /protein_id="ACB94147.1"
FT                   /translation="MDRLLVLVRHGQSDWNLKNLFTGWKDPDLTEKGIGEAQAAGRGLK
FT                   AKGLAFDIAFTSALTRAQHTLKLILGELGTPDVPTTREQALNERDYGDLSGLNKDDARQ
FT                   KWGEEQVHVWRRSYDISPPGGESLKDTVARVLPYYCQSILPAVLDGKKTIVAAHGNSLR
FT                   ALVMVLDGLTPETIPSMELETGVPLIYRLRANSTVESKEVLKLG"
FT   gene            553658..554230
FT                   /locus_tag="Bind_0495"
FT   CDS_pept        553658..554230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0495"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   psa:PST_4184 sensory box histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94148"
FT                   /db_xref="GOA:B2IEV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV7"
FT                   /protein_id="ACB94148.1"
FT                   /translation="MERLDILLVDDDLLVRHVIADEIAEAGHFVLTVACGEAALEALAD
FT                   NPAITLVLVDYAMPGMMGPDLIREIRNRRPDLKVAMLTGYAEILRMNERHDDYPIIAKG
FT                   LRMEELIKAVEAAARGEATEVAEDAASTRVEMVLEQMAPRPAVEGIQRQLYTLYERTLQ
FT                   DNLPQPLTKLLDKLGDGGTPSDPRKPS"
FT   gene            554349..554930
FT                   /locus_tag="Bind_0496"
FT   CDS_pept        554349..554930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0496"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: nha:Nham_3693 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94149"
FT                   /db_xref="GOA:B2IEV8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV8"
FT                   /protein_id="ACB94149.1"
FT                   /translation="MALRSIITIPDPLLRRVCDPVADVDSEIRRLMDDMLETMYDAPGI
FT                   GLAASQIAVMKRVIVMDVAKRRKGEDGAEADVAPQPLALANPEILWASEELSTYEEGCL
FT                   SIPDYYEEVVRPARVRVGYLDRQGQRQELEADGILATCVQHEIDHLNGVLFIDHISRLK
FT                   RERIVKKFSKAAKRDNHSAPKEKSKADSEA"
FT   gene            555008..555961
FT                   /locus_tag="Bind_0497"
FT   CDS_pept        555008..555961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0497"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: azc:AZC_0797
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94150"
FT                   /db_xref="GOA:B2IEV9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEV9"
FT                   /protein_id="ACB94150.1"
FT                   /translation="MGTPVFSVPVLNALIEAGHQVAAVYTRAPRPAGRRGLDLTPSPVH
FT                   LAAQQHDLPVETPKSLRSEEALATLRAYAPDVLVVVAYGLILPKAILDVPPFGALNLHA
FT                   SLLPRWRGAAPIQRAIMAGDSQSGIELMRMEEGLDTGPVGLVGEVTIGPDMTGGELHDL
FT                   LSLRAATLIIEGLQKLEAGTLTFTPQTEDGVIYAKKIEKVEARIDWRRPAHEVYNLIRA
FT                   LSPFPGAFFEVDLGKGLERIKILRAELTHTPAAQPGEILDAGLSIACGEGEGSGAIKLL
FT                   DIQRSGKAPMSAEAFLRGTKLPASTRLPLPDLHAPL"
FT   gene            555948..556730
FT                   /locus_tag="Bind_0498"
FT   CDS_pept        555948..556730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0498"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: ret:RHE_CH00415 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94151"
FT                   /db_xref="GOA:B2IEW0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IEW0"
FT                   /protein_id="ACB94151.1"
FT                   /translation="MPRYKLTVEYDGASFVGWQRQKNGLSVQEVIETALLAINGAPVGI
FT                   RGAGRTDAGVHASAQVAHADLAREWRPDVLRDALNAHMRPALVAVVAAEPVPETFDARF
FT                   SAIRRHYLYRIINRRAPLTFEAGRAWLVKRRLDARAMHEAAQVLTGRHDFSTFRAAECQ
FT                   AASPIRTLERLDVQAVGDLIEIRASARSFLHHQVRSMVGSLEMVGSGKWSAGDLRAALE
FT                   ACDRRRCGMVAPAAGLYLTGVDYPEEGEEKGAQPFFGE"
FT   gene            complement(556709..557038)
FT                   /locus_tag="Bind_0499"
FT   CDS_pept        complement(556709..557038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94152"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW1"
FT                   /protein_id="ACB94152.1"
FT                   /translation="MSKSIIVTLPHALSAEEAKKRIAERIDVLRTAYIDKLAYSEAVWT
FT                   ENRADLRVVAFGQTATAQVHVLQEIIRLEVQLPWILATLSGKIQNVLTQNAQESLQIGY
FT                   SPKKG"
FT   gene            complement(557168..557533)
FT                   /locus_tag="Bind_0500"
FT   CDS_pept        complement(557168..557533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll2512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94153"
FT                   /db_xref="InterPro:IPR021957"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW2"
FT                   /protein_id="ACB94153.1"
FT                   /translation="MRHAVAEEAKPSTGACQTLARLELFFGAGSSQKPVSHTAFARFLA
FT                   REVTPRFPQGLSLFEGTGQWRDSKGRSSQEASRLLLIFYVPDTESNEKIEAIRQAYKRR
FT                   FHQQSVLRADGTSCVSF"
FT   gene            complement(557591..557983)
FT                   /locus_tag="Bind_0501"
FT   CDS_pept        complement(557591..557983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0501"
FT                   /product="inner membrane protein"
FT                   /note="KEGG: azc:AZC_4001 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94154"
FT                   /db_xref="GOA:B2IEW3"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW3"
FT                   /protein_id="ACB94154.1"
FT                   /translation="MNNELTFLTWTLVLALVQVIAHGVARTKETGAKFNVSARDTTPPP
FT                   YGIIAGRLYRAQTNLFETLPLFAAAVLIAHVAGRESALTAWGALLYFWGRLIYVPLYVM
FT                   GIPVARTLVWMAATIGLILIFVAILI"
FT   sig_peptide     complement(557918..557983)
FT                   /locus_tag="Bind_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.434 at
FT                   residue 22"
FT   gene            complement(558076..558876)
FT                   /locus_tag="Bind_0502"
FT   CDS_pept        complement(558076..558876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rca:Rcas_3511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94155"
FT                   /db_xref="InterPro:IPR024992"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW4"
FT                   /protein_id="ACB94155.1"
FT                   /translation="MLLRSEGLETIAFSQPSHAWLSGQLARQWGNAHFAPPEPFEDVCL
FT                   ATEQHDLGWQEWEAAPALNEKTGLPQQFFEVPGDVHMKLWREGIGTAQIYGRFVAVLVS
FT                   LHAVTIYGFAFDPKTAEPAHAAKVHAFLDALAAQREEWLRQLRANPQFSNVVTNQALEH
FT                   CRLLIGVLDRLSLDICFGVKSEKFYRNVPMTRRETTDLRLRPVDHDPAELVLTPWPFRQ
FT                   DVIKVRVLGKLLHSRFASQAQLDDALLKAQDQAVETILRAGETK"
FT   gene            559101..560261
FT                   /locus_tag="Bind_0503"
FT   CDS_pept        559101..560261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0503"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="KEGG: fra:Francci3_4500 4Fe-4S ferredoxin,
FT                   iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94156"
FT                   /db_xref="GOA:B2IEW5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW5"
FT                   /protein_id="ACB94156.1"
FT                   /translation="MERPLTNGTRMVITCAELQTLIDALAARNYHVVGPRVRDGAIVYD
FT                   GITRLSDLPSGWTDHQEPGRYHLERRQDEALFGFTVGPQAWKRFLHPPVETLLTMNKGA
FT                   EGITISPGERAAPRFAFLGVRACEIHAIAIQDRVFCDGPYPDATYVMRRRDAFIVAVNC
FT                   GVAGGTCFCVSMQTGPKAHSGFDLALTELIDGRAHEFLVEIGSEAGADVLEQVTHRPAS
FT                   DQQIAAAEAIMAHTASQMGRKLETDGIKDLLQGNPNHPRWDAVAARCLTCGNCTMVCPT
FT                   CFCTTVEDHSDLMGTSAERVRKWDSCFTMDFSYIHGGSVRKTGVSRYRQWMTHKLASWI
FT                   DQFGTSGCVGCGRCITWCPVGIDITEETAAIRAAPHPARGQQHGES"
FT   gene            560248..560706
FT                   /locus_tag="Bind_0504"
FT   CDS_pept        560248..560706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0504"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: ace:Acel_1016
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94157"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW6"
FT                   /protein_id="ACB94157.1"
FT                   /translation="MENLEPVLRQHPFFAGFAPKHFELVTGCARNHRFEAGHYLFREGE
FT                   PANEFFLIRHGKVALEIVAPGQNPIVFATLGDGEIVGVSWLIPPYQWTFDARAVELTQA
FT                   IGVDAACLRGKCEADHHFGYEMMKLFLPLLVQRLQATRLQILDIYGKH"
FT   gene            560708..561577
FT                   /locus_tag="Bind_0505"
FT   CDS_pept        560708..561577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0505"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: scl:sce4573 hydroxylase or oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94158"
FT                   /db_xref="GOA:B2IEW7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW7"
FT                   /protein_id="ACB94158.1"
FT                   /translation="MGVMDMSATDMGLMPCPDPFLPQLYRVSRVLRELSDTVTLALTSL
FT                   SGSRPAFEPGQFNMLSVFGVGEVPISISGGSADDVVFVHTIRDLGAVSGAIAKLQPGTT
FT                   IGLRGPFGMGWPVTDVEGADIVIVAGGLGLAPLRPAIYQILANRNRYGRVAILYGARTP
FT                   NDILYRRELEQWRQRSDMDIEVTVDHASPDWHGNVGVVPALVSRMAFDPHETIALLCGP
FT                   EVMMRFTVSVLRAVGLPSDHIYLAMERNMKCAIGLCGHCQFGPLFVCKDGPVMRFDRIA
FT                   DFFSIREI"
FT   gene            561579..562400
FT                   /locus_tag="Bind_0506"
FT   CDS_pept        561579..562400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0506"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: fra:Francci3_4497 NADH ubiquinone oxidoreductase, 20
FT                   kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94159"
FT                   /db_xref="GOA:B2IEW8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW8"
FT                   /protein_id="ACB94159.1"
FT                   /translation="MSERRHPRLAVWKFASCDGCQLSLLDCEDELLTLASVIEIANFPE
FT                   ASRAVAPGPYDLSLVEGSITTEHDAERIRMVRAQSRHLVTIGACATAGGIQTLKNFADV
FT                   NAFIAAVYASPQYIATLSTSTPISAHVPVDYELQGCPVNKVQLIEVISAFLAGRKPSIA
FT                   AHSVCVECKQHGTVCVMVQGMPCLGPVTHAGCGAICPSFRRGCYGCYGPMETPNTTALA
FT                   REWQALGAAPRDISRAFRTFYAAAEPFRKESVVHADITHDDITNGDQDDPG"
FT   gene            562375..563664
FT                   /locus_tag="Bind_0507"
FT   CDS_pept        562375..563664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0507"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: ace:Acel_1019 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94160"
FT                   /db_xref="GOA:B2IEW9"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEW9"
FT                   /protein_id="ACB94160.1"
FT                   /translation="MATRTILVDYLARVEGEGALDIEVHDGRVTSARLRIFEPPRFFEA
FT                   FLRGRGYAETPDLVARICGICPIAYQMSAVHAIENAFGVTVSGQLRALRRLIYCGEWIE
FT                   SHALHIVMLHAPDFLGFPDGIRMASEQGDAVRNGLALKKTGNALMRLMGGREIHPVNVK
FT                   TGGFYRVPSRAELEPIGESLERARALAVGLVRWVSSFPFPDYERDYEFVALRHPDEYPF
FT                   NEGRLVSNRGIDIDIADYETEFEERQVAHSTALHALTRRRGAYLVGPLARYALNFDRLP
FT                   ASVQALARGAGLPPVCKNPFQSIIVRALEIVYACEEALKLIAAYEPPECAAVTVMPRAG
FT                   TGFGCTEAPRGLLWHRYEFAPDGTIERARIVPPTSQNQPSIEADLAAVASMILDQPDDV
FT                   IRARCEQAIRNYDPCISCSAHFLKLSVRRT"
FT   gene            563661..564203
FT                   /locus_tag="Bind_0508"
FT   CDS_pept        563661..564203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0508"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52 hydrogen uptake protein; KEGG:
FT                   fra:Francci3_4495 peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94161"
FT                   /db_xref="GOA:B2IEX0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX0"
FT                   /protein_id="ACB94161.1"
FT                   /translation="MTGAGEKERGLYKILVVGLGNPDRGDDGIGAAVIQSLTGRLPPDV
FT                   ALLMKRGDILSLIEEWSGINALICVDASAPMGTPGRIHRIDAAAGISPSDVSFTSSHAF
FT                   GLAEVIALGQTLQLLPEVAIVYAIEGATFDNGAPMTPIVAAAARDVANRIVVEVERLRQ
FT                   NPISIVSGDPNIKGSRK"
FT   gene            complement(564262..564423)
FT                   /pseudo
FT                   /locus_tag="Bind_0509"
FT   gene            complement(564495..565073)
FT                   /locus_tag="Bind_0510"
FT   CDS_pept        complement(564495..565073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0510"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   azc:AZC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94162"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX1"
FT                   /protein_id="ACB94162.1"
FT                   /translation="MLDAFRPFSPPRRSRLPSRPLGPRLFSLSSLFFLALCLVPSPSPA
FT                   QQVGTASGLPLPRYVSLKSDRVNLREGPSKDHRTTWVFQRAGLPVEITAEFETWRKIRD
FT                   SEGSEGWVLHSLLSGRRTALIAPWKKGEEFPLYEKPSDHSALRAKLQANVIAGVRRCDG
FT                   TWCRLTGDGFDGYLQQALLWGVYPDEKIE"
FT   sig_peptide     complement(564930..565073)
FT                   /locus_tag="Bind_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.696 at
FT                   residue 48"
FT   gene            565360..566355
FT                   /locus_tag="Bind_0511"
FT   CDS_pept        565360..566355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0511"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: xau:Xaut_4126 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94163"
FT                   /db_xref="GOA:B2IEX2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX2"
FT                   /protein_id="ACB94163.1"
FT                   /translation="MVRKKPLVVLTRKLPDVIETRMCELFNTQLNLDDTPMDKEALAKA
FT                   LATADVLVPTVTDRIDAELLAVAGPQLQLIANFGNGVDNIDVNAALERGLTVTNTPGVL
FT                   TEDTADMTMALILAVARRLVEGSRIIPESEWDGWSPTWMLGRRITGKRLGIIGMGRIGQ
FT                   ALARRAKAFGLQIHYHNRRKVAAQVEETLEATYWDSLDQMLARMDIVSINCPHTPATYH
FT                   LLSARRLSHLQPHSILVNTARGELIDEAALTRMLEAGQIAGAGLDVFEHEPAVSTKLIR
FT                   LAKAGKVTLLPHMGSATTEGRIDMGEKVLINIKTFMDGHRPPDRVLPGML"
FT   gene            566414..566914
FT                   /locus_tag="Bind_0512"
FT   CDS_pept        566414..566914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0512"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: rpe:RPE_0435
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94164"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX3"
FT                   /protein_id="ACB94164.1"
FT                   /translation="MPKGDAGRVAQRRPKGFAREIFLQMSRLPTLNSPFLLGFDEIERA
FT                   LDRATRMASDGYPPYNIERIARDGTQTEMLRITLAVAGFTREQLEITIEDGQLLIRGRQ
FT                   QDDKARHYLHRGIAARQFQRVFLLADGMQVSGADLTNGLLSIDLIRPDPSRVVQKIEIA
FT                   VRD"
FT   gene            567022..567288
FT                   /locus_tag="Bind_0513"
FT   CDS_pept        567022..567288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0513"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   xau:Xaut_2033 protein of unknown function DUF1150"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94165"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX4"
FT                   /protein_id="ACB94165.1"
FT                   /translation="MLDETKTHPNPLLTDEQLASLGGGRVAYLKSVRSEDVNQLFPDAP
FT                   ELMPGLKLFALLAADGKPIVLTDSRDAALANAMENQLQMVSLH"
FT   gene            complement(567399..567851)
FT                   /locus_tag="Bind_0514"
FT   CDS_pept        complement(567399..567851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0514"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: mlo:mll9093 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94166"
FT                   /db_xref="GOA:B2IEX5"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IEX5"
FT                   /protein_id="ACB94166.1"
FT                   /translation="MRKVMAAKLHGIHVTAADLDYHGSITLDPDHCEKAGLLPLEFVDI
FT                   WNKNSGARISTYVIFGERYSRCCILNGAAARTCQVGDEIIICSSHYIEAERIADFQPKI
FT                   LTFDKGNHIVETLSYVVERDGTGRYHFDIVNEGGQSLPIPVKAHGR"
FT   gene            568207..569364
FT                   /locus_tag="Bind_0515"
FT   CDS_pept        568207..569364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0515"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   gbe:GbCGDNIH1_1535 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94167"
FT                   /db_xref="GOA:B2IEX6"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX6"
FT                   /protein_id="ACB94167.1"
FT                   /translation="MRINTRYGLMDFPEADHDLIAQFLVRYGEWAWDEVCFIAEVLPMD
FT                   GARVLDVGAFVGTFGLGLAQRRQLQFLGFVEANPTAAAMLKENVKRNCAIAHSVVEAIV
FT                   GTPGENYEMGASESDNLGSTGFKHTLNISDKIASSKADILTLTELREKLGPFNLIKLDV
FT                   EGMELEILKADAEYLSKGDCTIWTECNETAGSLELVRELLSWDLPLYYFAFPAHNIENF
FT                   FGDREPIFPFAYEAGLLLAPKTPPSLSPILIEHHCILRPIRSELDLKDALWKTPRWGLK
FT                   EWNGLEREEIVALAGHALLGQNFPEYLRPDSTASAASNWLTLDQRLKSERGRRVFETMR
FT                   AERAEAALAEKSARLLQLTSEHGHDTSETSNKRAKLTDGEQKMER"
FT   gene            569493..571271
FT                   /locus_tag="Bind_0516"
FT   CDS_pept        569493..571271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX7"
FT                   /protein_id="ACB94168.1"
FT                   /translation="MAASSKASWLSRWFRLKHYSAAIDATSIEGASIEDVLAVSEEGVL
FT                   AAVTTEKVPPEDLLVDHHHLEIAAPYFDKSYYLAKNTDVRDANIDPLKHFLIWGWRERR
FT                   NPSLSFDVNFYLQTYPDVAAADVNPLIHFIMAGQAEGREARDPLGIWRRRLEAARAPSK
FT                   GGTAASLNNQAVDQIDGDELIDRLNISQMGSGLIISFSHDDYTRSCGGVQNVIVDEQKA
FT                   FNRAQWNYLHVSPMRPLQSLADILTIPADFIVAIRIDGTFLGHIAFDEFIAALVKTEAR
FT                   ERGIKCIIHHLMGFSPELILKLFDITQIKSPVVWVHDLFTVCENYTLLRNDITFCGGPP
FT                   PDSMACDICCYGEGRSEHYGRIQNFFQTTHPIVLAPSEFALEKWRHFELPHQQGVVVPP
FT                   ARLVFAEERFSIHTAPQQTLRVAYVGQRVFHKGWSVFEELALRFRQDQRYEFIQLGMPS
FT                   HEVVLPDCIGYCHVQVGPDDHDAMIHALAAAHIDIVVLWPMWPETFCYVAHEALAAGVF
FT                   IVTHKGAGNVDPVVTVQAPEQGIVLPDQSSLFALFETGDIIQLATKAVRRRGALIAGGG
FT                   TADWLLRDNPALLAFG"
FT   gene            571299..572318
FT                   /locus_tag="Bind_0517"
FT   CDS_pept        571299..572318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA1583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94169"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX8"
FT                   /protein_id="ACB94169.1"
FT                   /translation="MSEIHCFTSASFSYLDRVRVLGQTLRKHQPNWKFWLCLPDREPPG
FT                   FEFDLANEPIDGVVRIEELGIANTDSWVFTHDVVELCTAVKGPMLWKLLNDGASKVIYL
FT                   DPDIAVFSDLSEIERLLDSHDVVLTPHQIEPDHSLQAITDNEIGSLKHGIYNLGFVAVA
FT                   NREEGRAFAQWWRDRLLHFCYDDIPNGLFVDQRWCDHAPVFFPSTHILRDPGYNVASWN
FT                   QSRRPITIHEDGSIRANGSILRFFHFTKITWVGQLMLERYANGRPEIFELMKWYCTRLA
FT                   NNKVSGLPDGWWAFNHYSNGEPIKRAHRIALRHNEYLRDRFKNPFIASPELMSYLEPA"
FT   gene            complement(572403..573428)
FT                   /locus_tag="Bind_0518"
FT   CDS_pept        complement(572403..573428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0518"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gur:Gura_3168 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94170"
FT                   /db_xref="GOA:B2IEX9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEX9"
FT                   /protein_id="ACB94170.1"
FT                   /translation="MIPEISAILTTHNRAHLLPRVLQGLKQQTLAPSRFEIVAIDDGST
FT                   DDTQAVLKHWQNELPLRIFPQRASGLAAAKNLGIFVSRAPIVVFLDDDDVASPDLLASH
FT                   LAIHLEQPDQAVAVLGRTILAPEIADLPLMRHVTEVGCQLFSYHWMQPRQVLGYKEFWG
FT                   GRSSCKRGLLVRHGVFHPDFKFGCEDIELGWRLAKHGLRVIYEPRAYSTMIRAINFDQF
FT                   CQRSYRQGRSQHAFSMLHDDNTIRAYCEIDAALAAWHTHWVDYAGLLRWTRKLEKLTLA
FT                   RARASFPLHDLLQKTLDLAYRDAFFLSRAKGIADTAKETTKPVDQEKQRDLFEYGLQAA
FT                   R"
FT   gene            complement(573425..574126)
FT                   /locus_tag="Bind_0519"
FT   CDS_pept        complement(573425..574126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94171"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY0"
FT                   /protein_id="ACB94171.1"
FT                   /translation="MARILAAGVYMAEKPNTVAHVSLCLALSKKHRVEQRWIALSPNGK
FT                   GACDHPMTLAVVTERTPKFQLLDRLLIDAQDYDWILLCDDDIELDFDAIDKLIDYATAY
FT                   DFALCQPARTTDSFTDHPLVQVLPGLKARRTRFVEIGPFVCMRRDAAKLLLPFGNACGM
FT                   GWGLDFVWPQIIEDAKLKMGIIDAVPVAHRIRPPVTGYNYESARREMDRLLAEHPHLTL
FT                   EQAFTVIEAYL"
FT   gene            complement(574119..575618)
FT                   /locus_tag="Bind_0520"
FT   CDS_pept        complement(574119..575618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0520"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gur:Gura_3169 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94172"
FT                   /db_xref="GOA:B2IEY1"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY1"
FT                   /protein_id="ACB94172.1"
FT                   /translation="MTSLKLPDHPSWQGSEDQFEEKPLNTAELTAVLQYEIARLTRECD
FT                   ELRVKNTALAEANTALQKASDQSVPSQPSGDTAHSRKITTSPFSILSTFVRNLFAQNPN
FT                   NAKLDDESSVSSILRAQRWSGGDFFVVSDMPPLFDQQSGALRMMTLLQLMNEAGWRITF
FT                   GSYIERSKLPLALTSNEGRARYEGALYKHGVQCILYGMDEINTYLRKKETRLNWAFVSF
FT                   PHIASAVMPLVRARFPNALIAFDMVDFHSLRLEREAELLGDSEKLAQARHQREEEIGLA
FT                   LAADVTLAITAEEKENLLSLAPLAVVKVLPNVFELPQYTPPGPTERNGVFFLGGFWHAP
FT                   NSDGIKWFVEKIWPFVRAKEPNAILRIAGSNMNEDILALSAVPGIEVLGYVPYLQPLFD
FT                   SNRVFIAPLRYGAGMKGKVGQSLAHGLPVVATTIGAEGMSLVDGTHILVADEESAFADH
FT                   IVQVLRDDSLWCHLSEHGRTHIEKTLSLDVVRTQVGDIFHG"
FT   gene            complement(576054..576551)
FT                   /locus_tag="Bind_0521"
FT   CDS_pept        complement(576054..576551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0521"
FT                   /product="peptide deformylase"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase; KEGG: bcs:BCAN_B0456 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94173"
FT                   /db_xref="GOA:B2IEY2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY2"
FT                   /protein_id="ACB94173.1"
FT                   /translation="MAVRPVIRFPDPRLSMAAQKVEHFDETLRTLADDLVESLHAAHGI
FT                   GITAPHIGVPARLVALELTPNQTRLYVNPEIIWSSDTKIRHQEGSVSMPGVTEIVERCA
FT                   EIHVRYQDLDGSVHIEKADGFLAICHQHEIDQLDGLFWIQRLSRLKRERVIKRYEKLAS
FT                   DR"
FT   gene            complement(576625..577656)
FT                   /locus_tag="Bind_0522"
FT   CDS_pept        complement(576625..577656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0522"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: cak:Caul_2660 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94174"
FT                   /db_xref="GOA:B2IEY3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY3"
FT                   /protein_id="ACB94174.1"
FT                   /translation="MNQIVNSKVRPLLVASQLGAELNARIAREVEGLTFIDVPPGPLDE
FT                   RATDAEVVFAAPTHGSVARSWTVVPKSWPGSIRWIQLISAGIDGYPRWIFNGPTVTCAR
FT                   GPSAQPIAEFVLATIFASARHLPELWVTNPQEWKDKKKTTRDIAGLPKGSIPTNIVGRR
FT                   LAGTTLGLVGFGAIGQRIAELALALGFHVVATRRTDKPFDIEGVERAADAGEVFARADF
FT                   AVLVAPATPQTDHLINHAALAKAKQGLHLINVARGSLIDDKALLEALDDGRIGLASLDV
FT                   TDPEPLPEGHPFYTHPRIRLTPHISMMTDQADTELIAKFADNIARYRRGEPLRDPVDSV
FT                   RGY"
FT   gene            complement(577693..578916)
FT                   /locus_tag="Bind_0523"
FT   CDS_pept        complement(577693..578916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0523"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ppu:PP_3226
FT                   acyl-CoA dehydrogenase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94175"
FT                   /db_xref="GOA:B2IEY4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY4"
FT                   /protein_id="ACB94175.1"
FT                   /translation="MTHSSPDLASPLSAISDLDPILASLTAEFSGRAAEHDRQASFAFE
FT                   NIARLRELGLLGLTVPKIFGGGVPSAFGGGEVTLSLAARIIRAIGQGDPSTALVLVMQY
FT                   VHHIHLARDDRWPASLRERVQRDAVENGALINSLRVEPELGTPARGGLPNTIARRTPEG
FT                   WRLSGHKLYSTGIPALTWLSVWGRTDDDNPSVGPFLVHRDTPGVKIIESWDHLGMRASG
FT                   SHEVIFEDVLIPLDHAVDLRPPAAWARGFDPDQMAWMTVLVASLYDGVAQGARDWFAEF
FT                   ANERVPANLGAPLASLSRFQEAAGVIDALLFSNAIILQKIAEATDRGDYPSVRDCNFTK
FT                   YIVTKNAIEAVEHALELSGNPGLTRSNPLERHYRDVLCSRIHTPQNDVILTSAGRDAFA
FT                   SRALREVA"
FT   gene            complement(578922..579947)
FT                   /locus_tag="Bind_0524"
FT   CDS_pept        complement(578922..579947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0524"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, aliphatic sulfonates family, putative"
FT                   /note="KEGG: pfl:PFL_1382 ABC transporter, periplasmic
FT                   substrate-binding protein, aliphatic sulfonates family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94176"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY5"
FT                   /protein_id="ACB94176.1"
FT                   /translation="MSKILPVISTGLSRRLLLQGAAATTALGASALGPGLALASGEKPL
FT                   RVARSKGRFDPELLFASSGVTPPSHPIAYSEFGSGKLAAEALNANALDIGAMSEIPPIF
FT                   IANADPKFRLIAVIKGDVNQQVVLVPRESKIASIADLKGKRVGYVRSTTCHYFLLKMLA
FT                   EAGLSFNDITLVNLSPADGQAAFTRGALDAWAIYGYSVSLAVHNEGARILKTALGYLSG
FT                   NYTIAAHVDAIADPVRHAEIAEFLVQWKRSFGWLNTHHEVWAPIEAKALGLPQDFILEE
FT                   LRNQSAPWQIGPVDDAAIRSQQDVADVFYAAGLIPKPVQVAALWDRSFNPVLVETHITE
FT                   K"
FT   sig_peptide     complement(579828..579947)
FT                   /locus_tag="Bind_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 40"
FT   gene            580129..581079
FT                   /locus_tag="Bind_0525"
FT   CDS_pept        580129..581079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0525"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bpd:BURPS668_0795 regulatory
FT                   protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94177"
FT                   /db_xref="GOA:B2IEY6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY6"
FT                   /protein_id="ACB94177.1"
FT                   /translation="MRLTNLDMDLLRTLSVASELGGLGRAAERLGRSPSAISLQMHKLE
FT                   EQVGKTLFRKQGRGISLTDAGDLLLGYARRILALNDEALAATRGVGVEGIVRLGVPFDL
FT                   TSEWLPKVLARFSEAYPRVHIELRTDRSVELLQLYNQDLLDLTLAFGPVERPGASFVAE
FT                   VPVRWIGSTGFRLDKNQDVPLILLDPPCWFRQTGIDALDRHQTAWRLAFTSPSLAGLWA
FT                   ATEAGLGITVRTPLGMPRSLSALDPDHGLPDLPRVSIVLYNSARRYPHLTSFLETILVE
FT                   TLESALPSGSLQTVASRSMCIPPARGKTSLALSSN"
FT   gene            complement(581203..582177)
FT                   /locus_tag="Bind_0526"
FT   CDS_pept        complement(581203..582177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0526"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   bam:Bamb_3674 aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94178"
FT                   /db_xref="GOA:B2IEY7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY7"
FT                   /protein_id="ACB94178.1"
FT                   /translation="MARRLPLILSFLSVFLFTVTPLAADQATNADSVLRIGDQKGGLHA
FT                   LMAAANVLGDLPYRIEWLVFPAAAPLLEALRTGAIDAGGVGDGPFVFAAAAAAPIKAVY
FT                   AYRSDGSNTAIVASANSAIHAPADLKGKSIATGRGSIGHYILVKTLDAATLSPQDVKPV
FT                   FLSPADSRAALKSGSVEAWATWEPYTALTEIQDGSHIIIDGGKGFLSGLGYLVASDKAI
FT                   ASNATQLADFIHRLSRAHRWAKTHLQDYAEVWSKETGFPVEVALLALKRMNATPELIDG
FT                   AITNEQQKTADVYFGAGIIPKRLDAALSFDTRFNASIASDDTR"
FT   sig_peptide     complement(582106..582177)
FT                   /locus_tag="Bind_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.788 at
FT                   residue 24"
FT   gene            complement(582308..582775)
FT                   /locus_tag="Bind_0527"
FT   CDS_pept        complement(582308..582775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0527"
FT                   /product="protein TolR"
FT                   /note="TIGRFAM: protein TolR; PFAM: Biopolymer transport
FT                   protein ExbD/TolR; KEGG: mex:Mext_1617 protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94179"
FT                   /db_xref="GOA:B2IEY8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY8"
FT                   /protein_id="ACB94179.1"
FT                   /translation="MAFASPKADGGEAAPMSDMNVTPLVDVMLVLLIVFMVAAPLMATG
FT                   VPVDLPKAQTKPLNEQKPPIAVSIDAAGKFFVDQAEVAPEELIYVLGQNAESKDRRIHV
FT                   RGDKAIAYGKVIEVMGLINSAGYTKVALVSEAPGAATPSPAASTPAPAPAP"
FT   gene            complement(582756..583496)
FT                   /locus_tag="Bind_0528"
FT   CDS_pept        complement(582756..583496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0528"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   mag:amb3214 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94180"
FT                   /db_xref="GOA:B2IEY9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEY9"
FT                   /protein_id="ACB94180.1"
FT                   /translation="MSDPVSGAAPAAAHVLSPVELFLQADSVVKTVMILLVLASAWGWV
FT                   VIFNKLIRLSVLQKRAAKLLKSVQEGLPVATLAESFDKAPANDPFVSVYKAMIEEHARS
FT                   ADLIYTDGQRDSLQERIHRVAHLASSHAIDQLQSQLPGLATIGAVAPFVGLFGTVWGIM
FT                   NSFQGIAASNNTSLSVVAPGIAEALFATALGLVAAIPAVVFYNRIGTDISKYSKKLSAF
FT                   INVFEIELSRQLSKKGERSGLRVA"
FT   gene            complement(583637..584464)
FT                   /locus_tag="Bind_0529"
FT   CDS_pept        complement(583637..584464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0529"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: pfo:Pfl_3737
FT                   TonB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94181"
FT                   /db_xref="GOA:B2IEZ0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ0"
FT                   /protein_id="ACB94181.1"
FT                   /translation="MTAALAPNFPTYSDQANGLFQPEGGAQGLLLPEPQKPSYRTTGLV
FT                   LLVYALALAAVVTYTAKPVEVPPEEPLELVIEPAAPAGEQAPAAEQQPEQPPVEEPPPV
FT                   EEPTPPTQDLAPPPAVEPEPVAPVEPPKPVQPKPPVKKVEKKPPPPKAAAPKAATAGGH
FT                   PGVPAGGAGAGGPIPAGAIPSGYANLVQARIARSAGNNYPRAALAAGASGRVPYRIVIS
FT                   PTGQLISKSITSSGNPAFDAAASDALARAAPFPPPPGVNRPVSLSGAIAYRLH"
FT   gene            complement(584869..585375)
FT                   /locus_tag="Bind_0530"
FT   CDS_pept        complement(584869..585375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0530"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   ret:RHE_CH00838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94182"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ1"
FT                   /protein_id="ACB94182.1"
FT                   /translation="MSAPARHWIAVASAEHVALGRTLGIMQVCHGKAASLRRVAPGDRI
FT                   IYYSPMIRFGCKDRLQAFTAIGTVCEGMPYQVEMTTGFKPWRREVRWSSSRDAPIRPLL
FT                   DRLAFTHGDRNWGYRFRFGLFEITIEDAELIATAMMPDCGESEAQTREQLLAIGQSCPS
FT                   GVTCR"
FT   gene            complement(585372..585746)
FT                   /locus_tag="Bind_0531"
FT   CDS_pept        complement(585372..585746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0531"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00839 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94183"
FT                   /db_xref="GOA:B2IEZ2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR026275"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ2"
FT                   /protein_id="ACB94183.1"
FT                   /translation="MNDTNILLLYVADAPASARFYAELFGIEPVEASQTFALFILPSGL
FT                   ALGLWGKADVQPAPVAGGGGSEIGFKVKGAEEIDNTHANWLAKGATIAFPPTDLDFGRS
FT                   FVALDPDGHRLRVYAAAEKM"
FT   gene            complement(585823..586518)
FT                   /locus_tag="Bind_0532"
FT   CDS_pept        complement(585823..586518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0532"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bpt:Bpet1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94184"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ3"
FT                   /protein_id="ACB94184.1"
FT                   /translation="MSRSERLFDLLHALRGYRRPVSGKVLADEIGVSIRTLYRDIASLQ
FT                   ALGAGIEGEPGIGYILKPGFLLPPLMFTSEEIEALVLGSRWVADRADDRLREAARSALT
FT                   RIAEVLPADLRDDLDASALLVGPGACIPTDNVNLALLRKAIRTERKLVLAYRDGTGAAS
FT                   ERIVWPFALAFFDSVRVLLGWCELRRGFRHFRTDRIVSVTPVEARYPKRRQALLKEWRE
FT                   TEGITKGLD"
FT   gene            586654..587631
FT                   /locus_tag="Bind_0533"
FT   CDS_pept        586654..587631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0533"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: pla:Plav_2215
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94185"
FT                   /db_xref="GOA:B2IEZ4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ4"
FT                   /protein_id="ACB94185.1"
FT                   /translation="MVPFFRHSMQMQTQVTGMTLDANPNAAQIEFWNGLAGEKWSLYQA
FT                   LLDAAFAPLTQALIEAAHLSGDETIYEIGCGCGDLSLALAAKLRAQGKVIALDISKPML
FT                   ARAVERTQEAGATEAQKLQFIAADAMTYRFEPLADLVTSRFGVMFFADPLAAFKNIRLG
FT                   LKPQGRLAILCWCPLEENPWVKQLYDSVIDLAPPLPADLAAKCAMPSPDVPGPYAFSDP
FT                   KLVCDLLTKAGFTHVRATRVAELLPLGEAPAQAEDPIQAAVEAALPLVVNTGPVAALMR
FT                   EADAQLRAEIKARLRSTLATCVSAGKIELGGACWLYEADNAKQA"
FT   gene            complement(587897..588427)
FT                   /locus_tag="Bind_0534"
FT   CDS_pept        complement(587897..588427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94186"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ5"
FT                   /protein_id="ACB94186.1"
FT                   /translation="MKIMLACLAAGSTLLAINSATYAEHAKTNNAELIQRLNTGAPPAV
FT                   VKNATILDGDMKPVREGTNGWTCLEVMKAPTCADEAGMEWLKALMAKGPAPQKIGFIYM
FT                   LHGDEGASNTDPFATGKTADNYWITTGPHVMIVGAAAKDMMQAYPRDPKADPNKPYVMW
FT                   PGTPYEHLMLPVK"
FT   sig_peptide     complement(588356..588427)
FT                   /locus_tag="Bind_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 24"
FT   gene            complement(588664..589626)
FT                   /locus_tag="Bind_0535"
FT   CDS_pept        complement(588664..589626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0535"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: zmo:ZMO0094 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94187"
FT                   /db_xref="GOA:B2IEZ6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IEZ6"
FT                   /protein_id="ACB94187.1"
FT                   /translation="MNAPFVVSPVRHDWSRHEIKALYDLPLLELIARASQIHALYHDPN
FT                   DLQKASLLSIKTGGCSEDCGYCSQSARRDEVHLDRVEMMSPSDVLAVAAQARDNGADRF
FT                   CMGAAWRQVRDGAAFDAVLEMVEGVRALGMEACVTLGMLNQSQAQRLKQAGLTAYNHNL
FT                   DTSPEFYPQIVTTHTYDERLATLEAVRGEGIALCCGGIIGMGETVEDRVALLAILAGFD
FT                   PHPESVPINALVPVAGTPLGDRQKLDPLEIVRMIATARLVMPDSRIRLSAGRSSLSREA
FT                   QILCMVAGANSIFSGNVLLTTPNASLDADEALMEALAPR"
FT   gene            complement(589747..591117)
FT                   /locus_tag="Bind_0536"
FT   CDS_pept        complement(589747..591117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0536"
FT                   /product="Malonyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.9"
FT                   /note="PFAM: Malonyl-CoA decarboxylase; KEGG: bja:blr6729
FT                   putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94188"
FT                   /db_xref="GOA:B2IEZ7"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ7"
FT                   /protein_id="ACB94188.1"
FT                   /translation="MNSTSFFDLVASITERGRDLLARRLTAIDPEHNAKSLIELCEALL
FT                   SERGEASGLAQAAEILERYLSLDEAERIALFTAFAEKFGPNRERLTKAAKAWLADPQHA
FT                   DAGDLHYYSESVRQELFRRLNRAPGGTHALVGMRADLITLLPQNKHLTPVDRDLAHLLA
FT                   VWFNRGFLVLHRIDWSTPAIVLEKIIRYEAVHAIHDWADLRRRIDSLDRRCYGFFHPAL
FT                   IDEPLIFVEVALTEKMPAAIGPLLAEDRTVVPLEKARTAVFYSISTCQRGLAGISFGNF
FT                   LIKQVVEELRRELPNLTTFVTLSPVPGFMQWLQTAENLPLTEEQRAILPSLKEPNWTEK
FT                   PEEAEQLQKVIEPLAAYYFLKIKRPDGRPRDPVARFHLGNGARLEQIRWLGDRSPRSLS
FT                   EGAGLMVNYLYDLDDIEKNHEAFVKTGEIITSSAIKKLLKSDPKPRPSTAALPQPRG"
FT   gene            591531..592310
FT                   /locus_tag="Bind_0537"
FT   CDS_pept        591531..592310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0537"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   mex:Mext_1566 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94189"
FT                   /db_xref="GOA:B2IEZ8"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ8"
FT                   /protein_id="ACB94189.1"
FT                   /translation="MLPLTLSSFDLTSFIETLDGLRGLALDPASWIAVITLIAMEIVLG
FT                   IDNLVFVALLSGRLPPPQSGRARRIGIALSLVMRILLLSMAAFIVHLVDPVLTLAGKTF
FT                   SWRDLILLAGGLFLVYKATKEIRDTVDPEDAPAELMRKQSFGMVVLQIILLDIVFSIDS
FT                   IITAVGMTEHVPIMIIAVIIAVLAMLLAADPLANFIHRNPSIVILALGFLLLIGTTLIA
FT                   DGFGFHFPRGYVYAAMGFAALIEGLNMIARRRRKPQA"
FT   gene            592380..594590
FT                   /locus_tag="Bind_0538"
FT   CDS_pept        592380..594590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0538"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: mex:Mext_1010 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction protein res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94190"
FT                   /db_xref="GOA:B2IEZ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEZ9"
FT                   /protein_id="ACB94190.1"
FT                   /translation="MNRLIADVLIPVAVDIAYSYAVPEHLGVAPGDFVVVPLGRRQAEG
FT                   IVWDLRRGAADNLKLIQARLDLPPLAEDLRRFIDWVARWTLSPRGMVLRMAIRTPLQAP
FT                   PEPPRLGVMRAGVLPARMTPARHRVLEALGDGLVLARKELAKKAACSPNVIDGLIDEGT
FT                   LATTVLVDEPDSVREGISHGPTLEPDQAAAAVELTNQVRRQTFTVTLLEGVTGSGKTEV
FT                   YFEAVASALETGGHALILLPEIALTAQFLDRFTTRFGERPGEWHSAVGPRRRARTWRAV
FT                   AEGRIKVVVGARSALFLPFRDLRLIVVDEEHDSAYKQEDGVPYHARDMAVVRGQLSKSA
FT                   VILASATPSIETRVNAEQGRYGHLRLHARHGGRVLPALSAIDLRKAGPSPGKWISPRLA
FT                   QAMTETLARGEQSLLFLNRRGYAPLTLCRLCGHRFQCPHCTAWLVEHRFRKALVCHHCG
FT                   HIEPVPEACPACGGLHHLTACGPGIERVAEEAAELFPNARTLVLSSDLPGGTARMRDEL
FT                   EAVAQGACDIVIGTQLVAKGHNFPLLSLVGVVDADISLANGDPRASERTFQILRQVTGR
FT                   AGRFETQGQALIQTWQPEHPVIAALLSGDAERFYAEETEQRRRGGLPPFRRLAALIISA
FT                   KEAAVAERHARALVQAAHAMPPNPAYLLARGAPGPDADGIVLLGPAPAPITVIRARHRF
FT                   RLLIKAPRGADLQGFIRAVLAAAPPPRGDLRVSVDIDPQSFL"
FT   gene            594649..594969
FT                   /locus_tag="Bind_0539"
FT   CDS_pept        594649..594969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0539"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: mlo:msl0793 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94191"
FT                   /db_xref="GOA:B2IF00"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF00"
FT                   /protein_id="ACB94191.1"
FT                   /translation="MTKMTFITFDGTSIPVEAENGEILMRVGQRCEIPGILGECGGTCS
FT                   CGSCHVYIDESWRDRVPPVKELEQMMIDSLMTKQDNSRLTCMILVAPELDGLILHLPNP
FT                   NL"
FT   gene            complement(595121..596215)
FT                   /locus_tag="Bind_0540"
FT   CDS_pept        complement(595121..596215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0540"
FT                   /product="peptidase M50"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50;
FT                   KEGG: mes:Meso_2201 peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94192"
FT                   /db_xref="GOA:B2IF01"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF01"
FT                   /protein_id="ACB94192.1"
FT                   /translation="MSWSLTIGRFGATTLRVHLTFFLLVAWIGVSAWLKGGAPAARDSV
FT                   LFVALLFGCVVLHEFGHILMARRFGIETPDVILLPIGGVSLMPRMPEKPAQEFAVAIAG
FT                   PTVNIVIAFLLYLLLGSIHPEHLAQIDNPHISLLARLAAVNIFLVVFNLIPAFPMDGGR
FT                   ILRALLTMKLGKARATQLAASIGKAFAFALGFLGLFGNPLLIFIAIFVYMAAEGEAQMT
FT                   AFHEATHGLSVADAMETRFNAIPINANLAAAIEMLLATAQHEFPVIDAFGRPVGLLVRE
FT                   DILLALNDHSREAAINTFMRVPVETVQSTTPLEAVLDRLLVPQAADLVVTNPDGVLVGL
FT                   LTRQNLTEMMIIKSMRPDWRFDRA"
FT   gene            complement(596524..598029)
FT                   /locus_tag="Bind_0541"
FT   CDS_pept        complement(596524..598029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0541"
FT                   /product="Carboxypeptidase Taq"
FT                   /EC_number="3.4.17.19"
FT                   /note="PFAM: peptidase M32 carboxypeptidase Taq
FT                   metallopeptidase; KEGG: mex:Mext_0276 carboxypeptidase Taq"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94193"
FT                   /db_xref="GOA:B2IF02"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF02"
FT                   /protein_id="ACB94193.1"
FT                   /translation="MTSYHALEQQFARIDKIKDVIGLLNWDTETIMPDGAAEGRSEQLS
FT                   TLEGMAHRLLVSAETGELLDKAEAAADGLDDWQSANLREMRRLYFHAAAIPEELVEANS
FT                   KAVSRSLMAWRQARKNSDFAALLPYLKEVLDLQRRIGQIKGEALGLSPYDALLDTYEPG
FT                   MRQAKIDLLFTNLRAELPSLIQEAQARQASLPPTEALTGPFPIDLQRGLGKKLMAAVGF
FT                   DFERGRLDISLHPFCGGATDDVRITSRYDEERFISGLMGVLHETGHALYEQGRPEAWRH
FT                   QPVGAARGMALHESQSLLIEMQACRSRAFVHYLAPLLRETFQGDGAAWSADNLYRDLTT
FT                   VKPGFIRVDADEVTYPAHVLLRYDLEKAMINGDLRLEDLPGAFNEGMKTLLGLTVPNDG
FT                   LGCLQDIHWPGGSWGYFPTYTLGAMAAAQLFDAASRAEPDVLPGIGRGDFGPLRSWLSA
FT                   HVHRKGSLLEMDELLIAATGRPLGAEAFQKHLRTRYLEDRHQA"
FT   gene            598222..599445
FT                   /locus_tag="Bind_0542"
FT   CDS_pept        598222..599445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0542"
FT                   /product="protein of unknown function DUF949"
FT                   /note="PFAM: protein of unknown function DUF949; KEGG:
FT                   mex:Mext_4457 protein of unknown function DUF949"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94194"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF03"
FT                   /protein_id="ACB94194.1"
FT                   /translation="MDFKSWVRVWRAVSILVAFFACQQGAVAGGYSKGETPIPGATLAL
FT                   MRARDTTAEAPILIRTYKKEAELEIWKQARNGRFVLLKTFPICRWSGQLGPKSQQGDRQ
FT                   APEGFYWVGPKQMNPNSAYYLSFDVGYPNAYDKAHGGSGSYVMVHGTCSSAGCFAMTDK
FT                   GVGEIYAIAREALRGGQQAFQFQAYPFRMTAQNMAKYRLDANIAFWRQLKEGSDRFEAT
FT                   GEEPLVSVASGRYVFSPSKDPDKETLAQTHHLEEQARIATLVAEGSAAIQTTYADGGQH
FT                   PAFRALARQGTLLGEVSRPEALADAGREVIIVPAHPKRLAKGGAAARLIQTAAAKGTNP
FT                   TEAKPVPSMVSASLVPSASSVFGPVVQSKTEPSVFAPAPMSYRLGRLAPAQSMMTGAMP
FT                   ILPAVLVD"
FT   sig_peptide     598222..598308
FT                   /locus_tag="Bind_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.822 at
FT                   residue 29"
FT   gene            complement(599535..601517)
FT                   /locus_tag="Bind_0543"
FT   CDS_pept        complement(599535..601517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0543"
FT                   /product="elongation factor G domain IV"
FT                   /note="PFAM: elongation factor G domain protein; protein
FT                   synthesis factor GTP-binding; GTP-binding protein
FT                   HSR1-related; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain IV; KEGG: acr:Acry_2751
FT                   elongation factor G, domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94195"
FT                   /db_xref="GOA:B2IF04"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF04"
FT                   /protein_id="ACB94195.1"
FT                   /translation="MIGSLPRTEAVLPRTVALVGPYGSGKSTLFDALMARAGAPMKRVT
FT                   EARAMSTELRIGHCQFLGDPWTLLDCPGSIEFAYETACALDAADLALIVCEPVPQRLAS
FT                   LPLLLHMIEERGLPFLVFLNKIEMFIGNLNEITDLLQDTMKRPLALRQLPIREGETISG
FT                   FIDIASHRAYRYKAGQGTEPGSERIEIPQNLREPEEMAFSALAEKLADQDDRFLERLLE
FT                   EEMPTGTEIFEQLSQDQAAGTIAEVLLGSALHGYGITRLWKALRHDAPSATATAERHGI
FT                   GAGSEPLIHIFKTSHHATAAHAGKLSFGRVWRGIVKDGATMDGVRIGALYHFVSGEAVR
FT                   VKEAEAGDVIALARLELINTGQILGLRKGEEQLASSAPPPPSFALAIKAKDRLDDAKLA
FT                   QALHKLVEEDPSLSLEQDLEGGVMLLQGQGEIHVQSALERLTMQAHLAVQSGKPPVACR
FT                   ETIGETTIEHARLKRQTGGHGQFADVTLEIAPRRRGEGFVFIDRIVGGAIPKPFIPAIR
FT                   DAAEEAMSKGPLGYRVVDVSVTLLDGSYHTVDSSEQAFKTATRMAITAALAKAKPKLLE
FT                   PIDHVTVAVPRQNTPDAQRLLSGRRGQILGYGEREGWPGWDEIEAMVPAAELQDFVVAL
FT                   RSDTQGLGSYRHAFDHLAEAATMQR"
FT   gene            601761..602882
FT                   /locus_tag="Bind_0544"
FT   CDS_pept        601761..602882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0544"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: atc:AGR_L_226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94196"
FT                   /db_xref="GOA:B2IF05"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF05"
FT                   /protein_id="ACB94196.1"
FT                   /translation="MTKWRIRIVGGSLGGLFAAALLRRDGHDVRIYERSAGGLAGRGAG
FT                   LVSQPDISSILRAVGCEHVAQIGVVAKERIYFDRDGGIAERYPTPQMQISWDYLYNTFR
FT                   AFSDGEAYSLGRSVRSVAQDETGALLRFEDGAEDHAGLVIGADGVGSVVREAVIGQPSP
FT                   SLYAGYVAWRGLFPEQALPKDAAEILLDRFAFYTMPRSHILGYVVAGPNGEMAPGKRRY
FT                   NWVWYRPAPGRQGLDEALTDAKGQIHRYSLAPGALSQERREGLLSEAAMLLPPPFAAAV
FT                   GAEPQPFIQAIFDFEAPKMAKDCVALLGDAAFVVRPHTAMGVAKAAGDALALRIRLAES
FT                   ADIESALVAYDRDRRPVGVSIAARGRQLGKALE"
FT   gene            complement(602894..603457)
FT                   /locus_tag="Bind_0545"
FT   CDS_pept        complement(602894..603457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0545"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ava:Ava_4090 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94197"
FT                   /db_xref="GOA:B2IF06"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF06"
FT                   /protein_id="ACB94197.1"
FT                   /translation="MEVQAQIDFQGFHPTEQQRALIEQKIAGLEEFYDRITACRVVMKA
FT                   PSHHHRTGGQYEVNIHLVLPEGREVVVERTPPEDERFSDPMFAINDAFSRARRRLQDEV
FT                   RHIRGQVKVHETQPIGTVIRVRPEEDYGFLETEGREIYFHRNSVLDEAFAHLEPGVRVT
FT                   FVEEMGEKGPQASTVKLLGKHGLR"
FT   gene            603905..604819
FT                   /locus_tag="Bind_0546"
FT   CDS_pept        603905..604819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0546"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: gdi:GDI3480 putative
FT                   transcriptional regulator LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94198"
FT                   /db_xref="GOA:B2IF07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF07"
FT                   /protein_id="ACB94198.1"
FT                   /translation="MDNRAGEMLVFVRVVEAGSFSEAARQMLMTPSTISKLIARLEERL
FT                   GLRLLERSTRRLSLTDEGRIYYERSAALLAELDDIEGALAKGARNAGGIVRVNASVAFG
FT                   VLGIEPLLPAFWEAYPHIVVDLSLSDEIVDLYLDRTDIAFRVGALSDSGLIAVRIGVCR
FT                   RRIVASPEYLERHGTPQTMEDLEGHNCLGFNFRRAAPVWPFREGGRIVDRILAGTLLAN
FT                   NGETVHRMAKAGVGLARLADFHTRADIASGCLVEVLDGIGYDDEEEIHALYLGGQRMPQ
FT                   RIRLFLDFMVPRLQQFLRGGVKE"
FT   gene            complement(604867..605190)
FT                   /locus_tag="Bind_0547"
FT   CDS_pept        complement(604867..605190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0547"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bbt:BBta_4871 putative ferrodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94199"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF08"
FT                   /protein_id="ACB94199.1"
FT                   /translation="MIEIIDPTRCTSCNICVKVCPTNVFGSVKNSIPVIARQSDCQTCF
FT                   MCELYCPADALYVAPFTDELQIDDIHASHNNIDFGSYRRAIGWTKETNALRASDQSFEL
FT                   LKP"
FT   gene            complement(605204..606814)
FT                   /locus_tag="Bind_0548"
FT   CDS_pept        complement(605204..606814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0548"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: glucose-inhibited division protein A; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: bbt:BBta_4872
FT                   putative fumarate/succinate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94200"
FT                   /db_xref="GOA:B2IF09"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF09"
FT                   /protein_id="ACB94200.1"
FT                   /translation="MLSGEVISEGSGSVEFDADVLVLGGGPAGTWAACTAAERGARVIL
FT                   ADKGFCGSSGATAPSGTGVWYIEADAEKREAAMASREVLGGYLQDRLWMHRVLDRTFDS
FT                   INLLAARGYPFPIDANGHSRRNSLQGPEYMRLMRRQTQEASVLILDHSPALELLVDDTG
FT                   AVAGATGLRRQRGDNWVVRAKSVIMATGGCAFLSKALGCNLLTGDGYLMAAEAGADLSG
FT                   MEFSNAYAISASFSSVTKTLFYKWASFTYENGEIIPGAGSQGGRSAIARALMVGPVYAQ
FT                   LDQVEPGMQATLRLAQPNFFLPFDRVGINPFTQRFPITLLLEGTVRGTGGLRITDETCA
FT                   TSVAGLFAAGDAATRELICGGFTGGGSHNAAWAMSSGYWAGAAAADHAKQLGTTTKRQV
FT                   FRAGGVALRSRTKASFNPNETTKAVQDEVFPFKRNYFRTADQLVPSLDRLNKLWQTINH
FT                   ADAADRDQVLRARECAAMIATARWMYRSALARQESRGMHRREEFPHQDHKQHHYITTGG
FT                   LDDVWTGTRPVLAHALQDA"
FT   gene            complement(606875..609373)
FT                   /locus_tag="Bind_0549"
FT   CDS_pept        complement(606875..609373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0549"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: nar:Saro_1708 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94201"
FT                   /db_xref="GOA:B2IF10"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF10"
FT                   /protein_id="ACB94201.1"
FT                   /translation="MTSKAPTTEPFRFLFHTENSKAISVGMFRGGHPVHFSCLTFCLYI
FT                   ATMSAAKTQESSANEATLQDVVVTGIATPDTDKQAFSKQQATQRQFVPSSSTIITKQQL
FT                   DAAQVRNVLDAQRLQPGLRIRFTNVRNLSINIRGFGASSSSATDGIFNGVPVYIDGILQ
FT                   PRVGQALFDVPDLDGIEVLKGPQATSGGMDNTGGVVNLTTTLPSFATHASAEVSYGRYN
FT                   WAQFKGSLTGAVGDSTTTAFRLAAFGSDRDGYVSNYNGGQKLNDFHDKGMRGQILWQPT
FT                   EDLTARFIVDYAQISQACCGQIYNGGIAYYVNGQPIPNNFYNRAARIGLTPPPANALSS
FT                   YMTDNFGYQNTSQESYGAAAIVDYNLPDGYHFNSVTSFRGWDFHPHNFGDAIYVGLPTD
FT                   LTTRNNSHVTERSVQQEFKISTPKGQPVEGTAGLFYLYEQLYNWGLSAYGSQAGLWYGK
FT                   PTDSAAVNNTLNYTARESYDNPTTHYIAPYAQATWHVDPEFDLTAGLRYSYVYKTTLYR
FT                   QWQNAWDTSYLSPADQAASQAARNTLLGSPRQFTASTHQGLISALASASYKFAPDVMGY
FT                   VTFARSGRPGGPNPANLPVGAPTTVKEEEVENYEVGLKSQFFDQRLLVNVAAFYMNNHN
FT                   YITNVTSLVGSSFSTYLANAQRAVSRGVELDVRAQPFEGLNTYASMIYDNAYYASFDNG
FT                   PCPFERSNQTSCNFTGQPLSLVPRWAVAFGGEYSHHLGLVEPFTKPLIGYVGADFNWQS
FT                   SVFSNTTNSIYSVIGAYGLLNVHGGVKFEDSSWDLSVWGQNVLNKHYFITLSETNLGTG
FT                   IAAGNVGLPMTVGFTLRWQM"
FT   gene            complement(609757..610587)
FT                   /locus_tag="Bind_0550"
FT   CDS_pept        complement(609757..610587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsq:Rsph17025_0748 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94202"
FT                   /db_xref="GOA:B2IF11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF11"
FT                   /protein_id="ACB94202.1"
FT                   /translation="MTHDLDAHGLVIHAIDKDFNLPGGTFTALRNISLSIAPNEFVSIV
FT                   GASGCGKSTLLKLIVGLDQPTRGDIFLDGHKLTTPSLDRAIVFQEARLFPWLTAEQNIA
FT                   LSLIKSRLSTQEKQKTIAKHIELVGLKDFANALPAQLSGGMAQRVAIARALVTRPRILL
FT                   LDEPFGALDALTKAHMQNELQRIVQEEKITTVLVTHDVEEAIFLGDRIVVMHPHPGRIA
FT                   DIVPITLMDAERNRTHPSFVHLRETILIKLGEHIKNPSRSAGAGTNLPTMMHAG"
FT   gene            complement(610584..611384)
FT                   /locus_tag="Bind_0551"
FT   CDS_pept        complement(610584..611384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0551"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_3168 sulfate ester
FT                   transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94203"
FT                   /db_xref="GOA:B2IF12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF12"
FT                   /protein_id="ACB94203.1"
FT                   /translation="MSVHFAAPTLPTRASILLARRLVLPLLVLLVWETASHLELVSPKL
FT                   LPPLETLVKRGGEEFAQGRLPRDIAASLTRDLLGFALGAMLGTSLGILLGLSSLLRHLI
FT                   KPTFDALKQIAIFAWIPLVSVWFGIGEAAKIAFIAIAAFTPCLVNTLTGMAGIPRPYIE
FT                   VAKVLDFSPWSFLTRLAIPAALPSIFTGLHLGLIHSWLATIGAEYFMTAGPGIGGMMIA
FT                   GREQFEMDLVLLGVILLASIGVLLNNAALHVETYVLSWRKTSAQ"
FT   gene            complement(611381..612241)
FT                   /locus_tag="Bind_0552"
FT   CDS_pept        complement(611381..612241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0552"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_3169 sulfate ester
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94204"
FT                   /db_xref="GOA:B2IF13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF13"
FT                   /protein_id="ACB94204.1"
FT                   /translation="MTDLQIAHPVGRQSVRTRTKETVPFRSVVNGIGRRLNGKILLGLL
FT                   LPGALLALWAILARLGTLPEQILPAPSLVIETFQDYWASGELWQHCSYSLWRIAAGFSV
FT                   GASLGLILGIAMGLSPVVEDIVSPFFLAFAQVPAIGWVPLLMLVAGIGETLKILVIAKA
FT                   ALVPVAVNTQRGLHNVPKSYLEVGRVLTFDLKPMLRHIILPAAVPDIFSGIRYGLTNAW
FT                   LALVAVELIASAEGLGYLTVWGRQLFQLDVVIMAMIVIGTIGFLLDRGLQLIESHLLSW
FT                   RTLSR"
FT   gene            complement(612355..613464)
FT                   /locus_tag="Bind_0553"
FT   CDS_pept        complement(612355..613464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0553"
FT                   /product="sulfate ester transport system substrate-binding
FT                   protein"
FT                   /note="KEGG: azc:AZC_3170 sulfate ester transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94205"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF14"
FT                   /protein_id="ACB94205.1"
FT                   /translation="MPIHNRRGFGHKRGGVFSTLLPSIILLALFFASMNAAEALTIRIG
FT                   VAATGVGNRQFVGSGTIAVLHSEHYLEEEFKNDPDIKIEWFFFKGAGPAVNEALVNKQL
FT                   DFAMQGDLPAIIGRANGLKTKLLAANDVRANIYLAVASKSGVTTIEDLKGRKVAQFRGT
FT                   NMQIPVDKILAAHGLKETDIKFINMDVGTTAAALASGDIDAAFGQADFIDYEQKGIAKI
FT                   IYSTKGDDLGFTRHSHVLVTEDFEQAHPEITARIIKSWVKAAAWASDENHRDALYEIWG
FT                   RSGYPLEIFRADFQDVPLKSRLSPLIDDFLVAAYATKINEAKAYRLLRNTTTVDGWFEP
FT                   KYLKQALQDLGLDHYWTPNDAAGQPIVTQ"
FT   sig_peptide     complement(613345..613464)
FT                   /locus_tag="Bind_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.390 at
FT                   residue 40"
FT   gene            complement(613604..614542)
FT                   /locus_tag="Bind_0554"
FT   CDS_pept        complement(613604..614542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0554"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: ppg:PputGB1_0233 taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94206"
FT                   /db_xref="GOA:B2IF15"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF15"
FT                   /protein_id="ACB94206.1"
FT                   /translation="MTLATVVLPKHENAPIPDLDIHHVGGRIGAEISNVTLSSTLQPSI
FT                   IAAIRQALLRHKVIFFRNQTHLTDVEQESFGRLLGDLVPHPTVPSLEGTQAILELDGAR
FT                   GERASSWHTDVTFRAAYPKISILRGHVVPERGGDTTWSNTETAYEELPEVFRDFIDKLW
FT                   AVHSNEYDYVGDRGGNIPESAIKRYKQIFTSTVYEAEHPLVHVHSETGKRSLIIGHFVK
FT                   RITGFGTADSQRIISILHDHATRPENTVRWRWSVGDVAIWDNRATLHRAVDDYDDQPRI
FT                   VRRTTIAGEVPVSVDGQRSRERVQGSPSIAA"
FT   gene            complement(614747..616207)
FT                   /locus_tag="Bind_0555"
FT   CDS_pept        complement(614747..616207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0555"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: nar:Saro_0474 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94207"
FT                   /db_xref="GOA:B2IF16"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF16"
FT                   /protein_id="ACB94207.1"
FT                   /translation="MPGLFSFNRRNLLIGTAAATVTSLPQIARPATGDRAPNIIFILAD
FT                   DLGYADVSIYGRPDLSTPNIDGIGLKGARLLQAYANSAVCSATRTALLTGRYQYRERVG
FT                   LEEPIAGNIHVGLPPQRPTLPSLLKKAGYTTTLIGKWHLGTLPDFGPLQSGYDHFYGFR
FT                   GGAVDYYSHKGTDDQDDLWDQDTKVHQTGYLTELLGDRAIETINASAKTGQPFFISLHF
FT                   NAPHWPWEAPGDEAESARVAGTRLFDFDGGSQATYRGMIAAMDLQIGRIVQALQANGIS
FT                   ENTIVIFTSDNGGERFADTWPFTGRKTELLEGGLRIPALVSWPARIKADQTIDQVSISM
FT                   DWLPTLLAAAGSEPDPNFPSDGINLLPFLSESKAAIPRKLFWRYKANAQRAVRDGDYKY
FT                   LKIRDNDFLFNVVDDPLERVNLKERHKDIYNRLLAEWLEWNSTMLPEITESFTHGFTGH
FT                   ELADHYGVTAPTTEPDNPAPLRAMRRDD"
FT   sig_peptide     complement(616121..616207)
FT                   /locus_tag="Bind_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.936 at
FT                   residue 29"
FT   gene            616467..617711
FT                   /locus_tag="Bind_0556"
FT   CDS_pept        616467..617711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0556"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_0358 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94208"
FT                   /db_xref="GOA:B2IF17"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF17"
FT                   /protein_id="ACB94208.1"
FT                   /translation="MRDLIILFCTRSLRLFAFGLVSVILVFFLAERGFTTSEVGWLLSL
FT                   TLIGDAVISLFLTTRADRWGRRRTLMVSGLLMVVAGLAVITTGNFWLLALAMTIGVISP
FT                   AGNEVGPFLAVEQAALAHIVTPHQRTHYVAWYNVAGFSATALGALVGGILSGWWQGKGV
FT                   PALSSYTYLFGVYAGVGLLLVILSMRLSDAVEVEHNPVKNRGLIANWTGLHESRSIVLR
FT                   LSALFALDAFAGGFIVQSILAYWFYLKFGATNTELGGLFFATNILSGISALVAVPLARR
FT                   LGLVNTMVFTHLPSNLLLMAVPLMPNFQLAVGLLLLRHLISQMDVPARQSYVMAVVAPS
FT                   EYSAANGITATVRSLGSGLAPSLAGGLLSVAPLVNAPIFLAGGLKIVYDLALYRGFSHI
FT                   KPPEEIDAKTGSRPR"
FT   gene            complement(617776..618432)
FT                   /locus_tag="Bind_0557"
FT   CDS_pept        complement(617776..618432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94209"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF18"
FT                   /protein_id="ACB94209.1"
FT                   /translation="MLPLRDATNFVIQHTEWSPVPLVPEIRLRMSEDAIDLWEKAEAFC
FT                   DGIRLPPPFWAFAWAGGQALARYILDNFGLVRNRKVLDFAAGSGLIAIAAAKAGAARVE
FT                   ANEIDPFALAAIDHNAAENAVALTIRGEDLVGTDEGWDVVLAGDVSYERDMAARVTDWL
FT                   QKLHTRGALVLIGDPGRSYLAREKLECVARYRVPVSRAIEDSSEKETSVWRFRSV"
FT   gene            complement(618436..619086)
FT                   /locus_tag="Bind_0558"
FT   CDS_pept        complement(618436..619086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0558"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   pde:Pden_2924 protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94210"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF19"
FT                   /protein_id="ACB94210.1"
FT                   /translation="MSARDAILARIRQTTITKPEKDATILAEAQTLVADPAIGRPALDA
FT                   GALPVLFEQRLTSPKIGASLDKAATPGDVPEAVDRYLKAQGLAKEIALQPDPFLTSLDW
FT                   AGYTLHAEVKSDTPVAVGKALWGVAETGTLIFHSGPHSPTLFDFFPLHHLVIIEAARIL
FT                   GYLEDYVQAATGQPIPRNVNFVTGASGTTDIEGQLVKGAHGPRFLHVILVGGA"
FT   gene            complement(619083..620549)
FT                   /locus_tag="Bind_0559"
FT   CDS_pept        complement(619083..620549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0559"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   pde:Pden_2925 iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94211"
FT                   /db_xref="GOA:B2IF20"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF20"
FT                   /protein_id="ACB94211.1"
FT                   /translation="MSLTHPESATSSRADNPFAIPFDERVREALDNKSLKIAIDRTTNT
FT                   ARVKRAAAVASWPGFAQARDLGKRIKDHVISHLDHYLVEFEANAIRSGAKVHWASSSDE
FT                   ACAIVVDLCRKAGAKSVTRSKSMLGEEIGLPHALEEAGITRVETDLAEHIVQLAHDRPS
FT                   HIIWPALHRTREEVAELFRTHHHRPQNSDDIESMVASAREELRGRFLAADVGISGANFL
FT                   IADTGAICTVTNEGNAELTTTIPRVHIVTAGIEKLVPSMPHALVLLRLLVRSATGADLT
FT                   QYTTFHCGPKRPGDRDGPEEFHIVLVDNGRTKMLGEGLEEMLRCLRCGACMNHCVVYRQ
FT                   IGGHAYGGAYPGPMGSVITPVLDGLDKAHDLPEACTLNGNCQAVCPVDIPLPTLLRGWR
FT                   EKSWREGLEPQVVRQSLGLWSFGARHPFLYRLGTAIAVRGMRLLAKQGWISSMPLASGW
FT                   TRYRDFPKPAPRTFMEEWKQHQNKKARSQA"
FT   gene            complement(620555..621352)
FT                   /locus_tag="Bind_0560"
FT   CDS_pept        complement(620555..621352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0560"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: pde:Pden_2926
FT                   protein of unknown function DUF224, cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94212"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF21"
FT                   /protein_id="ACB94212.1"
FT                   /translation="MQAASPHNQHQDQASGTPKVGLFVTCLIDLVRPRIGFAAISLLEQ
FT                   AGCLVDVPQSQTCCGQPAYNSGDDNHARALARNVIAGFESFDYVVVPSGSCAGMIKKYP
FT                   PLFQGDPAWQQRAEALAARTYELLSFLVDVRGFRPKGVTLHTSATYHDSCSGLRQLGVE
FT                   AQPRALLASVEGLSLTPLPGHDICCGFGGTFCVKYPAISNAIVDEKARDIEDTKADLLL
FT                   GGDLGCLLNMAGKLHRRGAATRTFHTAEILAGMGSGPAIGEEG"
FT   gene            complement(621551..623233)
FT                   /locus_tag="Bind_0561"
FT   CDS_pept        complement(621551..623233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0561"
FT                   /product="L-lactate transport"
FT                   /note="TIGRFAM: L-lactate transport; PFAM: L-lactate
FT                   permease; KEGG: azc:AZC_4251 L-lactate transport precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94213"
FT                   /db_xref="GOA:B2IF22"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF22"
FT                   /protein_id="ACB94213.1"
FT                   /translation="MWQQVYDPFNNQLLSTAVASLPIICLLGLIAFSKVKAHIAAVLAL
FT                   ILAFLVVTLGFTMPPVMAAKAAFLGAMTGLFPIGWIIINVIFLYRLTVENGSFAILQDS
FT                   IANVTPDRRLQLLLVAFAFGAFFEGAAGFGTPVAVTGAILIGLGFSPLAASGLSLIANT
FT                   APVAFGALGAPVVTLAAVTNLDLGQVTAMVGRQLPLFSVMVPFWVVAAFAGFRGTLEVW
FT                   PAVLITGLAFAIPQFLVSNFHGPWLVDVIAALVCMACLIGFLQIWQPKRIWTNANFANR
FT                   FDVSLRPVSVGAAATPAETTRLTYTKGDLFKAWMPWLILCAIVFVWGTESFKVPVNNLF
FT                   LPKFTIEGLHQLVQKVPPVALKPAVESAVFSFNILTMSGTGILLAGIISGFLMGFGPLA
FT                   QIKAYGRTFWVVRYSLLTIAAMLALGTLTRYAGLDATLGLAFAGTGVVYPFFAALLGWL
FT                   GVALTGSDTASNVLFGGLQTVTAQQLGLSPILMAAANSSGGVMGKMVDAQSIVVASTAT
FT                   NWFGHEGTILRFVFRHSIVLACLVGIFIMLQAYVYPFTLTVIH"
FT   gene            complement(623400..624050)
FT                   /locus_tag="Bind_0562"
FT   CDS_pept        complement(623400..624050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0562"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: mex:Mext_2639
FT                   maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94214"
FT                   /db_xref="GOA:B2IF23"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF23"
FT                   /protein_id="ACB94214.1"
FT                   /translation="MQIFTFWRSLASFRVRIGLNLKGLAPEQIFVNIFTGELQEPAYKA
FT                   VNPQGLLPALIDGDGPPLVQSLAILEYLDETHPEPPLLPKDPRGRARARALAQIAAGDA
FT                   HSLVTPRVRGFMAKTYNIDEAGQTLWARHWVGLGLEAIEAHLAQEKETGLFCHGDSVTV
FT                   ADISVISLAVGQQLFGGTLEAYPFLSAIFDRCMALEAFATAHPLRQPGAPQQA"
FT   gene            624126..624563
FT                   /locus_tag="Bind_0563"
FT   CDS_pept        624126..624563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0563"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   xau:Xaut_4390 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94215"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:B2IF24"
FT                   /protein_id="ACB94215.1"
FT                   /translation="MDATIREGEKAVDPPRNFDASLVFIGTIHTPWHERGDCPRQGDEA
FT                   GPDCRIDVDPHWREALEGIEAYSRLQVLYWMNEARRDLVLQWPRGAEKPCGTFALRSPV
FT                   RPNPIASSIVLLVRREGTSLIVRGLDCRDGTPLLDLKPHRG"
FT   gene            complement(624679..626064)
FT                   /locus_tag="Bind_0564"
FT   CDS_pept        complement(624679..626064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0564"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: rso:RSc2518
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94216"
FT                   /db_xref="GOA:B2IEU3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU3"
FT                   /protein_id="ACB94216.1"
FT                   /translation="MSILVALLGLAFLIFVAYRGFSVILFAPIAAMIPVVLTEPSSVPA
FT                   VFTGLFMEKAVVFVKLYFPLFILGAVFGKVIELSGFSKSIVSTVIHAVGAQRAILSIVL
FT                   VAALLTYGGVSLFVVVFAVYPFAAEMFRQAGIPKRLIPATLALGAFSFTMDAVPGTPQI
FT                   QNIIPTTFFQTNSWAAPWLGTIGSLFIFITGMLYLEWRRRSAGNEGYGTGHINEPAPVS
FT                   TEHLAHPLIAFLPLLGVFVFNIVLTGLIPKFFGPVQEVTLPGLTAPIITKVPTVTAIWA
FT                   LEGALLLSILLVVVLAFRPLKKSFMEGSKLAVAGALLATMNTASEYGFGAVIAALPGFL
FT                   AVREALQAIPNPLVNAAIVTTTLAGITGSASGGLSIALAAMADQFIAGAHAAGIPLEVM
FT                   HRVTAMASGGMDILPHNGAVITVLAVTGLTHRQSYNDIFVIALLKTSAVFFIIGVYYAT
FT                   GLV"
FT   gene            626696..628234
FT                   /locus_tag="Bind_0565"
FT   CDS_pept        626696..628234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0565"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rpe:RPE_0360 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94217"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU4"
FT                   /protein_id="ACB94217.1"
FT                   /translation="MVVRIATVAFEGIEARPVDVQVQIANGNVVFAVVGLGDKAVAESR
FT                   ERVRAALNASGLALPAKRITVNLAPADLPKEGSHYDLPIALGIMAAIGALPADALADYT
FT                   ILGELALDGTITPVAGVLAAALAANARGHGLICPRECGPEAAWAARDLPIIAPTSLIQL
FT                   VNHCKGTQVLQRPFAALRKEPSDQPDLREIKGQETAKRALEIAAAGGHNLLFNGPPGAG
FT                   KSMLAARLPSILPPLNPRELLEVSLIHSVAGDLAGGTLTDRRPFRAPHHSASMAALVGG
FT                   GVRARPGEVALAHHGVLFLDELPEFQASVLDSLRQPIETGEVAIARANHRITYPARFQL
FT                   IAAMNPCRCGHAMDPGFACARQPNARCMAQYQAKLSGPLLDRIDLHVEVAAVAAADLLL
FT                   PAPAEGSAEVAARVAEARAIQRRRYDALDLPQIGSNAAAPAKIIEQVASLDSGGLSLLR
FT                   EASDRLHLSARGFHRVLKLARTIADLKGGGSVTAAHLAEALSYRGDLAQRRTAA"
FT   gene            628327..629898
FT                   /locus_tag="Bind_0566"
FT   CDS_pept        628327..629898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0566"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Rieske [2Fe-2S] domain protein; KEGG:
FT                   bam:Bamb_5661 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94218"
FT                   /db_xref="GOA:B2IEU5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2IEU5"
FT                   /protein_id="ACB94218.1"
FT                   /translation="MPSNEQENAAVNTQKTCAKPLFIDLTHPVKLETIPENQIVEACLG
FT                   EQSAILIREGTTLSILSGKCTHAGGPLAEGLLMEGHIRCPWHHACFDAHTGEALAAPAF
FT                   DPLERWAARIEDGMVFVDHKDSTPTHALQAAAPSDPFVIVGGGAAGFAAAEALYHEGFV
FT                   GQVVLISREAAGPYDRTMLSKDYLGGKLGEDQLPLHSQAFGQGSGKSAGRIDLGTEVER
FT                   IDRGRHCVVFADGQELRYAKLLLATGAEPRAPTFPGYNLPHVHVLRSLADCRSLIEHAA
FT                   HARHVVVLGASFIGLEAAASLRERGLEVDIVAHSEQPMEKTLGAQLGETLRALHENHGN
FT                   RFHLGRTILSVEPDRVLLDDGTVLPADLVLVGIGVEPRLDLAKASGLVVENGVLVDEFL
FT                   ATSDPDIYAAGDIAAWPDPHSGRRIRVEHWDVAERQGQIAAKNMLGLATPFTDVPFFWT
FT                   RQFDFSLSYIGHAPHWDRIEIDGDPSAGDGTLRYIDHGQVIAAAMIGRDAECLRERERM
FT                   EHILAA"
FT   gene            complement(629939..631519)
FT                   /locus_tag="Bind_0567"
FT   CDS_pept        complement(629939..631519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0567"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: rpc:RPC_0415 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94219"
FT                   /db_xref="GOA:B2IFK8"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFK8"
FT                   /protein_id="ACB94219.1"
FT                   /translation="MALSTKLVMRQGQSLVMTPQLLQAIKLLQFSNLELAAFVEDELER
FT                   NPLLERAEEAHEPYEPMLSTAYEAKDGHDFGDPEGHAFNESSEADWNSESFATDRGSME
FT                   ASLGTELSNTFDDDRAPTPGDHHDAGLDGYGLEGAGLSATSWSGTSGLNGDGEATNLEA
FT                   YVAAEATLKDHLAGQLAIATSDPVDRLIGNALIDSLDEVGYLTDPVEDIAQRLGTSVQR
FT                   VERMLGVVQTFDPSGVGARNLSECLAIQLRERDRLDPAMQALLNHLGLLAKRDFAALRK
FT                   ICQVDEEDILDMLNEIRRLDPKPGRAFGSSSIQPVVPDVIVRPLPDGSWHVELNADVLP
FT                   RILVNHTYAARVSKVKAKEADKAFMSNCLQTANWLTKSLEQRARTILKVSSEIVRQQDA
FT                   FFAKGVEHLRPLNLKTIADAIGMHESTVSRVTSNKYMTTPRGLFELKYFFTASINAHNG
FT                   GEAHSAESVRFRIKQMIDQESAKDILSDDAIVARLKEANIDIARRTVAKYRDSLKIPSS
FT                   VERRREKAL"
FT   gene            complement(632053..632988)
FT                   /locus_tag="Bind_0568"
FT   CDS_pept        complement(632053..632988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0568"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azc:AZC_3926 putative ABC transporter ATP-binding
FT                   protein in NtrA/RpoN 5'region"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94220"
FT                   /db_xref="GOA:B2IFK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFK9"
FT                   /protein_id="ACB94220.1"
FT                   /translation="MKSSYSFRRFGQWITTLKAPGSSRTVEAAAAGYGGEWLMEEEPAP
FT                   DLFEPVIDTPNLVTSTLSEHANPETSEGVLAASHLRKFYKTRRVVEDVSLHVRRGEAVG
FT                   LLGPNGAGKTTVFYMITGLIRPDQGNIFLDGHDVTPLPMYRRARLGVGYLPQEASIFRG
FT                   LSVEDNIRAVLEISQPDKHKRAEELESLLDEFDIKRLRKSPSIALSGGERRRCEIARAL
FT                   AGKPAFMLLDEPFAGVDPIAVNDIKVLVRHLTQRGIGVLITDHAVRETLGLIDRAYIIH
FT                   SGHVLTDGTPDEIVAHEDVRRFYLGADFRL"
FT   gene            complement(632985..633218)
FT                   /locus_tag="Bind_0569"
FT   CDS_pept        complement(632985..633218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94221"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL0"
FT                   /protein_id="ACB94221.1"
FT                   /translation="MLRRTGFPFSGTIHGSVRTFIATPPLSTRIDQSLDLNPQAIGQDQ
FT                   IGKCRIMDLASFDEKRDARKIVRCEGEPAACT"
FT   gene            complement(633384..634022)
FT                   /locus_tag="Bind_0570"
FT   CDS_pept        complement(633384..634022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0570"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: mex:Mext_2499 OstA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94222"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL1"
FT                   /protein_id="ACB94222.1"
FT                   /translation="MSPIALLRHAWWRPALIGLFFLQMGLSPTSLAAKPPVAAKPAAPA
FT                   PADPSAGRVLPGGNGHQPVNIEATKLDYFDKEQKLIYTGNVVATQGETILKTSTLIIYL
FT                   VPKGSTANSAGGTGSDQVRRMEAPNAVVMISKDQVGTGDSGVYEKAENKVTLNGNVTLT
FT                   QGPNVTKGDKLVYDLHTSQAVVIGHVRSLFLPSDSKSAEAPAKPAAPKP"
FT   sig_peptide     complement(633924..634022)
FT                   /locus_tag="Bind_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.911 at
FT                   residue 33"
FT   gene            complement(634019..634744)
FT                   /locus_tag="Bind_0571"
FT   CDS_pept        complement(634019..634744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0571"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bbt:BBta_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94223"
FT                   /db_xref="GOA:B2IFL2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL2"
FT                   /protein_id="ACB94223.1"
FT                   /translation="MSDSDGRSAWLRPASSGAKGKGPQSQQKLVYGDFAAANRHTSRVR
FT                   WLRRAFIIVPVVIGLGIFVMTVFDPFRHFPGNISIGRVDIEGSKITVETPNITGLQTNG
FT                   QPFAIRAAKAVQNIVQPNIVTLTDVNSDLGMEDKSNAHITAETGVYDSKIDRVQLTGKV
FT                   RIKNIGRYDMRMQRSEIYMKPGILDGWDKVEVLIEDGIIKADSMHLEDNGHHITFAGNV
FT                   FSHFDSEAPAEAPQAGGQP"
FT   gene            complement(634832..635446)
FT                   /locus_tag="Bind_0572"
FT   CDS_pept        complement(634832..635446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0572"
FT                   /product="3'-5' exonuclease"
FT                   /note="PFAM: 3'-5' exonuclease; KEGG: rpc:RPC_0419 3'-5'
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94224"
FT                   /db_xref="GOA:B2IFL3"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL3"
FT                   /protein_id="ACB94224.1"
FT                   /translation="MAIHLHKGDLPENVSFGRSVAVDTETLGLLPHRDRLCLVQLSGGD
FT                   GQAHLVQIKPGQTHAPHLERLLIDPNVTKLFHYARFDIAVLYKTFGTMTTPLYCTKIAS
FT                   KLTRTYTDRHGLKDLARELLGVDLSKQQQSSDWGADTLSDAQLTYAASDVLHLHALRTK
FT                   LDGMLEREHRTELAQACFDFLPTRAKLDLAGWAETDIFSHA"
FT   gene            635767..636999
FT                   /locus_tag="Bind_0573"
FT   CDS_pept        635767..636999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0573"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: azc:AZC_0229 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94225"
FT                   /db_xref="GOA:B2IFL4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL4"
FT                   /protein_id="ACB94225.1"
FT                   /translation="MDARVTVAQTTKAASQREADEPHSLVVRFGLDQPLAMDAGVSLAP
FT                   LTIAYQTYGTLNADKSNAILVCHALTGDQHVASDHPITKKPGWWWIMVGPGRPIDTNRY
FT                   FVISTNVVGGCMGTTGPASLNPATGRPYGLDLPLVTIRDMVNAQAMLIDHLGIETLFCV
FT                   AGGSMGGMQVLQWAASFPSRVFAALPIATAAKHSSQNIAFHEVGRQAIMADPNWCQGRY
FT                   LEEGVFPTKGLSVARMAAHITYMSDEALQSKFGRKLQGREAPTFSFDADFQIENYLRHQ
FT                   GTSFVDRFDANSYLYVTRACDYFDLAADYGGSLALAFKGTKTRFCVVSFQSDWLYTTAA
FT                   SRAIVHALNAGGASVSFVDIETDRGHDAFLLNEPEFIATTRGFLDAAARARGLPPAKGS
FT                   SRTESPEEETL"
FT   gene            637002..637649
FT                   /locus_tag="Bind_0574"
FT   CDS_pept        637002..637649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0574"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: nwi:Nwi_0586
FT                   methionine biosynthesis MetW"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94226"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL5"
FT                   /protein_id="ACB94226.1"
FT                   /translation="MAEGQNSRKRRAAFPAPRVDELLIADMVEPRSRVLDVGCGDGTLL
FT                   HLLSEDRGVDARGIELSQRGVNDCVAKGLSVIQGDADTDLEGYPDDAFDYVILSQTLQA
FT                   TRRPRQVLEHMLRIGRHAIVSFPNFGHWRIRAQLALLGHMPITHNLQAPWYDTPNIHFC
FT                   TISDFLALAQTIDARIERGIALGRFGTPLRFSEPWIWNLFGEQGVFRLTRKE"
FT   gene            637724..639091
FT                   /locus_tag="Bind_0575"
FT   CDS_pept        637724..639091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0575"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   rso:RS02383 probable amino acid transporter transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94227"
FT                   /db_xref="GOA:B2IFL6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL6"
FT                   /protein_id="ACB94227.1"
FT                   /translation="MTDEGGLGLKPDALSLPEAVIMGIAGTAPAYSMAATTATLIAVTG
FT                   ILAPASLLICGLVMFGVAFAFLHLTRLDPNAGAAYIWVKQTLHPVLGFFAGWAMLVMSA
FT                   LFMVSGTVPAATAMLQILAPGFVQNMMAVTLVAAFLMILIGLIVLKGIKLSSHFQVILT
FT                   LIEVGIVAGLIIAALFASFAHPAHALSFGLLLGQDFTPSLFVSGALVAVYFYAGWDVTA
FT                   NLNEETRNPKRSGGVASVLAMLALMLMLIGFSAACLLTLSDDDIQKAGTDIVTTVAARI
FT                   LPAPWSSLAVIAVVLSTIGTLETNILQFTRTLFAMARDGVFARRYARVHAVHQTPWLST
FT                   VLVTAIGLGLLLLSSSFSSVSAIMKASASALGFQIAFYYALSCLACAWCLRRGFRSSQI
FT                   LLTGILWPLISALFLFGVAIGSLPTFDGVTLFVSLGSLAFGAVPLLLSRMRSAAKA"
FT   gene            complement(639099..640721)
FT                   /locus_tag="Bind_0576"
FT   CDS_pept        complement(639099..640721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0576"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_0622 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94228"
FT                   /db_xref="GOA:B2IFL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL7"
FT                   /protein_id="ACB94228.1"
FT                   /translation="MIRLDNIGKQNGKQLVFIEASAAIQRGEKVGLVGPNGAGKTTLFR
FT                   MITGQEQPDEGQVVTDRGITIGYFSQDVGEMFGRSAISEVMDGTGPVSAVAAELKALEA
FT                   DMADPDRMDEIEAIIERYGEVQARFEDLGGYALEGRAREVLAGLSFTEEMMDGDVGALS
FT                   GGWKMRVALARILLMRPDAMLLDEPSNHLDLESLIWLEEFLKGYDGALLMTSHDREFMN
FT                   RIVTKVVEIDGGALTTYSGNYEFYEQQRALNEKQQQAQFERQQAMLAKEIKFIERFKAR
FT                   ASHAAQVQSRVKKLDKIERVEPPKRRQSIAFEFPTAPRSGDDVVSLKNVHKRYGDRSIY
FT                   EGLDFVVSRKERWCVMGINGAGKSTLLKLVTGSTQPDNGTVSLGGSVKMGYFAQHAMDL
FT                   LDGERTVFQSLEDTFPQAGQGSLRALAGCFGFSGDDVEKKCRVLSGGEKARLVMARMLY
FT                   DPPNFLVLDEPTNHLDIVTKEMLIAALSQYEGTMLFVSHDRHFLAALSNRVLELTPEGI
FT                   HKYGGGYTEYVARTGQEAPGLRS"
FT   gene            640923..641837
FT                   /locus_tag="Bind_0577"
FT   CDS_pept        640923..641837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0577"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: smd:Smed_2363 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94229"
FT                   /db_xref="GOA:B2IFL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL8"
FT                   /protein_id="ACB94229.1"
FT                   /translation="MDDISLSHIFLVCADEGSFSAAGRKLNLSRSSVGKTVARLEDMLG
FT                   VRLFHRSTRHQALTEEGKIYYEHARRAHNELDRARQIFASGHRSPSGILRVTAPMSLGR
FT                   SCIGPLLLDFTSRFSDLKLVLSLNDRPVDLIDEGFDLAIRVGATINTTGIAGRKLSTQA
FT                   MRLYASPSYLGARGTPKSCGEFDQHQILAYGRGRTLRWRFAGVGGQALQDVEGMSQAQF
FT                   DDLDLLANATAQGFGIASLPTWLAHPRALRGELVPLKAFNLKPYDISALWPQSHFMPPK
FT                   VRYAIDHLVQALPGLLTDDLKGH"
FT   gene            641957..642835
FT                   /locus_tag="Bind_0578"
FT   CDS_pept        641957..642835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0578"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mex:Mext_0756 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94230"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFL9"
FT                   /protein_id="ACB94230.1"
FT                   /translation="MDVVIQTQGPAINRRKVGDLIVTMLSDGFLDVSFDLLDGISSKDA
FT                   ASLLSQHRVSTLPRMNVNVFVIQNGEQMILIDGGAGGIHGWGGRLPVALSAAGIDPLYI
FT                   DIILLTHAHPDHVGGLAGPLATPHFRNVKQVYVHKAEYDFWRNDMIRAAAPDGFRPFFD
FT                   VAQNVFDAYKEQIIVFTGEDVIPKIQAVPLPGHTPGHTGYLISDKGESLLIWGDIVHFP
FT                   YVQIARPEVTIAFDNEPAEAAAIRRHILDRASSEGLLVSGMHFNMPTCGRIERASGGYE
FT                   LIYEAWSPALI"
FT   gene            complement(642844..643758)
FT                   /locus_tag="Bind_0579"
FT   CDS_pept        complement(642844..643758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0579"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rle:RL3780 putative LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94231"
FT                   /db_xref="GOA:B2IFM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM0"
FT                   /protein_id="ACB94231.1"
FT                   /translation="MDRIDAMRVFVRIVERGSFVRAAEDLGLPPSTATDAVKQLETRLG
FT                   VRLLQRTTRQVRTTLDGEAYYRRCLAILNDIEEAESAFSGALPRGLLRVDVQGTQARRF
FT                   IVPALPRFFADYPDLELFMSEGDRFVDLVGEGIDCALRTGEPKESDIIARRIAMLPEVT
FT                   VASANYIGRFGHPQRWDALDGHRMIGFRSSATGGVLPLEFMVNGTRKTVTLPSTLAVNG
FT                   ADTYKAAAQQGLGLIQVPRYSVEQDLAEGRLLECLPETPPSPTPVYVLYPRSRQLSLRV
FT                   RVFIEWVAKEYASHSGSIAATND"
FT   gene            643870..644637
FT                   /locus_tag="Bind_0580"
FT   CDS_pept        643870..644637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0580"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: hch:HCH_02025 short-chain alcohol
FT                   dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94232"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM1"
FT                   /protein_id="ACB94232.1"
FT                   /translation="MTTNETKIALVTGASRGLGRSMAIALAHKGVDVIGTYHSNKAEAD
FT                   ATVAAVEALGRKAVMFQLDTSNTASFASFAVDLKQRLAANWNRSTFDYLVNNAGIGIYA
FT                   PFAETSEADFDRLMNIHLKGVFFLTQALLPLIADGGRIVNLSSGLTRFSLPGYAAYAAM
FT                   KGAVEVLTRYLAKELGPRGIGVNTIAPGAIETDFGGGSVRDNKQVNDFIASVTALGRPG
FT                   LPDDIGPAVASLLTEDNRWINAQRIEVSGGMFV"
FT   gene            644655..645548
FT                   /locus_tag="Bind_0581"
FT   CDS_pept        644655..645548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0581"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   domain; KR domain protein; KEGG: rle:RL3778 putative
FT                   short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94233"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM2"
FT                   /protein_id="ACB94233.1"
FT                   /translation="MGQVIVITGASSGFGALTARALADAGHIVYAGMRDTAGRNAPQVE
FT                   AAKAYAKERAVDLHTVEMDVQSEASVEAAIATILRENSRLDTLVHNAGHMVFGPAEAFT
FT                   PEQYAQLYDVNVLGTQRVNRAALPILRRQGKGLLVWVSSTSTRGGTPPWLAPYFAAKAA
FT                   MDSLAVSYAGELARWGIETSIIVPGAFTKGTSHFAHAGAPADTARAKDYANGPTADIPD
FT                   VAMKGLSALEPADADAGEVAKAITRVVDLPFGRRPFRVHIDPSQDGAEIVNGVADRVRA
FT                   ELLRRIGLEDILHPRA"
FT   sig_peptide     644655..644726
FT                   /locus_tag="Bind_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.838 at
FT                   residue 24"
FT   gene            complement(645606..647222)
FT                   /locus_tag="Bind_0582"
FT   CDS_pept        complement(645606..647222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0582"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: bmu:Bmul_4948 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94234"
FT                   /db_xref="GOA:B2IFM3"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM3"
FT                   /protein_id="ACB94234.1"
FT                   /translation="MKESMTPIAQFELILGLMVAVLGLVWLAQRLRLPQAAMLIIGGIV
FT                   LALLPWTPDVELDPNLVLILFLPPLLLSSAFFTAWQDFRADLRIILQLAIGAVAFTTLC
FT                   IGYVAHWANPALPLAACFTLGAIVSPPDAVAVKAVLQHLRLPPRMSIMLEGESLVNDAA
FT                   ALVLFHFAVAAALTGTFDAGHAVIEFILLAAGGVLAGLIFGMVALFIMRHLHDELLVIV
FT                   SGFLTAWGSYIGGESLLHVSGVLTTVTCGFFLGWRAHEEMDASTRLKARGVWDIAIFLL
FT                   ESMVFILIGLSLRGVMMRLDKDWDVFFTWLPAIGIITGAMIISRFCWIFPTTYIVRWLL
FT                   PWLRQRDPYPPIAVPLVMSWAGMRGVVTLAVALALPDTFPGRDFILITAFTVILVTVLV
FT                   QGTTLAPLIRIIGLNAKSMPLTKTLTEAEARAKIAAVQLALVERKSLQPDGTHLHPRLA
FT                   EQYGYRARVSARFARETKELLPHRNAHFQVVQEAIKAGRAELLRLHRTGAVRDETLRDL
FT                   EHELDLEEINVQGWLSDYKDL"
FT   gene            complement(647390..647923)
FT                   /locus_tag="Bind_0583"
FT   CDS_pept        complement(647390..647923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0583"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: xau:Xaut_2496
FT                   inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94235"
FT                   /db_xref="GOA:B2IFM4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM4"
FT                   /protein_id="ACB94235.1"
FT                   /translation="MRLEAIAIGKNPPDEVNVVIEVPIGGEPIKYELDKDAGALFVDRF
FT                   LYTSMRYPGNYGFIPHTLSDDGDPCDVIVANTRAIIPGAVMSCRVVGVLLMQDEAGGDE
FT                   KIIAVPSSKLTKRYEKVTNYTDLPEITLKQIEHFFTHYKDLEPNKWVKILRWGDAEEAR
FT                   KIVLAGIEKAKAAK"
FT   gene            complement(648109..648633)
FT                   /locus_tag="Bind_0584"
FT   CDS_pept        complement(648109..648633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0584"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rpa:RPA0410 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94236"
FT                   /db_xref="GOA:B2IFM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM5"
FT                   /protein_id="ACB94236.1"
FT                   /translation="MIEAVITIRAAREKDAEGIAAVHDAAWRDAYRGIIPGRELERMIT
FT                   RRGPVWWHSAIVRGSRLLLLEWDDTICGYTSYGRNRVPSMPYGGEIFELYIAPEFQGVG
FT                   FGKRLFQVAGQDLAAHGYANFLVWALADNERGVRFYEGQGGTMVRQANERFGTETRPRI
FT                   AFAFDNLPFSR"
FT   gene            complement(648895..650271)
FT                   /locus_tag="Bind_0585"
FT   CDS_pept        complement(648895..650271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94237"
FT                   /db_xref="GOA:B2IFM6"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM6"
FT                   /protein_id="ACB94237.1"
FT                   /translation="MTYPSQSQRQRCSIITHPPPVQMSVIPMPVASRPHDNPATDAADL
FT                   LTLLGLTILMIGLPLAGIFSKSAIYSLLPIGAVLVFLGSVLESAEHGTHHLRGVLISRG
FT                   SVVGLFLVGWTSLSLLWTPFPGEASEHLLKGLGTLALVALVGIFLPSRTKPRHLSLLPI
FT                   GLGLTIVAVLAMLLIGPASFRTASEFDESLFERSVLTLTVLVWPALGALALRERWISAA
FT                   LLAVLVAVVAIAGRAQITLAALGAGAFTFAIAMSAPAKTARVLVCLFVPLILFAPAIPL
FT                   LVRLLHQIANLPLAPQSSLALWAELLDHDGIRLLTGHGADLASRAMSLGYLPPNTPKTL
FT                   LFLIWYDLGIIGALSFALLTALALLKASRLSIAIAPALLGGCVVVLTIAILGLATIQVW
FT                   WVSLLGCDIIAFLLLLKSPHRLTRPVATDIEAFAEEETAGPPAPPNGAPPSWARSPYPV
FT                   "
FT   gene            complement(650306..651058)
FT                   /locus_tag="Bind_0586"
FT   CDS_pept        complement(650306..651058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0586"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rpc:RPC_0385
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94238"
FT                   /db_xref="GOA:B2IFM7"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM7"
FT                   /protein_id="ACB94238.1"
FT                   /translation="MSSPLSPPSLHSDHPRTAMVFAAGLGTRMRPLTEKTPKPLIKVAG
FT                   KPLIDHMLDRFAAIGLPTAIVNVHFHPEQIEAHLASRTEPHILISDERSLLLDQGGGIK
FT                   RALPLLGEAPFFICNTDAFWLEGPCSNLQRLAAAWDPDRMDILLLIAATTSSQGVDWLG
FT                   DFSFEPDGRLKKRQERMVAPFVYAGVGIVKPELFQAETREVFPLAPYFFAAAAQDRLFG
FT                   LRLDGVWLHVGTPEAIEEAELTVARSIL"
FT   gene            complement(651165..652853)
FT                   /locus_tag="Bind_0587"
FT   CDS_pept        complement(651165..652853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0587"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function UPF0079; KEGG: mex:Mext_4431 protein of
FT                   unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94239"
FT                   /db_xref="GOA:B2IFM8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM8"
FT                   /protein_id="ACB94239.1"
FT                   /translation="MSELASGTGRTTVDTSIWHKELPGEAATAALAADIAPLLGPGDLL
FT                   TLSGDLGTGKTSFARALIRVLVGDPTLEVPSPTFTLMQLYEGERCPIVHADLYRISRPE
FT                   DLAELGWEEAGEGAIVIVEWPEHAREVLNSDRLDIAFFLDPAQPPTFRSATLTGHGAMA
FT                   ERLANARALQGLFERSGWHFAERHFLSGDASNRLYERLIKPNGDHAILMISPPKPDGPP
FT                   IRYGKSYSAIAKLAETIHPFLAMSEALRAHGFSAPEIFAADPVAGLAIIEDLGNDQITQ
FT                   GREIIQERYAWAVTALGAMHAMPLPDTIRQPDGRGGEVPYHLPLYDIDALAIEVELFVE
FT                   WYAPFIAGVQLASGPKASFVNLWRHALQEVAARPSSSANLTWTLRDYHSPNILWLPGRE
FT                   GIAQVGMIDFQDCVLGHPAYDVASLLQDARVTVSDEVELKLLGHYLRFRRERDSSFDIA
FT                   AFARAYALLGAQRATKILGIFTRLDRRDHKPAYLTHLPRVQFYLLKGLAHPALAEIKLW
FT                   FETYLPVIFEPLRQAQKQVHPQNPEPEQAAPDEPGQDLGRSGDPS"
FT   gene            complement(653445..656156)
FT                   /locus_tag="Bind_0588"
FT   CDS_pept        complement(653445..656156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0588"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mex:Mext_4432
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94240"
FT                   /db_xref="GOA:B2IFM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFM9"
FT                   /protein_id="ACB94240.1"
FT                   /translation="MERRKVHKNQPINEPRSPALRLVRGLHDLLACGSCFLFFSLGPVR
FT                   AETSASVFTMMLEQANLLWPVLITGLSLVVILTALASRKEEKRARAREKALLTEIHALQ
FT                   TRIDRAELFVGLDPQLFIAWSAPGEKPEIAGDPGFLTGKNLATGSSPSPDSLLAFKSWM
FT                   SLDDARDLQARIDLLREKGESFHLSLGGNGQHLDIEGRPIGGRAVVRIRDVSAARRDLL
FT                   QLREEQTQILADLAAVRTLLDAVPHPAWQRDGAGHLSWVNLAYVRAIEARDRQDAVVRG
FT                   VELLEHPTRDASDATRATGHIWQARAAAVVAGARRMLDIIEMPVPVAANDMGQIHGRRA
FT                   ALHASNGSQGITNQGTLDQATIGQEAIDPGTIGKGAVGMASDVSELEAMRSVNVQQAEA
FT                   HARTLDQLTTAVAIFDRTKRLVFHNTAYRQLWALDQAWLDQGPTDAEILDRLRMAHLLP
FT                   EQVDFRSWKQDLFSAYQALETREQLWYLPDGRTLRSVITPNPQGGVTYLFDDTTERFHL
FT                   ESRFNAAIRVQSETLDTLQEGVAVFGSDGRLKLFNPAFAALWKLEPEALGGEPHIDKVA
FT                   SLCAPLLVEQTAWDNLRTVVAGLLDERLGLENRLTRQDGSVLDYAAAPLPDGATLITFI
FT                   DMTASVNVERALTERNQALLDAEKLRNDFVHHVSYELRSPLTNIIGFIEMLGEGAVGPL
FT                   NEKQHEYIGYVMASSSALRAIINDILDLASIDADAMDLSLEEVDIAEAMRAAAEGVRDR
FT                   LRESTLTLAVDAAPDIGVFLADGKRIRQILFNLLSNAIGFSTPGQTVTLAASRSHDEVI
FT                   FKVIDEGCGIPDDMVEHVFDRFKTHAGGSNHRGVGLGLSIVRSFVQLHGGRVLIETKLG
FT                   KGTTMTCIFPSRGEASDPKADAQTEQSIGRLH"
FT   sig_peptide     complement(656016..656156)
FT                   /locus_tag="Bind_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.826 at
FT                   residue 47"
FT   gene            complement(656484..657893)
FT                   /locus_tag="Bind_0589"
FT   CDS_pept        complement(656484..657893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0589"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: azc:AZC_4042 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94241"
FT                   /db_xref="GOA:B2IFN0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN0"
FT                   /protein_id="ACB94241.1"
FT                   /translation="MTQSSPADYVIADIGLAEWGRKELAIAETEMPGLMATRAEYGPSQ
FT                   PLKGARIAGSLHMTIQTAVLIETLKALGADIRWASCNIYSTQDHAAAAIAAAGIPVFAI
FT                   KGESLTDYWEYTHKIFEWGDGGTPNLILDDGGDATLLIHLGIRAEAGDTAFLDKATNEE
FT                   EEVLFASIKKRLKEKPGFYTKCGEAIQGVSEETTTGVHRLYLMERDGKLLWPAINVNDS
FT                   VTKSKFDNLYGCRESLVDGIRRGTDVMMAGKVAMIAGFGDVGKGSAASLRNAGCRVLVS
FT                   EVDPICALQAAMEGYEVTTMEDAATRADIFVTCTGNVDVITVDHMRLMKDRAIVCNIGH
FT                   FDSEIQVAGLRNFKWENVKPQVDEIVFPDGKRIILLSEGRLVNLGNATGHPSFVMSASF
FT                   TNQTLAQIELWTKKGHYARKVHTLPKHLDEKVAALHLDKIGVKLTKLTPVQATYLGLPE
FT                   NGPFKPDHYRY"
FT   gene            complement(657967..659211)
FT                   /locus_tag="Bind_0590"
FT   CDS_pept        complement(657967..659211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0590"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mpt:Mpe_A0734 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94242"
FT                   /db_xref="GOA:B2IFN1"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN1"
FT                   /protein_id="ACB94242.1"
FT                   /translation="MDAKLDKAPLQGKTVLLVHPAWHSCGSHQVFVSQADAYRSLGARV
FT                   LDLALAATLGSVEGSPAHEAYAAATSDLQADTRFFAGVPWSRILWPSFRDTGWLWLHGN
FT                   LAAMAVVYTRLTPLPKSLLKEPKIDFIHCNHFFCMPAAAALRQRYGAPIVLDTHDIQAH
FT                   QYLLRNQATWAIPPRTKFEKMLKIEVRELAKADVLIHLNNEEAATFKSYLPSLRHELVY
FT                   PTVPPIAPGNAGEDFIIVASANYPNFLGVSWFLEEILPRVPNIPIKIIGNIDNELRTRA
FT                   PELLNRYESLFTGRVQDLDAAYANAAAVLLPTTEGHGISIKTIEALSSGAPLIATRHAF
FT                   RGMPVDPSHLQNVALASDAESFAALLTQAAHCKPHIDRLNCATRSVYKSYFSFETYRAE
FT                   LDRISHSLIGTGLKT"
FT   gene            complement(659588..660784)
FT                   /locus_tag="Bind_0591"
FT   CDS_pept        complement(659588..660784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0591"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gvi:gll1794 probable glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94243"
FT                   /db_xref="GOA:B2IFN2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN2"
FT                   /protein_id="ACB94243.1"
FT                   /translation="MKRSRTEHIMNMYPPSDHFFDRPLASVGEALQLPLVSVIIVNYNY
FT                   GRYLRQAVASILEQTYERIECIIVDNASTDESGQILDEMEADNSPVTIIRRAHNDGQTP
FT                   ASLDGFKASNGAYVIFLDADDILLPRGVETHIFVHLSMRSHVGFTSGDMLQVEGDQIVV
FT                   TGGNPFNDYIRSGKGIRQNLTRPYHHHADDPSTRNPGLDEIVLHKVHYVRPLAKNWVWS
FT                   PTSGNCFRRDALRLFADNPSLATLRTGTDMYFALGISALCGSVLIDEPVFAYRIHGNNI
FT                   FTRHAQLNRILCYDPGGSGDSNDQAKRFLVDHLVIHAKRFTQNTWLRLNFVLLLARLDQ
FT                   IDPDPSLPRWAARSRLAQRLVEHYSELEPILGFWKLRAMLLYKRVPLSIIFGLGSRQI"
FT   gene            661447..662301
FT                   /locus_tag="Bind_0592"
FT   CDS_pept        661447..662301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr0587 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94244"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN3"
FT                   /protein_id="ACB94244.1"
FT                   /translation="MLQAPTQKNYGIAVIANDKIIDWLLPFLESYLATNATLPLYIIPY
FT                   DDNISLTRKAAEIYGVTVVDPDSVALDALAKRLYPLSPGHRRRLRKFLSLALPLDEVIY
FT                   LDVDIVLFRDMREMFGRLEAGKAEFIVAAQTSENDFVYNKKRADYDFLREALTFNDGFF
FT                   LTSNRLLSLQDFYDIIDRDEKIFHRVRERGGLYAQPVTNFVVHRKGLKVLSFWDWVEGA
FT                   SGESFYKAEGVTFDAEGPRDHCGNKIYFAHWSGMKDAHLMGQRAFDAAWRDFSQKAHAR
FT                   AKF"
FT   gene            662465..663625
FT                   /locus_tag="Bind_0593"
FT   CDS_pept        662465..663625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0593"
FT                   /product="permease-like protein"
FT                   /note="KEGG: mag:amb3714 predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94245"
FT                   /db_xref="GOA:B2IFN4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN4"
FT                   /protein_id="ACB94245.1"
FT                   /translation="MPRLLTLYLTRRIALSVLMIEASLCLPLVMTSLFSALPPAAVRGG
FT                   LIWPALLGTLPTVLYIALPMAVGIAIALEFYRMASEGMIAVLYSLRLSVWSICLPGIVI
FT                   AMVCVFFGYFVASFVAPNYVGQMHDVVHVIRNSLNHRMLEPAHFYTFDNGSKTLYFQRW
FT                   RSSDVVSGMFIHQFSDEKKEEEIITASIAEFRRNENGVMLVLSDGSIESRPEGATAIHT
FT                   AHFDEYVIPIDMQGTGGMPKRNWRGVFEVPALEFFRERPQQADDPRRFSEWTSEATKRF
FT                   AVPFLALSHTILAMGLVLTLANATGRSTKAGLTAFIVVPLAHILILIGAETLVRQDPRL
FT                   VWLVGLAIAAELGVGCYLLYRKNANFLIQRRAATDYQQGAEEYQGA"
FT   sig_peptide     662465..662572
FT                   /locus_tag="Bind_0593"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.437 at
FT                   residue 36"
FT   gene            complement(663770..664552)
FT                   /locus_tag="Bind_0594"
FT   CDS_pept        complement(663770..664552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0594"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pmt:PMT0108 ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94246"
FT                   /db_xref="GOA:B2IFN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN5"
FT                   /protein_id="ACB94246.1"
FT                   /translation="MSSDQVISCDHVGKAFQLYLRRNDQIMQTLFGHWKQYYHEHWVLK
FT                   DISFKVARGESFGIIGRNGAGKTTLLQILCGITTPTHGTATVQGRIAPILALGTGFDHE
FT                   LTGRENALIGSAILGMKRAEALARMDTIAAFADIGEFFNQPLKMYSSGMVARLAFAVCA
FT                   HADADILIVDEALSVGDAAFGAKCDAFIRNFAKHGTILFVSHDLITVEALCDRVLWIDD
FT                   GRVRGLGKPHEVVPHYRATLEGQSTPSVRPAEPTYLSA"
FT   gene            complement(664542..665345)
FT                   /locus_tag="Bind_0595"
FT   CDS_pept        complement(664542..665345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0595"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: bxe:Bxe_A3799
FT                   ABC O-antigen/lipopolysaccharide exporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94247"
FT                   /db_xref="GOA:B2IFN6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN6"
FT                   /protein_id="ACB94247.1"
FT                   /translation="MTLASPLFNAWHFRELIRAVVRRELAARFRGSILGWLWAVFGPLV
FT                   MLSAYTIIFSNAVGVPNSAKGGGLGTYALSIFSGLIVFNLFSELAYRSPGLLHEHVTFI
FT                   KKSIFPSETLAWTATIRALVYAAISTAVLLVFQITLTHQLPWTILFAPLVLIPFTMFLL
FT                   GTCWFLMALGSFTRDVAHLMISIVPVLMFATPIFYSIDDVPPHLRRIVHCNVVGNYVEI
FT                   FRDLVVLGRLPGPYLCLGTLIVSLLVFYFGYRIFMQYKAVFVDVI"
FT   gene            665986..667584
FT                   /locus_tag="Bind_0596"
FT   CDS_pept        665986..667584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0596"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: azc:AZC_3545 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94248"
FT                   /db_xref="GOA:B2IFN7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN7"
FT                   /protein_id="ACB94248.1"
FT                   /translation="MTTNKSSEPAMGSAIQETANTEQIIIFDTTLRDGEQSPGASMNLD
FT                   EKIEVAELLDAMGVDVIEAGFPVTSEGDFEAVSAISRRVKRASVAGLARAAARDIDRCA
FT                   EALRDAVRPRMHVFISTSPLHMKYKLQKEPGEVLDMISTYVGRARNRIDDIEWSAEDGT
FT                   RTEIDFLCRCVEAAIKAGARTINIPDTVGYTIPEEYQALFETVRTRVPNSDQAIFSVHC
FT                   HNDLGLAVANTLAGIKGGARQVECTINGLGERAGNAAMEEVVMALRVRADALAYHSNID
FT                   ARMLTRASKLVSAVSSFPVQYNKAIVGRNAFAHESGIHQDGMLKNAQTYEIMTPESVGV
FT                   HKTSLVMGKHSGRHAFKEKLKELGYELGENALEEAFARFKDLADRKKIVYDEDLIALVD
FT                   DEIIHAHDRIKLVALTVIAGTKGPQSAALTLTIDGVEQTHQATGNGPIDAIFNAVQALV
FT                   PHGAVLELYQVHAVTKGTDAQAEVSVRLSEDGKTVTARGADPDTLVASAKAYIAALNKL
FT                   VVRRHKSRPDDSLAG"
FT   gene            667706..667781
FT                   /locus_tag="Bind_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            667706..667781
FT                   /locus_tag="Bind_R0004"
FT                   /product="tRNA-Lys"
FT   gene            668286..668574
FT                   /pseudo
FT                   /locus_tag="Bind_0597"
FT   gene            669431..669634
FT                   /locus_tag="Bind_0598"
FT   CDS_pept        669431..669634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN8"
FT                   /protein_id="ACB94249.1"
FT                   /translation="MNLNPGEEVTVAKLPSGKWGALLRLNGYDEPFNLGREFKTEEMTE
FT                   GWLDTTEANNLIDQYITKYRKA"
FT   gene            complement(669780..669995)
FT                   /locus_tag="Bind_0599"
FT   CDS_pept        complement(669780..669995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94250"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFN9"
FT                   /protein_id="ACB94250.1"
FT                   /translation="MFIIARNIEGPRLHCEALMVDKKTFSPWPPEAEDGWRRVYKFRDR
FT                   LQAEVVRLELDPLGEQLRVIDAVYIP"
FT   gene            complement(670223..670615)
FT                   /locus_tag="Bind_0600"
FT   CDS_pept        complement(670223..670615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0600"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sus:Acid_1340 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94251"
FT                   /db_xref="GOA:B2IFP0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP0"
FT                   /protein_id="ACB94251.1"
FT                   /translation="MARLIEEKDASEEVRTVYEDIKATRKTDWINNFWKAIAFHPPSLR
FT                   LLWTQVKQVMAPGALDPLTKEMIYVAVSVTNNCRYCISSHTAAARAKGMTDEQWAELLA
FT                   VVALANETNRLAIGYDVPVDEKFLQE"
FT   gene            670972..671478
FT                   /locus_tag="Bind_0601"
FT   CDS_pept        670972..671478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94252"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP1"
FT                   /protein_id="ACB94252.1"
FT                   /translation="MLDDEAWLERRYYGGDLPAAAERALHAVGLNWENEEVSEAYIQEA
FT                   LALAPNHLAVHFGAYKFYYYRRRLKEALPHVEAWVVDALRRNAFPEDWRQVTGAHADFN
FT                   NFDGEPRVFLFSLRAYGWLLARLRRIAEGREALLKVAELDLKDRMGALRLLAIIDQGNR
FT                   EEEED"
FT   gene            complement(671530..671781)
FT                   /locus_tag="Bind_0602"
FT   CDS_pept        complement(671530..671781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll7386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94253"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP2"
FT                   /protein_id="ACB94253.1"
FT                   /translation="MRTKLLLSSLTLMLGIGIGTAFAEEAYTDEEQEACQADAMRLCSD
FT                   AVPDVDRVTACMKQHISSLSPPCAKMFDSERPRPHRHK"
FT   sig_peptide     complement(671710..671781)
FT                   /locus_tag="Bind_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(671892..672338)
FT                   /locus_tag="Bind_0603"
FT   CDS_pept        complement(671892..672338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0603"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gox:GOX1434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94254"
FT                   /db_xref="GOA:B2IFP3"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP3"
FT                   /protein_id="ACB94254.1"
FT                   /translation="MDGCWFDLPPVMIKLEERVFLAAFERLLMPDLEKPLHPSQDKTNT
FT                   IRKDENAEHRERRLELLIDRLPPRLRQVIRGLRQPGRPWRRRTAGVLFICGGFLAILPI
FT                   LGLWMLPLGLLLLAEDIPLLARGCDRALDWIERYRPHWLNDKKP"
FT   gene            672567..678041
FT                   /locus_tag="Bind_0604"
FT   CDS_pept        672567..678041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0604"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein; N/apple
FT                   PAN domain protein; alpha-2-macroglobulin domain protein 2;
FT                   KEGG: sme:SMb21298 conserved hypothetical protein, possibly
FT                   exported"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94255"
FT                   /db_xref="GOA:B2IFP4"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP4"
FT                   /protein_id="ACB94255.1"
FT                   /translation="MSVSAIRVFVAGLLVTLVSLLPAIADAKREAVLTQDVDYFGFDLR
FT                   TEQNVTLDQCQASCLGNKACKAFTYNPKVKWCFLKSDFDRMNQAPGAIAGKIIDSESRE
FT                   ADLGAAPKLDFISNELIRQARDFKANLPRGRAPLGGGAPALIQQARKDLTNGKSDAALE
FT                   SLRLALATAPDKPELWSEVARAGNELGKTTSLASQMALVALNGYAVTRTASMRASALVE
FT                   LAVALEKSENYRAALNAYKASLALVNAKSVEAAYLDLKARRGFRIIDHSIDKDTISPRA
FT                   CVQFSEALVKAGVDYAPFLTLDGKAPKAFEAKDHEICVEGLAHGQHYKLGLRSGLPSSV
FT                   GEVLEAPVSLDIYVRDRSPLVRFTGDNFVLPGSARRGIPIVSVNTDRADLKLYRIGDRG
FT                   LAGLLTNTQFLTQLDRYSAQRIQDESGELVWQGAIDIQQDLNKEVVTSFPVDEALPKRQ
FT                   PGVYVLTAASPHTAKEDSDTQATQWFVVSDLGITTYAGTDALSIFVRSLASAKPMADVD
FT                   LQLLAKNNEILGTAKTDAEGRATFSAGLMRGTGGLAPTIIMARAGGSDFVFLDMTRAGF
FT                   DLSDRGVAGRESPGAIDLLAWTERGIYRVGETVHATALARDDRSVAIANLPLTFVFTRP
FT                   DGVEDRRFVRDGGTAGGYTLDLPLPDNALRGTWTMKVFVDPKRSAIGERTFLVDDFIPD
FT                   RTEFSLTSKVKEIEPSASVPVSVEGRFLYGAPAAGLSLEGDVNVKPTRENALFKDYVFG
FT                   LADEEMGDGKELALEDLPVLDEAGKATFNVTLGDLPSTTQWLSARIVVRMREGNGRAIE
FT                   RALDLPVKAKGPMIGIKPEFSGDLGENTIANFHVIGVSPDGHKRAMHGLTWKLVSVERR
FT                   YQWYREGSAWKYEPVNATKQVAAGMLDIGADGARISVPVVFGRYRLEIETSEAEGPSSS
FT                   VAFDAGWFVEASSTETPDGLEIALDKQSYKVGETATLKILSRYAGEALVAVGAEKLIAV
FT                   KTASLGDKGGEIALPVTADWGAGTYITATLFRPGDARDNRMPMRAIGIKWLRVDPGDRQ
FT                   LLVKLDLPAKMQPRQPLAIDLEVAGAGVREDAYVTVAAVDVGILNLTRYEPPNPDGWYF
FT                   GQRRLGLEIRDLYGRLIDGSLGVTGRLRTGGDGGQMALQGSPPTQKLVAFFSGPVKLDA
FT                   GGKAHVVFDIPQFNGTARVMAVAWSKSGVGHAVGDVIIRDPVVVTASLPRFLAPEDKAE
FT                   LRLDIANTDAPPGDYHIKAEGNAAIGFETSPFSRTIHLAAGEKSSLVIPIHAFQPGNGE
FT                   VSVTVSNGVNDAPQLSLAQTLDVPVRPAILPMTARHVISLIPKSSLTIDRQLLADFQLQ
FT                   GASVSINVSRAAAFDVPALLMALDRYPYGCAEQITSRALPLLYLSELAKQYGLAEEGDV
FT                   HQRVQEGIYKVLSYQGSSGGFGLWAAGSGDLWLDSYISDFLTRAREQKFDVPEEALAQA
FT                   LENLQNSLAYDDNLKDKGNEIAYALYVLARNRRAVLSDLRYYADTKLADFSTPLAKAHL
FT                   AAALAFYGDAERSKATFLDALGLSQQMLVSKVSLARADYGSQLRDAAAVLALASESRPV
FT                   PPIVPALVKIVSQEWEQKPAASTQELTWMLLAARGLQGADKDLALTVNGVPREGGYRAH
FT                   LDGDALLDHPVKLTNETAVPVTATVTTVAAPVRPLPAGGNGFLIDRKYYTLGGKETSVT
FT                   RVKQNERYVVVLHVSETNQWPQRILINDLLPAGFEIDNPSLVDSAQLSNFDWLDEVDAA
FT                   HTEFRNDRFIAAFDHLGNDHDDITLAYIVRAVTPGIYDHPAATVEDMYRPQFSAQTSTG
FT                   RMEVVAGQK"
FT   sig_peptide     672567..672644
FT                   /locus_tag="Bind_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.827 at
FT                   residue 26"
FT   gene            678038..680113
FT                   /locus_tag="Bind_0605"
FT   CDS_pept        678038..680113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bind_0605"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein; KEGG:
FT                   rle:pRL110012 putative penicillin-binding family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bind_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB94256"
FT                   /db_xref="GOA:B2IFP5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2IFP5"
FT                   /protein_id="ACB94256.1"
FT                   /translation="MIGWHKIATRVAAGCVCVGMVLAGLLLADLAFPPPLDEADIASVE
FT                   VLDADGLLLRAFTMKEGRWRLRTRIEDVDPQLIRMVISYEDQRFWHHPGIDPLALGRAL
FT                   MQLVAHGHIVSGGSTLSMQVARLIEPREGRSVPAKLRQIARALQIERRLSKRQILELYL
FT                   TRAPYGGNLEGVRAASLAYFGKEPRHLTLAQTALLVALPQMPEKRRPDLHPAEALAARQ
FT                   RVLERGAVGVDAEDVAQARLVALPDRRLNLPAFAPHLAEAALRKAPEAWQHRTSLRRRI
FT                   QQGLEAVARDAAARIGAKLSLAMVMADVHSGDIVAEVGSADYFDAVRSGWIDMTRVPRS
FT                   PGSALKPFIYGLAFEEGLIAQETLIEDRPADFFGYRPRNFDLSYQGDVSIRQALQLSLN
FT                   VPAMRLLDALGPVRLLVRFRRAGVRLALPAHEAPGLAIGLGGVGITLMDLVQLYAGLVD
FT                   RERLMRLGDRIHGQPERIEGAPLLEPAAAWNVADILSGVLPPVGAAPRRIAYKTGTSYG
FT                   YRDAWSIGFDGRYVLGVWVGRPDNGAVPGLTGYGTAAPILFEAFTRSGVAATPLPPAPV
FT                   GVGRLALTNLPISQRRFASTADGLPSLFVAEPPPQIVYPPEGAHVDLGAEPDGMPLVLK
FT                   LQGGLAPFRWLANGKPLPELSRGRTSQWVPDGDGFSILMVIDAVGRTASVSLYIDR"
FT   sig_peptide     678038..678124
FT                   /locus_tag="Bind_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.858 at
FT                   residue 29"
FT   gene            680554..682033
FT                   /locus_tag="Bind_R0005"
FT   rRNA            680554..682033
FT                   /locus_tag="Bind_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            682219..682295
FT                   /locus_tag="Bind_R0006"
FT                   /note="tRNA-Ile1"
FT   tRNA            682219..682295
FT                   /locus_tag="Bind_R0006"
FT                   /product="tRNA-Ile"
FT   gene            682425..682500
FT                   /locus_tag="Bind_R0007"
FT                   /note="tRNA-Ala1"
FT