(data stored in ACNUC7421 zone)

EMBL: CP001022

ID   CP001022; SV 1; circular; genomic DNA; STD; PRO; 3034136 BP.
XX
AC   CP001022; AADW02000000-AADW02000051;
XX
PR   Project:PRJNA10649;
XX
DT   04-APR-2008 (Rel. 95, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 3)
XX
DE   Exiguobacterium sibiricum 255-15, complete genome.
XX
KW   .
XX
OS   Exiguobacterium sibiricum 255-15
OC   Bacteria; Firmicutes; Bacilli; Bacillales;
OC   Bacillales Family XII. Incertae Sedis; Exiguobacterium.
XX
RN   [1]
RP   1-3034136
RX   DOI; 10.1007/s00792-005-0497-5.
RX   PUBMED; 16489412.
RA   Rodrigues D.F., Goris J., Vishnivetskaya T., Gilichinsky D.,
RA   Thomashow M.F., Tiedje J.M.;
RT   "Characterization of Exiguobacterium isolates from the Siberian permafrost.
RT   Description of Exiguobacterium sibiricum sp. nov";
RL   Extremophiles 10(4):285-294(2006).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-3034136
RX   DOI; 10.1186/1471-2164-9-547.
RX   PUBMED; 19019206.
RA   Rodrigues D.F., Ivanova N., He Z., Huebner M., Zhou J., Tiedje J.M.;
RT   "Architecture of thermal adaptation in an Exiguobacterium sibiricum strain
RT   isolated from 3 million year old permafrost: a genome and transcriptome
RT   approach";
RL   BMC Genomics 9:547-547(2008).
XX
RN   [3]
RP   1-3034136
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   "Complete sequence of chromosome of Exiguobacterium sibiricum 255-15";
RL   Unpublished.
XX
RN   [4]
RP   1-3034136
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (02-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 72b5f783a6a1ea442e45ba40e4265a9c.
DR   BioSample; SAMN00120225.
DR   EnsemblGenomes-Gn; EBG00001154833.
DR   EnsemblGenomes-Gn; EBG00001154834.
DR   EnsemblGenomes-Gn; EBG00001154835.
DR   EnsemblGenomes-Gn; EBG00001154836.
DR   EnsemblGenomes-Gn; EBG00001154837.
DR   EnsemblGenomes-Gn; EBG00001154838.
DR   EnsemblGenomes-Gn; EBG00001154839.
DR   EnsemblGenomes-Gn; EBG00001154840.
DR   EnsemblGenomes-Gn; EBG00001154841.
DR   EnsemblGenomes-Gn; EBG00001154842.
DR   EnsemblGenomes-Gn; EBG00001154843.
DR   EnsemblGenomes-Gn; EBG00001154844.
DR   EnsemblGenomes-Gn; EBG00001154845.
DR   EnsemblGenomes-Gn; EBG00001154846.
DR   EnsemblGenomes-Gn; EBG00001154847.
DR   EnsemblGenomes-Gn; EBG00001154848.
DR   EnsemblGenomes-Gn; EBG00001154849.
DR   EnsemblGenomes-Gn; EBG00001154850.
DR   EnsemblGenomes-Gn; EBG00001154851.
DR   EnsemblGenomes-Gn; EBG00001154852.
DR   EnsemblGenomes-Gn; EBG00001154853.
DR   EnsemblGenomes-Gn; EBG00001154854.
DR   EnsemblGenomes-Gn; EBG00001154855.
DR   EnsemblGenomes-Gn; EBG00001154856.
DR   EnsemblGenomes-Gn; EBG00001154857.
DR   EnsemblGenomes-Gn; EBG00001154858.
DR   EnsemblGenomes-Gn; EBG00001154859.
DR   EnsemblGenomes-Gn; EBG00001154860.
DR   EnsemblGenomes-Gn; EBG00001154861.
DR   EnsemblGenomes-Gn; EBG00001154862.
DR   EnsemblGenomes-Gn; EBG00001154863.
DR   EnsemblGenomes-Gn; EBG00001154864.
DR   EnsemblGenomes-Gn; EBG00001154865.
DR   EnsemblGenomes-Gn; EBG00001154866.
DR   EnsemblGenomes-Gn; EBG00001154867.
DR   EnsemblGenomes-Gn; EBG00001154868.
DR   EnsemblGenomes-Gn; EBG00001154869.
DR   EnsemblGenomes-Gn; EBG00001154870.
DR   EnsemblGenomes-Gn; EBG00001154871.
DR   EnsemblGenomes-Gn; EBG00001154872.
DR   EnsemblGenomes-Gn; EBG00001154873.
DR   EnsemblGenomes-Gn; EBG00001154874.
DR   EnsemblGenomes-Gn; EBG00001154875.
DR   EnsemblGenomes-Gn; EBG00001154876.
DR   EnsemblGenomes-Gn; EBG00001154877.
DR   EnsemblGenomes-Gn; EBG00001154878.
DR   EnsemblGenomes-Gn; EBG00001154879.
DR   EnsemblGenomes-Gn; EBG00001154880.
DR   EnsemblGenomes-Gn; EBG00001154881.
DR   EnsemblGenomes-Gn; EBG00001154882.
DR   EnsemblGenomes-Gn; EBG00001154883.
DR   EnsemblGenomes-Gn; EBG00001154884.
DR   EnsemblGenomes-Gn; EBG00001154885.
DR   EnsemblGenomes-Gn; EBG00001154886.
DR   EnsemblGenomes-Gn; EBG00001154887.
DR   EnsemblGenomes-Gn; EBG00001154888.
DR   EnsemblGenomes-Gn; EBG00001154889.
DR   EnsemblGenomes-Gn; EBG00001154890.
DR   EnsemblGenomes-Gn; EBG00001154891.
DR   EnsemblGenomes-Gn; EBG00001154892.
DR   EnsemblGenomes-Gn; EBG00001154893.
DR   EnsemblGenomes-Gn; EBG00001154894.
DR   EnsemblGenomes-Gn; EBG00001154895.
DR   EnsemblGenomes-Gn; EBG00001154896.
DR   EnsemblGenomes-Gn; EBG00001154897.
DR   EnsemblGenomes-Gn; EBG00001154898.
DR   EnsemblGenomes-Gn; EBG00001154899.
DR   EnsemblGenomes-Gn; EBG00001154900.
DR   EnsemblGenomes-Gn; EBG00001154901.
DR   EnsemblGenomes-Gn; EBG00001154902.
DR   EnsemblGenomes-Gn; EBG00001154903.
DR   EnsemblGenomes-Gn; EBG00001154904.
DR   EnsemblGenomes-Gn; EBG00001154905.
DR   EnsemblGenomes-Gn; EBG00001154906.
DR   EnsemblGenomes-Gn; EBG00001154907.
DR   EnsemblGenomes-Gn; EBG00001154908.
DR   EnsemblGenomes-Gn; EBG00001154909.
DR   EnsemblGenomes-Gn; EBG00001154910.
DR   EnsemblGenomes-Gn; EBG00001154911.
DR   EnsemblGenomes-Gn; EBG00001154912.
DR   EnsemblGenomes-Gn; EBG00001154913.
DR   EnsemblGenomes-Gn; EBG00001154914.
DR   EnsemblGenomes-Gn; EBG00001154915.
DR   EnsemblGenomes-Gn; EBG00001154916.
DR   EnsemblGenomes-Gn; EBG00001154917.
DR   EnsemblGenomes-Gn; EBG00001154918.
DR   EnsemblGenomes-Gn; EBG00001154919.
DR   EnsemblGenomes-Gn; EBG00001154920.
DR   EnsemblGenomes-Gn; EBG00001154921.
DR   EnsemblGenomes-Gn; EBG00001154922.
DR   EnsemblGenomes-Gn; EBG00001154923.
DR   EnsemblGenomes-Gn; EBG00001154924.
DR   EnsemblGenomes-Gn; EBG00001154925.
DR   EnsemblGenomes-Gn; EBG00001154926.
DR   EnsemblGenomes-Gn; EBG00001154927.
DR   EnsemblGenomes-Gn; EBG00001154928.
DR   EnsemblGenomes-Gn; EBG00001154929.
DR   EnsemblGenomes-Gn; EBG00001154930.
DR   EnsemblGenomes-Gn; EBG00001154931.
DR   EnsemblGenomes-Gn; EBG00001154932.
DR   EnsemblGenomes-Gn; EBG00001154933.
DR   EnsemblGenomes-Gn; EBG00001154934.
DR   EnsemblGenomes-Gn; EBG00001154935.
DR   EnsemblGenomes-Gn; EBG00001154936.
DR   EnsemblGenomes-Gn; EBG00001154937.
DR   EnsemblGenomes-Gn; EBG00001154938.
DR   EnsemblGenomes-Gn; EBG00001154939.
DR   EnsemblGenomes-Gn; EBG00001154940.
DR   EnsemblGenomes-Gn; EBG00001154941.
DR   EnsemblGenomes-Gn; EBG00001154942.
DR   EnsemblGenomes-Gn; EBG00001154943.
DR   EnsemblGenomes-Gn; EBG00001154944.
DR   EnsemblGenomes-Gn; EBG00001154945.
DR   EnsemblGenomes-Gn; EBG00001154946.
DR   EnsemblGenomes-Gn; EBG00001154947.
DR   EnsemblGenomes-Gn; EBG00001154948.
DR   EnsemblGenomes-Gn; EBG00001154949.
DR   EnsemblGenomes-Gn; EBG00001154950.
DR   EnsemblGenomes-Gn; EBG00001154951.
DR   EnsemblGenomes-Gn; EBG00001154952.
DR   EnsemblGenomes-Gn; EBG00001154953.
DR   EnsemblGenomes-Gn; EBG00001154954.
DR   EnsemblGenomes-Gn; Exig_R0001.
DR   EnsemblGenomes-Gn; Exig_R0002.
DR   EnsemblGenomes-Gn; Exig_R0003.
DR   EnsemblGenomes-Gn; Exig_R0005.
DR   EnsemblGenomes-Gn; Exig_R0006.
DR   EnsemblGenomes-Gn; Exig_R0007.
DR   EnsemblGenomes-Gn; Exig_R0008.
DR   EnsemblGenomes-Gn; Exig_R0009.
DR   EnsemblGenomes-Gn; Exig_R0010.
DR   EnsemblGenomes-Gn; Exig_R0011.
DR   EnsemblGenomes-Gn; Exig_R0012.
DR   EnsemblGenomes-Gn; Exig_R0013.
DR   EnsemblGenomes-Gn; Exig_R0014.
DR   EnsemblGenomes-Gn; Exig_R0015.
DR   EnsemblGenomes-Gn; Exig_R0016.
DR   EnsemblGenomes-Gn; Exig_R0017.
DR   EnsemblGenomes-Gn; Exig_R0018.
DR   EnsemblGenomes-Gn; Exig_R0019.
DR   EnsemblGenomes-Gn; Exig_R0020.
DR   EnsemblGenomes-Gn; Exig_R0021.
DR   EnsemblGenomes-Gn; Exig_R0022.
DR   EnsemblGenomes-Gn; Exig_R0023.
DR   EnsemblGenomes-Gn; Exig_R0024.
DR   EnsemblGenomes-Gn; Exig_R0025.
DR   EnsemblGenomes-Gn; Exig_R0026.
DR   EnsemblGenomes-Gn; Exig_R0027.
DR   EnsemblGenomes-Gn; Exig_R0028.
DR   EnsemblGenomes-Gn; Exig_R0029.
DR   EnsemblGenomes-Gn; Exig_R0030.
DR   EnsemblGenomes-Gn; Exig_R0031.
DR   EnsemblGenomes-Gn; Exig_R0032.
DR   EnsemblGenomes-Gn; Exig_R0033.
DR   EnsemblGenomes-Gn; Exig_R0034.
DR   EnsemblGenomes-Gn; Exig_R0035.
DR   EnsemblGenomes-Gn; Exig_R0036.
DR   EnsemblGenomes-Gn; Exig_R0037.
DR   EnsemblGenomes-Gn; Exig_R0038.
DR   EnsemblGenomes-Gn; Exig_R0039.
DR   EnsemblGenomes-Gn; Exig_R0040.
DR   EnsemblGenomes-Gn; Exig_R0042.
DR   EnsemblGenomes-Gn; Exig_R0043.
DR   EnsemblGenomes-Gn; Exig_R0044.
DR   EnsemblGenomes-Gn; Exig_R0045.
DR   EnsemblGenomes-Gn; Exig_R0046.
DR   EnsemblGenomes-Gn; Exig_R0047.
DR   EnsemblGenomes-Gn; Exig_R0048.
DR   EnsemblGenomes-Gn; Exig_R0049.
DR   EnsemblGenomes-Gn; Exig_R0050.
DR   EnsemblGenomes-Gn; Exig_R0051.
DR   EnsemblGenomes-Gn; Exig_R0052.
DR   EnsemblGenomes-Gn; Exig_R0053.
DR   EnsemblGenomes-Gn; Exig_R0054.
DR   EnsemblGenomes-Gn; Exig_R0055.
DR   EnsemblGenomes-Gn; Exig_R0056.
DR   EnsemblGenomes-Gn; Exig_R0057.
DR   EnsemblGenomes-Gn; Exig_R0058.
DR   EnsemblGenomes-Gn; Exig_R0059.
DR   EnsemblGenomes-Gn; Exig_R0061.
DR   EnsemblGenomes-Gn; Exig_R0062.
DR   EnsemblGenomes-Gn; Exig_R0063.
DR   EnsemblGenomes-Gn; Exig_R0064.
DR   EnsemblGenomes-Gn; Exig_R0065.
DR   EnsemblGenomes-Gn; Exig_R0066.
DR   EnsemblGenomes-Gn; Exig_R0067.
DR   EnsemblGenomes-Gn; Exig_R0068.
DR   EnsemblGenomes-Gn; Exig_R0069.
DR   EnsemblGenomes-Gn; Exig_R0070.
DR   EnsemblGenomes-Gn; Exig_R0071.
DR   EnsemblGenomes-Gn; Exig_R0072.
DR   EnsemblGenomes-Gn; Exig_R0073.
DR   EnsemblGenomes-Gn; Exig_R0074.
DR   EnsemblGenomes-Gn; Exig_R0075.
DR   EnsemblGenomes-Gn; Exig_R0076.
DR   EnsemblGenomes-Gn; Exig_R0077.
DR   EnsemblGenomes-Gn; Exig_R0078.
DR   EnsemblGenomes-Gn; Exig_R0080.
DR   EnsemblGenomes-Gn; Exig_R0081.
DR   EnsemblGenomes-Gn; Exig_R0085.
DR   EnsemblGenomes-Gn; Exig_R0086.
DR   EnsemblGenomes-Gn; Exig_R0094.
DR   EnsemblGenomes-Gn; Exig_R0098.
DR   EnsemblGenomes-Gn; Exig_R0099.
DR   EnsemblGenomes-Gn; Exig_R0101.
DR   EnsemblGenomes-Gn; Exig_R0102.
DR   EnsemblGenomes-Gn; Exig_R0103.
DR   EnsemblGenomes-Gn; Exig_R0104.
DR   EnsemblGenomes-Gn; Exig_R0105.
DR   EnsemblGenomes-Gn; Exig_R0106.
DR   EnsemblGenomes-Gn; Exig_R0107.
DR   EnsemblGenomes-Gn; Exig_R0108.
DR   EnsemblGenomes-Gn; Exig_R0109.
DR   EnsemblGenomes-Gn; Exig_R0110.
DR   EnsemblGenomes-Gn; Exig_R0111.
DR   EnsemblGenomes-Gn; Exig_R0112.
DR   EnsemblGenomes-Gn; Exig_R0113.
DR   EnsemblGenomes-Gn; Exig_R0114.
DR   EnsemblGenomes-Gn; Exig_R0115.
DR   EnsemblGenomes-Gn; Exig_R0116.
DR   EnsemblGenomes-Tr; EBT00001743807.
DR   EnsemblGenomes-Tr; EBT00001743808.
DR   EnsemblGenomes-Tr; EBT00001743809.
DR   EnsemblGenomes-Tr; EBT00001743810.
DR   EnsemblGenomes-Tr; EBT00001743811.
DR   EnsemblGenomes-Tr; EBT00001743812.
DR   EnsemblGenomes-Tr; EBT00001743813.
DR   EnsemblGenomes-Tr; EBT00001743814.
DR   EnsemblGenomes-Tr; EBT00001743815.
DR   EnsemblGenomes-Tr; EBT00001743816.
DR   EnsemblGenomes-Tr; EBT00001743817.
DR   EnsemblGenomes-Tr; EBT00001743818.
DR   EnsemblGenomes-Tr; EBT00001743819.
DR   EnsemblGenomes-Tr; EBT00001743820.
DR   EnsemblGenomes-Tr; EBT00001743821.
DR   EnsemblGenomes-Tr; EBT00001743822.
DR   EnsemblGenomes-Tr; EBT00001743823.
DR   EnsemblGenomes-Tr; EBT00001743824.
DR   EnsemblGenomes-Tr; EBT00001743825.
DR   EnsemblGenomes-Tr; EBT00001743826.
DR   EnsemblGenomes-Tr; EBT00001743827.
DR   EnsemblGenomes-Tr; EBT00001743828.
DR   EnsemblGenomes-Tr; EBT00001743829.
DR   EnsemblGenomes-Tr; EBT00001743830.
DR   EnsemblGenomes-Tr; EBT00001743831.
DR   EnsemblGenomes-Tr; EBT00001743832.
DR   EnsemblGenomes-Tr; EBT00001743833.
DR   EnsemblGenomes-Tr; EBT00001743834.
DR   EnsemblGenomes-Tr; EBT00001743835.
DR   EnsemblGenomes-Tr; EBT00001743836.
DR   EnsemblGenomes-Tr; EBT00001743837.
DR   EnsemblGenomes-Tr; EBT00001743838.
DR   EnsemblGenomes-Tr; EBT00001743839.
DR   EnsemblGenomes-Tr; EBT00001743840.
DR   EnsemblGenomes-Tr; EBT00001743841.
DR   EnsemblGenomes-Tr; EBT00001743842.
DR   EnsemblGenomes-Tr; EBT00001743843.
DR   EnsemblGenomes-Tr; EBT00001743844.
DR   EnsemblGenomes-Tr; EBT00001743845.
DR   EnsemblGenomes-Tr; EBT00001743846.
DR   EnsemblGenomes-Tr; EBT00001743847.
DR   EnsemblGenomes-Tr; EBT00001743848.
DR   EnsemblGenomes-Tr; EBT00001743849.
DR   EnsemblGenomes-Tr; EBT00001743850.
DR   EnsemblGenomes-Tr; EBT00001743851.
DR   EnsemblGenomes-Tr; EBT00001743852.
DR   EnsemblGenomes-Tr; EBT00001743853.
DR   EnsemblGenomes-Tr; EBT00001743854.
DR   EnsemblGenomes-Tr; EBT00001743855.
DR   EnsemblGenomes-Tr; EBT00001743856.
DR   EnsemblGenomes-Tr; EBT00001743857.
DR   EnsemblGenomes-Tr; EBT00001743858.
DR   EnsemblGenomes-Tr; EBT00001743859.
DR   EnsemblGenomes-Tr; EBT00001743860.
DR   EnsemblGenomes-Tr; EBT00001743861.
DR   EnsemblGenomes-Tr; EBT00001743862.
DR   EnsemblGenomes-Tr; EBT00001743863.
DR   EnsemblGenomes-Tr; EBT00001743864.
DR   EnsemblGenomes-Tr; EBT00001743865.
DR   EnsemblGenomes-Tr; EBT00001743866.
DR   EnsemblGenomes-Tr; EBT00001743867.
DR   EnsemblGenomes-Tr; EBT00001743868.
DR   EnsemblGenomes-Tr; EBT00001743869.
DR   EnsemblGenomes-Tr; EBT00001743870.
DR   EnsemblGenomes-Tr; EBT00001743871.
DR   EnsemblGenomes-Tr; EBT00001743872.
DR   EnsemblGenomes-Tr; EBT00001743873.
DR   EnsemblGenomes-Tr; EBT00001743874.
DR   EnsemblGenomes-Tr; EBT00001743875.
DR   EnsemblGenomes-Tr; EBT00001743876.
DR   EnsemblGenomes-Tr; EBT00001743877.
DR   EnsemblGenomes-Tr; EBT00001743878.
DR   EnsemblGenomes-Tr; EBT00001743879.
DR   EnsemblGenomes-Tr; EBT00001743880.
DR   EnsemblGenomes-Tr; EBT00001743881.
DR   EnsemblGenomes-Tr; EBT00001743882.
DR   EnsemblGenomes-Tr; EBT00001743883.
DR   EnsemblGenomes-Tr; EBT00001743884.
DR   EnsemblGenomes-Tr; EBT00001743885.
DR   EnsemblGenomes-Tr; EBT00001743886.
DR   EnsemblGenomes-Tr; EBT00001743887.
DR   EnsemblGenomes-Tr; EBT00001743888.
DR   EnsemblGenomes-Tr; EBT00001743889.
DR   EnsemblGenomes-Tr; EBT00001743890.
DR   EnsemblGenomes-Tr; EBT00001743891.
DR   EnsemblGenomes-Tr; EBT00001743892.
DR   EnsemblGenomes-Tr; EBT00001743893.
DR   EnsemblGenomes-Tr; EBT00001743894.
DR   EnsemblGenomes-Tr; EBT00001743895.
DR   EnsemblGenomes-Tr; EBT00001743896.
DR   EnsemblGenomes-Tr; EBT00001743897.
DR   EnsemblGenomes-Tr; EBT00001743898.
DR   EnsemblGenomes-Tr; EBT00001743899.
DR   EnsemblGenomes-Tr; EBT00001743900.
DR   EnsemblGenomes-Tr; EBT00001743901.
DR   EnsemblGenomes-Tr; EBT00001743902.
DR   EnsemblGenomes-Tr; EBT00001743903.
DR   EnsemblGenomes-Tr; EBT00001743904.
DR   EnsemblGenomes-Tr; EBT00001743905.
DR   EnsemblGenomes-Tr; EBT00001743906.
DR   EnsemblGenomes-Tr; EBT00001743907.
DR   EnsemblGenomes-Tr; EBT00001743908.
DR   EnsemblGenomes-Tr; EBT00001743909.
DR   EnsemblGenomes-Tr; EBT00001743910.
DR   EnsemblGenomes-Tr; EBT00001743911.
DR   EnsemblGenomes-Tr; EBT00001743912.
DR   EnsemblGenomes-Tr; EBT00001743913.
DR   EnsemblGenomes-Tr; EBT00001743914.
DR   EnsemblGenomes-Tr; EBT00001743915.
DR   EnsemblGenomes-Tr; EBT00001743916.
DR   EnsemblGenomes-Tr; EBT00001743917.
DR   EnsemblGenomes-Tr; EBT00001743918.
DR   EnsemblGenomes-Tr; EBT00001743919.
DR   EnsemblGenomes-Tr; EBT00001743920.
DR   EnsemblGenomes-Tr; EBT00001743921.
DR   EnsemblGenomes-Tr; EBT00001743922.
DR   EnsemblGenomes-Tr; EBT00001743923.
DR   EnsemblGenomes-Tr; EBT00001743924.
DR   EnsemblGenomes-Tr; EBT00001743925.
DR   EnsemblGenomes-Tr; EBT00001743926.
DR   EnsemblGenomes-Tr; EBT00001743927.
DR   EnsemblGenomes-Tr; EBT00001743928.
DR   EnsemblGenomes-Tr; Exig_R0001-1.
DR   EnsemblGenomes-Tr; Exig_R0002-1.
DR   EnsemblGenomes-Tr; Exig_R0003-1.
DR   EnsemblGenomes-Tr; Exig_R0005-1.
DR   EnsemblGenomes-Tr; Exig_R0006-1.
DR   EnsemblGenomes-Tr; Exig_R0007-1.
DR   EnsemblGenomes-Tr; Exig_R0008-1.
DR   EnsemblGenomes-Tr; Exig_R0009-1.
DR   EnsemblGenomes-Tr; Exig_R0010-1.
DR   EnsemblGenomes-Tr; Exig_R0011-1.
DR   EnsemblGenomes-Tr; Exig_R0012-1.
DR   EnsemblGenomes-Tr; Exig_R0013-1.
DR   EnsemblGenomes-Tr; Exig_R0014-1.
DR   EnsemblGenomes-Tr; Exig_R0015-1.
DR   EnsemblGenomes-Tr; Exig_R0016-1.
DR   EnsemblGenomes-Tr; Exig_R0017-1.
DR   EnsemblGenomes-Tr; Exig_R0018-1.
DR   EnsemblGenomes-Tr; Exig_R0019-1.
DR   EnsemblGenomes-Tr; Exig_R0020-1.
DR   EnsemblGenomes-Tr; Exig_R0021-1.
DR   EnsemblGenomes-Tr; Exig_R0022-1.
DR   EnsemblGenomes-Tr; Exig_R0023-1.
DR   EnsemblGenomes-Tr; Exig_R0024-1.
DR   EnsemblGenomes-Tr; Exig_R0025-1.
DR   EnsemblGenomes-Tr; Exig_R0026-1.
DR   EnsemblGenomes-Tr; Exig_R0027-1.
DR   EnsemblGenomes-Tr; Exig_R0028-1.
DR   EnsemblGenomes-Tr; Exig_R0029-1.
DR   EnsemblGenomes-Tr; Exig_R0030-1.
DR   EnsemblGenomes-Tr; Exig_R0031-1.
DR   EnsemblGenomes-Tr; Exig_R0032-1.
DR   EnsemblGenomes-Tr; Exig_R0033-1.
DR   EnsemblGenomes-Tr; Exig_R0034-1.
DR   EnsemblGenomes-Tr; Exig_R0035-1.
DR   EnsemblGenomes-Tr; Exig_R0036-1.
DR   EnsemblGenomes-Tr; Exig_R0037-1.
DR   EnsemblGenomes-Tr; Exig_R0038-1.
DR   EnsemblGenomes-Tr; Exig_R0039-1.
DR   EnsemblGenomes-Tr; Exig_R0040-1.
DR   EnsemblGenomes-Tr; Exig_R0042-1.
DR   EnsemblGenomes-Tr; Exig_R0043-1.
DR   EnsemblGenomes-Tr; Exig_R0044-1.
DR   EnsemblGenomes-Tr; Exig_R0045-1.
DR   EnsemblGenomes-Tr; Exig_R0046-1.
DR   EnsemblGenomes-Tr; Exig_R0047-1.
DR   EnsemblGenomes-Tr; Exig_R0048-1.
DR   EnsemblGenomes-Tr; Exig_R0049-1.
DR   EnsemblGenomes-Tr; Exig_R0050-1.
DR   EnsemblGenomes-Tr; Exig_R0051-1.
DR   EnsemblGenomes-Tr; Exig_R0052-1.
DR   EnsemblGenomes-Tr; Exig_R0053-1.
DR   EnsemblGenomes-Tr; Exig_R0054-1.
DR   EnsemblGenomes-Tr; Exig_R0055-1.
DR   EnsemblGenomes-Tr; Exig_R0056-1.
DR   EnsemblGenomes-Tr; Exig_R0057-1.
DR   EnsemblGenomes-Tr; Exig_R0058-1.
DR   EnsemblGenomes-Tr; Exig_R0059-1.
DR   EnsemblGenomes-Tr; Exig_R0061-1.
DR   EnsemblGenomes-Tr; Exig_R0062-1.
DR   EnsemblGenomes-Tr; Exig_R0063-1.
DR   EnsemblGenomes-Tr; Exig_R0064-1.
DR   EnsemblGenomes-Tr; Exig_R0065-1.
DR   EnsemblGenomes-Tr; Exig_R0066-1.
DR   EnsemblGenomes-Tr; Exig_R0067-1.
DR   EnsemblGenomes-Tr; Exig_R0068-1.
DR   EnsemblGenomes-Tr; Exig_R0069-1.
DR   EnsemblGenomes-Tr; Exig_R0070-1.
DR   EnsemblGenomes-Tr; Exig_R0071-1.
DR   EnsemblGenomes-Tr; Exig_R0072-1.
DR   EnsemblGenomes-Tr; Exig_R0073-1.
DR   EnsemblGenomes-Tr; Exig_R0074-1.
DR   EnsemblGenomes-Tr; Exig_R0075-1.
DR   EnsemblGenomes-Tr; Exig_R0076-1.
DR   EnsemblGenomes-Tr; Exig_R0077-1.
DR   EnsemblGenomes-Tr; Exig_R0078-1.
DR   EnsemblGenomes-Tr; Exig_R0080-1.
DR   EnsemblGenomes-Tr; Exig_R0081-1.
DR   EnsemblGenomes-Tr; Exig_R0085-1.
DR   EnsemblGenomes-Tr; Exig_R0086-1.
DR   EnsemblGenomes-Tr; Exig_R0094-1.
DR   EnsemblGenomes-Tr; Exig_R0098-1.
DR   EnsemblGenomes-Tr; Exig_R0099-1.
DR   EnsemblGenomes-Tr; Exig_R0101-1.
DR   EnsemblGenomes-Tr; Exig_R0102-1.
DR   EnsemblGenomes-Tr; Exig_R0103-1.
DR   EnsemblGenomes-Tr; Exig_R0104-1.
DR   EnsemblGenomes-Tr; Exig_R0105-1.
DR   EnsemblGenomes-Tr; Exig_R0106-1.
DR   EnsemblGenomes-Tr; Exig_R0107-1.
DR   EnsemblGenomes-Tr; Exig_R0108-1.
DR   EnsemblGenomes-Tr; Exig_R0109-1.
DR   EnsemblGenomes-Tr; Exig_R0110-1.
DR   EnsemblGenomes-Tr; Exig_R0111-1.
DR   EnsemblGenomes-Tr; Exig_R0112-1.
DR   EnsemblGenomes-Tr; Exig_R0113-1.
DR   EnsemblGenomes-Tr; Exig_R0114-1.
DR   EnsemblGenomes-Tr; Exig_R0115-1.
DR   EnsemblGenomes-Tr; Exig_R0116-1.
DR   EuropePMC; PMC2615787; 19019206.
DR   EuropePMC; PMC5833320; 29438502.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001022.
DR   SILVA-SSU; CP001022.
DR   StrainInfo; 689778; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662203
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3034136
FT                   /organism="Exiguobacterium sibiricum 255-15"
FT                   /strain="255-15"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:262543"
FT   gene            427..1821
FT                   /locus_tag="Exig_0001"
FT   CDS_pept        427..1821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bld:BLi00001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59489"
FT                   /db_xref="GOA:B1YGB2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGB2"
FT                   /protein_id="ACB59489.1"
FT                   /translation="MKNAAELWHNVLSVIEEEQRTPKASYDMWLKSTEGVTLNGTTLIV
FT                   SAPAAFTVTWLERQYLSLLEDTVEEVTGSRLDIQFIEEGQAKHMLDRQNEEVEVMEVAP
FT                   AKTKAQKTPKSSDELVMSELGQLNEKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPL
FT                   FIYGGVGLGKTHLMHAIGQYVQDQKLGTKIAYVSSEQFTNDFINSIRDNKTVQFRNKYR
FT                   NIDVLLIDDIQFLAGKEQTQEEFFHTFNALHNDQKQIIISSDRPPKEIPTLEDRLRSRF
FT                   EWGLITDITPPDLETRIAILRKKANAEQLDVSNEVMLYIASQIDTNIRELEGALTRVIA
FT                   YANLVGRTIDPNVAAEALHNIMPASEPRKVTIRDIQESVSKHFNLPFDDLKAKKRTKSI
FT                   AFPRQIAMYLSREMTESSLPKIGEEFGGRDHTTVIHAHEKISTLVKSDGETGKVIEQIK
FT                   HELKHS"
FT   gene            2009..3142
FT                   /locus_tag="Exig_0002"
FT   CDS_pept        2009..3142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gka:GK0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59490"
FT                   /db_xref="GOA:B1YGB3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB3"
FT                   /protein_id="ACB59490.1"
FT                   /translation="MHITIQRDTLIQAIQDVAKAVSSRTTIPILTGIKLEAHGDGMTLT
FT                   GSDTEISIERTIYAEENGTSYVTVHRAGSVVLNARFFGDIVKKLPTDEVILEVSPNFMT
FT                   RIQSGTAEFHLNGLDPDEFPRLPQVDGGQQFRLPADLLRSMIRQTSFAVAVQETRPVLT
FT                   GVNFSADKDILTCVSTDSHRLALRRAQFETDNEISFQNVIVPGKSLNELSKLLSDGHVD
FT                   ITITNQQILFKMKHVLFFSRLLDGNYPDTSRLIPEEYRTAVRMNAKELLQAIDRASLLA
FT                   REDRNNVIKFAAEGTTAVEISSHSPEVGKVSEQVSILSLEGEELKISFNSKYMMDALKA
FT                   LDATDIEIQFTGSIRPFILHPVDQDNVLQLILPVRTA"
FT   gene            3283..3504
FT                   /locus_tag="Exig_0003"
FT   CDS_pept        3283..3504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: lsl:LSL_0003
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59491"
FT                   /db_xref="GOA:B1YGB4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB4"
FT                   /protein_id="ACB59491.1"
FT                   /translation="MNQIKISTEYVTLGQFLKLSDIISSGGQAKPFLAEVPILVNGEVD
FT                   QRRGRKLRDGDVIDVEDYGQFIIKNEGN"
FT   gene            3506..4660
FT                   /locus_tag="Exig_0004"
FT   CDS_pept        3506..4660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59492"
FT                   /db_xref="GOA:B1YGB5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGB5"
FT                   /protein_id="ACB59492.1"
FT                   /translation="MRLDSVRLSHYRNYESLELSFSEKTNVLIGENAQGKTNLLEAIYV
FT                   LALAKSHRTTHDKELIQWDAETARVEGRIHKRRGSHSQEIAISSRGKKAKLNHLEQRRL
FT                   SDYVGALNIVLFAPEDLHIVKGSPQIRRRFLDMEIGQVSPVYLHELSQYLKVLKQRNAL
FT                   LKQLSMKGGDETFLDVLTEQMITLAVKIVQRRHHFIAQLEKWARPIHEGISRGQEQLVL
FT                   IYRSDTFSNDLLDVEGMTASYMQKFGKMKTNEIRRGVTLFGPHRDDFEMEVNGRNVQTY
FT                   GSQGQQRTAALSLKLAEIELIHEEVGEYPLLLLDDVLSELDDHRQTHLLDTMQQKVQTI
FT                   LTTTSVDGIAHETIKQAKLFHVKQGAVILEETSYKEIVGEKTDE"
FT   gene            4653..6584
FT                   /locus_tag="Exig_0005"
FT   CDS_pept        4653..6584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bca:BCE_0005 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59493"
FT                   /db_xref="GOA:B1YGB6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB6"
FT                   /protein_id="ACB59493.1"
FT                   /translation="MSNHEDMELEQGYGADQIQVLEGLEAVRKRPGMYIGSTASKGLHH
FT                   LVWEIVDNSIDEALAGYCDTIKVTIEPGNSILVEDNGRGIPVDIQEKMGRPAVEVILTV
FT                   LHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVFVKRNEKLYYQAYHRGVPAADLEI
FT                   IGTSEETGTMIRFFPDDEIFQETLEYDYDLLATRLRELAFLNKGLTIEITDDRADEPIT
FT                   RSFHYEGGIKSYVEHLNRSKEVVHEEPVYVHGNRDGIEVEVALQYNDGFAANIYSFTNN
FT                   IPTHEGGTHETGFKTALTRVINDYAKKFGLMKEADGTLSGEDVREGMTAIVSIKHPNPQ
FT                   FEGQTKTKLGNSDARTATDTLFSSAFEQFMMENPTSARAIVEKGMMASRARMAAKRARE
FT                   LTRRKGVLEVSSLPGKLADCSSRDATISEIYIVEGDSAGGSAKSGRDRHFQAILPIRGK
FT                   ILNVEKARLDKILGNNEIRTIITALGTSIGSEFNIEKARYHKVIIMTDADVDGAHIRTL
FT                   LLTFFYRYMRPLVEHGYVYIAQPPLYGIKQGKNITYVHNERELNEALAALPENARYDIQ
FT                   RYKGLGEMDPEQLWETTMDPSGRQMLRVELQDAIEADEVFDILMGDQVEPRRDFIQSHA
FT                   HYVKNLDI"
FT   gene            6612..9272
FT                   /locus_tag="Exig_0006"
FT   CDS_pept        6612..9272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bce:BC0006 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59494"
FT                   /db_xref="GOA:B1YGB7"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB7"
FT                   /protein_id="ACB59494.1"
FT                   /translation="MSDQQGIIKDINISQEMRTSFMDYAMSVIVARALPDVRDGLKPGH
FT                   RRILYAMNDLGIRADKPHKKSARIVGEVIGKYHPHGDSAVYDTMVRMAQDFSYRYELVD
FT                   GHGNFGSVDGDSAAAMRYTEARMSKIAMEIVRDINKNTVNFKDNYDGSEREPEVLPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHQLGEVIDGVLALSHNPDITISELMQHIPGPDFPTAGE
FT                   ILGRSGIRRAYETGRGSLIVRAKAEIEQTKKDRERIIVTELPYQVNKARLVEKIADLVR
FT                   EKKIEGITDLRDESDRRGMRVVMEIRRDANASVILNNLYKQTSMQTTFGVNMLAIVSGR
FT                   PRTLTLKEMLYHYLEHQKEIVRRRTQFDLEKAEAREHLLAGLRIALDHLDEVIKIIRAN
FT                   RTADAAREQLMERFELSEKQSQAILDMRLQRLTGLEREKIDAEYDEIMALITELKRILE
FT                   SDEVLLELIRTELEEVKERFNDQRRTEIRMDHIEFEDEDLIPEKDIIITLTSSGYIKRL
FT                   TTDSYRAQRRGGRGVQGIGTNDADYVTRLLSCSTHDTILFFTNRGKVYRIRGYEVPEMS
FT                   RTSKGVPIINLIQIERDEKVETMIPVNFKRYLEEQEAAEATENIIDVEVTAEDAPDGLE
FT                   EPEEALDAEEVMQDEQKSLIFMTRKGRVKRSPLSAYARINKNGLIAIRLFEDDELTSVR
FT                   LASTEDEVFTVSNTGKAIRFPITNVRSMGRGARGVKAMNLSADAIVIGMELARDEQDVL
FT                   VITEKGFGKRTPMTEFRTQSRGGKGLIASKVTDRVGQIVALRIVDVDDDIMIMTESGIV
FT                   IRTDSQNISSVGRNAQGVKVIRIEEGDRVATVAKLKKEDAVEEEGIVLEEGETGSEEQP
FT                   VSTSEMNSESEQTEE"
FT   gene            9365..10411
FT                   /locus_tag="Exig_0007"
FT   CDS_pept        9365..10411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0007"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="KEGG: gtn:GTNG_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59495"
FT                   /db_xref="GOA:B1YGB8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB8"
FT                   /protein_id="ACB59495.1"
FT                   /translation="MRVASERLILGDRITESLFLHTDIPIVEAGKKIGADELRRIKRFL
FT                   IKEVDIEKRPEGMSEASMMDQELDDMIEDSIFDSLIETYNQVFTSWEQGLVPNVYDALR
FT                   WVKESMPETMRRDDILPYFLERGTEAYTVRHAIYRGAIAQLLAEAAGKERKMIHDLWVA
FT                   SYFADCGLARIMEWRHTKRYEAMQQEIFHRHPAMAFQALQKENIISDTVKRLIVQHHER
FT                   LDGSGYPLKVKGDKIMDHTRLFIVADVFAAMTSWRPYREAYKVYDAYCHLKARPMQYDS
FT                   KYVMLLGQLLLPIEPGDRVLMSNGKIATVLRKNSIFDRPVIAYEEHNRRIVKDLMEDRQ
FT                   LNIIQLMD"
FT   gene            10779..12333
FT                   /locus_tag="Exig_R0001"
FT   rRNA            10779..12333
FT                   /locus_tag="Exig_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            12515..15409
FT                   /locus_tag="Exig_R0002"
FT   rRNA            12515..15409
FT                   /locus_tag="Exig_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            15465..15579
FT                   /locus_tag="Exig_R0003"
FT   rRNA            15465..15579
FT                   /locus_tag="Exig_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            15734..17200
FT                   /locus_tag="Exig_0008"
FT   CDS_pept        15734..17200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0008"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: gtn:GTNG_0009 inosine-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59496"
FT                   /db_xref="GOA:B1YGB9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGB9"
FT                   /protein_id="ACB59496.1"
FT                   /translation="MWENKFAKEGLTFDDVLLVPRRSSVLPRDVDLSVTLCEGITLNIP
FT                   LISAGMDTVTEAPMAIAMARQGGLGVIHKNMSMEDQAEHVDRVKRSENGVITNPFYLTP
FT                   ERQVYDAEYLMSKYRISGVPIVNNETERKLVGILTNRDLRFVKDYSTVIETVMTTEELV
FT                   TAKVGTSLEEAEQILHKHRIEKLPLVDENGVLKGLITTKDIEKVEQYPHAAKDSFGRLL
FT                   VAAAVGVTKDASVRAKFLVDAGVDALVVDTAHGHSEGVLVKVRELRDEYPNLPIIAGNV
FT                   ATAEATRDLIEAGASVIKVGIGPGSICTTRVVAGVGVPQITAVFDCATEARKHGVSIIA
FT                   DGGIKYSGDIVKALAAGGHAVMLGSLLAGVEESPGEMEIYQGRQFKTYRGMGSEASMKR
FT                   GSQDRYFQEADKKFVPEGIEGRVAYRGKLGDSVYQLVGGIRSGMGYCGSASLEELREET
FT                   QFIRMTGAGLQESHPHDIQITKEASNYTRQ"
FT   gene            complement(17262..18656)
FT                   /locus_tag="Exig_0009"
FT   CDS_pept        complement(17262..18656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0009"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG: bcl:ABC0450
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59497"
FT                   /db_xref="GOA:B1YGC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC0"
FT                   /protein_id="ACB59497.1"
FT                   /translation="MDMLSFELIRDGNRPLYEQLYQQIRQEIIEGRLAYGTKLPSKRKL
FT                   GQFLNLSQTTIELAYQQLVAEGYVESVSRKGYFVLAYEELAYVKTTPLPTSQRSNQQPA
FT                   MRYDFHPSKIDGSSFPFSRWRKHAKDVIDEQHQSLVSLGHPQGDLSLRLEIATYLYHSR
FT                   GVVCSPEQIIIGSGVEQLLPHIVFLLGKTTTYGIEDPGYHATRLILKSHERSAVPIPVD
FT                   QNGLVIPSLVQSPVDVMYVTPAHQFPSGSILSVNRRRQLLNWAAASDRRYIIEDDYDSE
FT                   FRYSGKSIPSLHSMDSERVIYLSTFSKSLMPSLRIGYMVLPRPLLERYQTEFPYYTCSV
FT                   SRFDQTILTRFMKEGDFEKHLNRMRKIYRRKLDVVVHALRDVPFLKLTGESAGLHVVLS
FT                   VSNGMGEQELLRRAKDSSIQVYGLSDYAQLPLSTAYPQIVLGFASLTEQQLMQGLTELV
FT                   TAWQLK"
FT   gene            18784..19674
FT                   /locus_tag="Exig_0010"
FT   CDS_pept        18784..19674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0010"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bcl:ABC0451 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59498"
FT                   /db_xref="GOA:B1YGC1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC1"
FT                   /protein_id="ACB59498.1"
FT                   /translation="MMERQQGSDRVKRGMAEMQKGGVIMDVVNAEQAKIAEAAGAVAVM
FT                   ALERVPSDIRRDGGVARMADPLITEEVLQAVSIPVMAKCRIGHIVEARVLESLGVDFID
FT                   ESEVLTPADEEYHLLKSSFTVPFVCGARDLGEAARRIAEGAAMIRTKGEPGTGNVVEAV
FT                   RHMRKIQAQLHQILHSQPDELMTRAKEWGASYEVLQQIQTTGRLPVVNFAAGGIATPAD
FT                   AALMMHLGAEGVFVGSGIFKSEHPERVAKAIVEAVTYKDDFERIAHLSKGLGTAMKGID
FT                   VTSMPFEERMAPRGW"
FT   gene            19668..20246
FT                   /locus_tag="Exig_0011"
FT   CDS_pept        19668..20246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0011"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG: bha:BH0023
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59499"
FT                   /db_xref="GOA:B1YGC2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGC2"
FT                   /protein_id="ACB59499.1"
FT                   /translation="MVIGILGVQGAVREHQEMLHLLGVKTMIVKSSADLDGIDGLIFPG
FT                   GESTTIRRLIDRYGLLDVLRRQADTLPMFGTCAGMILLASELTEGPSHLGAIPMTVRRN
FT                   AFGRQIDSFETSLNVEGAGQDIEAVFIRAPFVEQVGEGVRVLAAIGIAAVVVETDLHLA
FT                   CSFHPELTSDRRLHDYFIQKIRRRTAVSV"
FT   gene            20341..21588
FT                   /locus_tag="Exig_0012"
FT   CDS_pept        20341..21588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0012"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: gka:GK0010 serine-type
FT                   D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59500"
FT                   /db_xref="GOA:B1YGC3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC3"
FT                   /protein_id="ACB59500.1"
FT                   /translation="MKRLFTLFLSVLILTAGGQPMTGHAETPDIQAESYIMVDAVTGKI
FT                   LLAEQADLALPPASMTKLMTLYLVRQQIEQKKLSWNQTVRPSEKVLKLAKTPGIARLPI
FT                   RKTTYTIRELYDAAFIKSANDAAVLLAEVMAGTEKQFVERMNETAVALGMEDTEYANAS
FT                   GLDAVDATLPGTNLMTAMDISLLIIRYIQDYPDVLDVTKRSFITINGEKVENSNKMLPR
FT                   QPYAYSGMRGMKTGTTDLAGYCFASVATRGNLTLVSVVMRTTSDKARFAETKKLLDYGF
FT                   SFFEPLTYYGKGEQIKGVLPIRGAKQSRYDVVTKTALYVTVLKNQAKPHTPVFQFSKAE
FT                   APLKEGEIIGTVQVEDSGRYLPGFTVPQATVTSAAKVELASFQIRLFRAVSAWSKKISQ
FT                   AIHQPTLVNRKGDSVK"
FT   sig_peptide     20341..20418
FT                   /locus_tag="Exig_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 26"
FT   gene            21872..23149
FT                   /locus_tag="Exig_0013"
FT   CDS_pept        21872..23149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bpu:BPUM_0509 serine--tRNA ligase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59501"
FT                   /db_xref="GOA:B1YGC4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGC4"
FT                   /protein_id="ACB59501.1"
FT                   /translation="MIDIKRLRQDFDAIQEKLAHRGEDLTDMNRFIALDEKRRELIAKT
FT                   EVLKAERNEATKKIAELKRNKENADEAIAAMRQVGDEVKALDEELREVEATLNLLLLGI
FT                   PNIPHDSVPIGSTEDDNVVIREVGDKPAFDFEAVPHWDLMEQLKIVDVERAGKVTGSRF
FT                   VFYRGAGARLERALINFMMDLHQDKNGYTEILPPLMVNRDSMTGTGQLPKFEEDAFKVE
FT                   DTNYFLVPTAEVPVTNMHRDEILSADQLPIGYAAYSQCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEESYEQLELLTGQAEEVLKLLKLPYQVLSMCTADLGFTAAKKYDIEVW
FT                   MPSQGVYREISSCSNFEDFQARRAQIRFRREANAKPEFVHTLNGSALAVGRTVAAILEN
FT                   YQQADGSVVIPEVLRPYMGGLEVIQG"
FT   gene            23287..23377
FT                   /locus_tag="Exig_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            23287..23377
FT                   /locus_tag="Exig_R0005"
FT                   /product="tRNA-Ser"
FT   gene            23413..23503
FT                   /locus_tag="Exig_R0006"
FT                   /note="tRNA-Ser2"
FT   tRNA            23413..23503
FT                   /locus_tag="Exig_R0006"
FT                   /product="tRNA-Ser"
FT   gene            23539..23628
FT                   /locus_tag="Exig_R0007"
FT                   /note="tRNA-Ser3"
FT   tRNA            23539..23628
FT                   /locus_tag="Exig_R0007"
FT                   /product="tRNA-Ser"
FT   gene            23735..24199
FT                   /pseudo
FT                   /locus_tag="Exig_0014"
FT   gene            complement(24238..24915)
FT                   /locus_tag="Exig_0015"
FT   CDS_pept        complement(24238..24915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0015"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: oih:OB0015
FT                   deoxypurine kinase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59502"
FT                   /db_xref="GOA:B1YGC5"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC5"
FT                   /protein_id="ACB59502.1"
FT                   /translation="MNSKLREKYNIPADAVITIGGMVGIGKSTITNGLADSLGFRTSLE
FT                   KVDTNPYLDKFYHDFERWSFHLQIYFLAERFKEQKKIFQYGGGFIQDRSIYEDTGIFAK
FT                   MHFEKGTMSPTDYETYSSLFDAMVMTPFFPHPDLLIYLEGSFEQVLERIRLRGREMEQQ
FT                   TPIEYWEEMYERYTNWINNFTICPVLRLSIDEYDLLNEPESIERILSKIDKQLEVARTA
FT                   KIR"
FT   gene            complement(24912..25541)
FT                   /locus_tag="Exig_0016"
FT   CDS_pept        complement(24912..25541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0016"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: bce:BC0021
FT                   deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59503"
FT                   /db_xref="GOA:B1YGC6"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC6"
FT                   /protein_id="ACB59503.1"
FT                   /translation="MFITVEGPIGVGKTSLANAISHHFSFSMLREIVEENPFLGKFYED
FT                   IEEWSFQTEMFFLCNRFKQLDDIERHYLSKQRSVVADYHIFKNLIFAHRSLKVEHLDKY
FT                   EQIYSILTTDMPKPDAVIYLDASIDTLMKRVALRGREIEENMSRAYLEQLAADYETFVT
FT                   DYQIKHPEVKVIRFNGDELDFVKRPEDLEYVLTKIRNELYEGANHA"
FT   gene            25647..26156
FT                   /locus_tag="Exig_0017"
FT   CDS_pept        25647..26156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0017"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   bwe:BcerKBAB4_0017 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59504"
FT                   /db_xref="GOA:B1YGC7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC7"
FT                   /protein_id="ACB59504.1"
FT                   /translation="MMERHEHYMRLAIEEAKKAKAIGEVPIGCVIVKGDEVIATGYNHR
FT                   ETNHQATAHAELLAIEEACNKLANWRLEGCELYVTLEPCPMCAGAIMLSRIEHVIFGAV
FT                   DPKGGCCGTLMNLVQDERFNHVSQLTGGVLEQECGEMLTSFFRELRAKKKQRKRAMGCN
FT                   GTDETV"
FT   gene            26312..26414
FT                   /gene="ffs"
FT                   /locus_tag="Exig_R0008"
FT   ncRNA           26312..26414
FT                   /gene="ffs"
FT                   /locus_tag="Exig_R0008"
FT                   /note="SRP RNA; RNA component of signal
FT                   recognitionparticle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            26567..28252
FT                   /locus_tag="Exig_0018"
FT   CDS_pept        26567..28252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0018"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0034 DNA polymerase III gamma and tau
FT                   subunits; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59505"
FT                   /db_xref="GOA:B1YGC8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGC8"
FT                   /protein_id="ACB59505.1"
FT                   /translation="MAYQALYRVYRPQRFDEVVGQAHITRTIQNALMEERMSHAYLFSG
FT                   PRGTGKTSLAKIIAKAINCEQAPVNEPCNECPTCRAITEGSSPDVFEIDAASNNGVDEI
FT                   REIRDKVKYPPSEAAYKVYIIDEVHMLSTGAFNALLKTLEEPPAHAIFILATTEPHKIP
FT                   ATIISRCQRFDVKRHEVDQLMERMQYILSDQTIGYTETALRLIARAADGGMRDALSLLD
FT                   QAVAFSNGDLTDDAVLEVTGAVEDEALLAVANALQAHQVDQLLQTLEKMQRAGKDLKRF
FT                   VEDLVFFYRDTLLLKTSPTAVDLLERARPTEAFKTFVETIETEACFHIIEQLHDCQQQM
FT                   RLTNHPRVLVEIAFIQIAEQGRTTGQIMQSLQQEVRELKEQMHQLKVTGVPAAEGTPAQ
FT                   QPAKRKQARPTVRIAKERIRQMLSRAEKAQLLEIQERWDAILKLILKQDGPIYSLVHES
FT                   KPVLCSEDTLLIEFDNGKGWHFEQVMTNERTRFVIEEALFEVCGVKRQILAILDNDWKE
FT                   LKAEFVAKRNSSNIEEKEVAVESEEDRLLSETLGRFGDIVEFED"
FT   gene            28276..28596
FT                   /locus_tag="Exig_0019"
FT   CDS_pept        28276..28596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bwe:BcerKBAB4_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59506"
FT                   /db_xref="GOA:B1YGC9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGC9"
FT                   /protein_id="ACB59506.1"
FT                   /translation="MRGMGNMNNMMKQMQKMQKDMAKAQEELKDLTVTGTAGGEMVSVV
FT                   ADGHKNIIDVIIKEEVVDPDDVEMIQDLVLAATNDALKKVDELVSSKMGKFTQGMNMPG
FT                   MF"
FT   gene            28615..29214
FT                   /locus_tag="Exig_0020"
FT   CDS_pept        28615..29214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0020"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bwe:BcerKBAB4_0020 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59507"
FT                   /db_xref="GOA:B1YGD0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGD0"
FT                   /protein_id="ACB59507.1"
FT                   /translation="MQYPEAISRLIESFTKLPGIGPKTAVRLAFHVLDMEEDDVLMFGK
FT                   ALVSAKRDISYCSICGNITDKDPCYVCSDKHRNRTIVCVVQDSRDVIAMEKMRDYQGLY
FT                   HVLHGAISPMEGIGPEDINVSSLLTRLQADEAITEIILATNPNIEGEATAMYLSRLLKP
FT                   TGIRVTRIAHGLPVGGDLEYADEVTLSRAMEGRREL"
FT   gene            29211..29435
FT                   /locus_tag="Exig_0021"
FT   CDS_pept        29211..29435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59508"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD1"
FT                   /protein_id="ACB59508.1"
FT                   /translation="MNWFRKKIRSEYDERFLRELALAQENYLMKRRLLEISYDDCGDLE
FT                   AQMKLAESVYYFYIREAKKRRVSLPTVRL"
FT   gene            29790..31344
FT                   /locus_tag="Exig_R0009"
FT   rRNA            29790..31344
FT                   /locus_tag="Exig_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            31527..34421
FT                   /locus_tag="Exig_R0010"
FT   rRNA            31527..34421
FT                   /locus_tag="Exig_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            34477..34591
FT                   /locus_tag="Exig_R0011"
FT   rRNA            34477..34591
FT                   /locus_tag="Exig_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            34663..34738
FT                   /locus_tag="Exig_R0012"
FT                   /note="tRNA-Asp1"
FT   tRNA            34663..34738
FT                   /locus_tag="Exig_R0012"
FT                   /product="tRNA-Asp"
FT   gene            34766..34841
FT                   /locus_tag="Exig_R0013"
FT                   /note="tRNA-Phe1"
FT   tRNA            34766..34841
FT                   /locus_tag="Exig_R0013"
FT                   /product="tRNA-Phe"
FT   gene            34850..34925
FT                   /locus_tag="Exig_R0014"
FT                   /note="tRNA-Thr1"
FT   tRNA            34850..34925
FT                   /locus_tag="Exig_R0014"
FT                   /product="tRNA-Thr"
FT   gene            34936..35011
FT                   /locus_tag="Exig_R0015"
FT                   /note="tRNA-His1"
FT   tRNA            34936..35011
FT                   /locus_tag="Exig_R0015"
FT                   /product="tRNA-His"
FT   gene            35036..35111
FT                   /locus_tag="Exig_R0016"
FT                   /note="tRNA-Lys1"
FT   tRNA            35036..35111
FT                   /locus_tag="Exig_R0016"
FT                   /product="tRNA-Lys"
FT   gene            35121..35204
FT                   /locus_tag="Exig_R0017"
FT                   /note="tRNA-Leu1"
FT   tRNA            35121..35204
FT                   /locus_tag="Exig_R0017"
FT                   /product="tRNA-Leu"
FT   gene            35215..35289
FT                   /locus_tag="Exig_R0018"
FT                   /note="tRNA-Gly1"
FT   tRNA            35215..35289
FT                   /locus_tag="Exig_R0018"
FT                   /product="tRNA-Gly"
FT   gene            35325..35407
FT                   /locus_tag="Exig_R0019"
FT                   /note="tRNA-Leu2"
FT   tRNA            35325..35407
FT                   /locus_tag="Exig_R0019"
FT                   /product="tRNA-Leu"
FT   gene            35416..35489
FT                   /locus_tag="Exig_R0020"
FT                   /note="tRNA-Arg1"
FT   tRNA            35416..35489
FT                   /locus_tag="Exig_R0020"
FT                   /product="tRNA-Arg"
FT   gene            35495..35571
FT                   /locus_tag="Exig_R0021"
FT                   /note="tRNA-Pro1"
FT   tRNA            35495..35571
FT                   /locus_tag="Exig_R0021"
FT                   /product="tRNA-Pro"
FT   gene            35706..37260
FT                   /locus_tag="Exig_R0022"
FT   rRNA            35706..37260
FT                   /locus_tag="Exig_R0022"
FT                   /product="16S ribosomal RNA"
FT   gene            37343..37419
FT                   /locus_tag="Exig_R0023"
FT                   /note="tRNA-Ile1"
FT   tRNA            37343..37419
FT                   /locus_tag="Exig_R0023"
FT                   /product="tRNA-Ile"
FT   gene            37438..37510
FT                   /locus_tag="Exig_R0024"
FT                   /note="tRNA-Ala1"
FT   tRNA            37438..37510
FT                   /locus_tag="Exig_R0024"
FT                   /product="tRNA-Ala"
FT   gene            37642..40536
FT                   /locus_tag="Exig_R0025"
FT   rRNA            37642..40536
FT                   /locus_tag="Exig_R0025"
FT                   /product="23S ribosomal RNA"
FT   gene            40592..40706
FT                   /locus_tag="Exig_R0026"
FT   rRNA            40592..40706
FT                   /locus_tag="Exig_R0026"
FT                   /product="5S ribosomal RNA"
FT   gene            40787..42196
FT                   /locus_tag="Exig_0022"
FT   CDS_pept        40787..42196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0022"
FT                   /product="Arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region; KEGG:
FT                   gtn:GTNG_0022 lysine decarboxylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59509"
FT                   /db_xref="GOA:B1YGD2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD2"
FT                   /protein_id="ACB59509.1"
FT                   /translation="MPIIEALCAHVERNATSWHVPGHKNGTLFEGLPSFFEWDKTELRG
FT                   LDDFHYPEEAIYEAKLLLRQVYEARDSHFLINGSTVGNWAMLAAVSQRGDRIYVQRNSH
FT                   KSVFNALEWLGLSPILLGPEIDPSTGISGNVSRETLEEALTTFPGGVAVFLTSPTYYGE
FT                   TARIEELLPFTTASGIPLLIDEAHGAHFGEAFGVRSAFELGATAVVQSAHKTLPALTMG
FT                   AWIHERFTDDERRRLTRALQAFQTSSPSYLLMASLDFAREYREKWTVSNMKSVRTSHEH
FT                   LHQQINQLTDITAFTFDDWSRMILSCEEYSGSQLIEALADQGLDAEFALGPHVVCILPL
FT                   RSIEPFEQDTWINQIQLAIETLKAEGIPDKRYMEQPFMGKIKVSSLACPLDQLEDAEAV
FT                   EQTFEQSVGLVSLETIIPYPPGIPLILRGERITAEHITMIEHYINTSIHLQGGEFLHQG
FT                   KLRVIQEGIRE"
FT   gene            42193..42831
FT                   /locus_tag="Exig_0023"
FT   CDS_pept        42193..42831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0023"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: aoe:Clos_0060 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59510"
FT                   /db_xref="GOA:B1YGD3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGD3"
FT                   /protein_id="ACB59510.1"
FT                   /translation="MTGTFITVEGPDGAGKTTQLQLLADRLTAEGYEIVMTREPGGTRI
FT                   GNEIRSLILNPDFQEMDEMTEILLYAASRAQHVNELIRPALAAGKIVLCDRFIDASIAY
FT                   QGYGLGYTIEQVRSINQQATNHLTPDRTYLFDLTVSESKQRMMDRGALDRIEQRDDAFR
FT                   QRVYDGFMTLAVQEPERIQLVDANQSIESLQTELCKDVLTYLKKRERLS"
FT   gene            42828..43157
FT                   /locus_tag="Exig_0024"
FT   CDS_pept        42828..43157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0024"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   bcl:ABC0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59511"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD4"
FT                   /protein_id="ACB59511.1"
FT                   /translation="MKMVITIVQDKDSLRLAEALVEHDFRATKLATTGGFLKEGNTTFM
FT                   IGVQSERLDDLMRLIKKNCSSREQMVSPISPMGGHADSYIPYPVEVQVGGATVFVLPIE
FT                   GFHQF"
FT   gene            43157..44149
FT                   /locus_tag="Exig_0025"
FT   CDS_pept        43157..44149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0025"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0044 DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59512"
FT                   /db_xref="GOA:B1YGD5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD5"
FT                   /protein_id="ACB59512.1"
FT                   /translation="MQTFHELEQTQSVIATILRNSLQTNRINHAYIFTGDYEPLLLEAA
FT                   QLFAKSLFCERRDQIEPCQTCRSCRRMDSGNLVDYYQIEPDGATIKKEQIQELMHDLSL
FT                   RGLEGDRQIYVVTQSHKMTPQAANSLLKFFEEPGAGKVAILITNQPQLLLPTIRSRGQL
FT                   LSFRPADRLLIGQVLSEKTGRDNELTQLAARVYPKIEDAEQALVEDWFVNARVSVLQLM
FT                   EELANRPADLPLFVQEKWMSQFKNRQDARIGLELVTCFFEDVLHLKLNPSWETITYANS
FT                   RPLLEQMGGKSQTTITRWLQAVLAAVKRIEANVNPQLTVERLMFDLQKG"
FT   gene            44156..44986
FT                   /locus_tag="Exig_0026"
FT   CDS_pept        44156..44986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0026"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: bcy:Bcer98_0027
FT                   PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59513"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD6"
FT                   /protein_id="ACB59513.1"
FT                   /translation="MLEVVGVRFKEAGKIYYFAPGQESLSRGQSVIVETVRGIEYGEVV
FT                   IADKQMDEEDVVLPLKSILRVADDKDAMIVRENKMAAFDAHAVCVEKIREHKLDMKLVD
FT                   VEYTFDRNKVIFYFTAEGRVDFRELVKDLAAVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   VLCCSSFLGEFEPVSIKMAKDQNLSLNPTKISGVCGRLMCCLKYENDTYEEMRRDLPDY
FT                   GKRLTVPEGEGRVVGLNILDQIVQIELKDRSRVLTYSMEELLSVGAVKQKRPKE"
FT   gene            44983..45345
FT                   /locus_tag="Exig_0027"
FT   CDS_pept        44983..45345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0027"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   bwe:BcerKBAB4_0028 protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59514"
FT                   /db_xref="GOA:B1YGD7"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD7"
FT                   /protein_id="ACB59514.1"
FT                   /translation="MTGCMRVERIDKKEIITRVDAIEQQIHLLTEHLSVLKDQLAYMME
FT                   ENQHLYLENHHLREKVERDEQQPITEEAQAEAGTGAGYDNLGRLYQEGFHICNLHYGQV
FT                   RKDGDCLFCLSMLTKH"
FT   gene            45395..46132
FT                   /locus_tag="Exig_0028"
FT   CDS_pept        45395..46132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0028"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: gtn:GTNG_0027
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59515"
FT                   /db_xref="GOA:B1YGD8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD8"
FT                   /protein_id="ACB59515.1"
FT                   /translation="MPELLSDERLDHLLGKEGRIIQSPTVFSYSLDAALLAQFAWVPIQ
FT                   QGKLVDLCAGNGAIPLFLSYRTKGTITGLEIQPRLVDMAERSIQMNEKQDQLQMVEGDV
FT                   KEAGKQLGYGLYDAVTCNPPYFLANESSNRNASEHYTIARHEVLCTLEDCIRSAADLLK
FT                   QGGKTAFVHRPERLLDIVTLMRQYRLEPKRMQLIYPKEGKEANMLLIEGIKDAKPGLKV
FT                   LAPFIVYEQDDTYTLQMRNQFNV"
FT   gene            46125..46403
FT                   /locus_tag="Exig_0029"
FT   CDS_pept        46125..46403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0029"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: ssp:SSP2268 putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59516"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGD9"
FT                   /protein_id="ACB59516.1"
FT                   /translation="MSEHAVYIVRCRDGSLYTGYAIDVEKRLATHNAGQGARYTRARLP
FT                   VVLEYTETFPTKSEALKREYAIKQLTRLKKERLIQGGRSSHESNKQF"
FT   gene            46381..47235
FT                   /locus_tag="Exig_0030"
FT   CDS_pept        46381..47235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0030"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: btl:BALH_0032
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59517"
FT                   /db_xref="GOA:B1YGE0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGE0"
FT                   /protein_id="ACB59517.1"
FT                   /translation="MKATSSFKGQTTGLYIVPTPIGNLEDMTYRAVRILQESDLVAAED
FT                   TRQTMKLFNHFKIETKLVSYHEHNKQVSGARLLADLHAGKQIALVSDAGMPGISDPGSD
FT                   LIREAIAEDIPVIVLPGANAALTALVASGLATERFLYYGFLPRKKKERREALETVRYEK
FT                   GSLIFYEAPHRLKEMLGALRDVLGDRQLTLARELTKRYEEYIRGSVTEALEWAEEEVRG
FT                   EFVVIVEGSTEERPAEEEQKADPLQQIERYIEQGEKPNAALKRVAKERGLDRQELYLRY
FT                   HES"
FT   gene            complement(47273..47569)
FT                   /locus_tag="Exig_0031"
FT   CDS_pept        complement(47273..47569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0031"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: bha:BH0050
FT                   transcriptional pleiotropic regulator of transition state
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59518"
FT                   /db_xref="GOA:B1YGE1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGE1"
FT                   /protein_id="ACB59518.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLQIAEKDALEIYVDNEQIIL
FT                   KKYKPNMTCQVTGEVSEDNFKLADGKLILSPDGAQRVLVELKDFLDRHYAGNE"
FT   gene            47910..49865
FT                   /locus_tag="Exig_0032"
FT   CDS_pept        47910..49865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0032"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: btl:BALH_0034
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59519"
FT                   /db_xref="GOA:B1YGE2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGE2"
FT                   /protein_id="ACB59519.1"
FT                   /translation="MAKTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLQGFDVRY
FT                   LTGTDEHGQKIQEKAKEAGVSEQEFVDGVVEQIKVLWDRLDISYDDYIRTTEPRHKEVV
FT                   ERVFETLLEKGDIYLGEYEGWYSVPDETYYTESQLVDGKSPDSGHPVELVREECYFFRI
FT                   SQYADRLVEYYEANPSFILPESRKHEMINNFIKPGLQDLAVSRTTFDWGVKVPSNPKHV
FT                   VYVWVDALTNYISSLGYGTDDQGNFDKYWPADVHLVGKEIVRFHTIVWPALLMALDLPL
FT                   PKQVFAHGWLLMKDGKMSKSKGNVVDPVPMIDRYGLDALRYYLLREVPFGSDGMFTPEA
FT                   FVERMNFDLANDLGNLLNRTIAMITKYFDGVIPTYAGNVTPFDETLSTLAKETVEKVEA
FT                   AMEHMEFSVALSHIWQLISRANKYIDETQPWVLAKDESKTDELASSMVHLVGALRHVAI
FT                   MLQPFMTRSPKEMFRQLGLEGQPMDWTALEQFAAIEEGTKVGAAEPIFPRRDMKEEVEA
FT                   IVEMMKQASAARVEEETEVEEEDTDARPETTIDVFDQIELRVGEVVTAEKIKKAKKLLK
FT                   LTVDMGKETRQIVSGIAEWYEPEDLVGRKVIVVANLKSVTLRGELSQGMVLAAEKSGKL
FT                   ELATVPSTMANGASVK"
FT   gene            49925..50692
FT                   /locus_tag="Exig_0033"
FT   CDS_pept        49925..50692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0033"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: bcl:ABC0067 deoxyribonuclease,
FT                   TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59520"
FT                   /db_xref="GOA:B1YGN7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGN7"
FT                   /protein_id="ACB59520.1"
FT                   /translation="MLIDTHTHLNSDQFDGDVEETIERARANGVSPMIVVGFDHKTIDR
FT                   AMELVEQYDDLYAVIGWHPVDSIDFDDAAYEKVGRLMDHPKVVALGEIGLDYHWDTSPK
FT                   DVQDAAFRKQIRLAKQKNKPIVIHNREATEDTLRILEEEDAKEVGGILHSYSMSAELLP
FT                   RCLAMNFYISLGGPVTFKNAKMPKRVAQEVPLDRLLVETDCPYLTPTPYRGKRNEPAYV
FT                   RFVAEEIAQLRGMMYADIEQATTENAKRVFRLP"
FT   gene            50689..51978
FT                   /locus_tag="Exig_0034"
FT   CDS_pept        50689..51978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0034"
FT                   /product="3D domain protein"
FT                   /note="PFAM: protein of unknown function DUF348; 3D domain
FT                   protein; G5 domain protein; KEGG: gtn:GTNG_0032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59521"
FT                   /db_xref="GOA:B1YGN8"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGN8"
FT                   /protein_id="ACB59521.1"
FT                   /translation="MIRSITYMTIGCTLLLVASLLYMMMDHPRDVTILVDGRQTKIETV
FT                   ETSVFGVLKEAGISVRSQDVIEPALSADLPKNDLIVIQPAKEITLIMGYGEARTIRTQA
FT                   RRVEDLLKEQGISQMLETDDVYPSKEAVLTSGMTVRYREAFPIELIVEGKAREVYTYQT
FT                   TVRELLSMQGVKLQTEDKVMPGLDTVVAKDMLVTVNTTRRAVLTEQQLLPFEVETVEDD
FT                   TLPAGEQLVTKSGRPGIRTQKYQLTLADGLSKEKKLIANEVTSEPVKQVVKIGTKPVES
FT                   VEAATTPAPTFDQEKATVPLAEEPKAATDLDFSKAKTLMVEATAYTNDPASNGSQLYDG
FT                   RALTATGYDVTDTITYQGLPIIAVDPKVIPLGTKVYVEGVGLAIALDTGGAIKGNKIDV
FT                   LVEGESTAKTFGRKTIQIWVIPNETTEAGT"
FT   gene            52045..52605
FT                   /locus_tag="Exig_0035"
FT   CDS_pept        52045..52605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0035"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="KEGG: oih:OB0049 hypothetical protein; TIGRFAM:
FT                   primase/topoisomerase like protein; PFAM: TOPRIM domain
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59522"
FT                   /db_xref="GOA:B1YGN9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGN9"
FT                   /protein_id="ACB59522.1"
FT                   /translation="MMRKRLKEVIVVEGRDDTTRLQEVFDVDTIETNGSAVNEQTLQRI
FT                   AKALERRGVIVFTDPDFPGDRIRARINERVPGCKQAYLPRADAKDKRGKIGVEHASPEA
FT                   IERALGAVYETEEQHDAEVTREMILAADLIGGAAASKRRKRLGQLLAIGEPNAKQLVKR
FT                   VASIRITKQEWEDALKQIEEEQD"
FT   gene            52602..53480
FT                   /locus_tag="Exig_0036"
FT   CDS_pept        52602..53480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0036"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   gtn:GTNG_0035 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59523"
FT                   /db_xref="GOA:B1YGP0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP0"
FT                   /protein_id="ACB59523.1"
FT                   /translation="MKDIATLHRTKEILAKHGFSFKKSLGQNFLIDLNVLGNIVGAANL
FT                   TPDSGVLEIGPGIGSLTEQSAKQAKKVVALEIDQRLLPILEDSLAPYPHVKVIHGDALE
FT                   LDLETIVDEEFTQQGITDLAVVANLPYYVTTPIIMRILEARTPFRTLIMMIQKEVAERI
FT                   GAQPGTKAYGSLSIAIQYYAEAEVCFTVPKQVFIPAPNVDSAVIRLNIRKEPAVKTLDE
FT                   KLFFEVTRASFAQRRKTILNNLSSHFGKAEKEAVEAALHEAGIDPRRRGETLSLQEFAQ
FT                   LADALLPIKKR"
FT   gene            53565..53804
FT                   /locus_tag="Exig_0037"
FT   CDS_pept        53565..53804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0037"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   sha:SH2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59524"
FT                   /db_xref="GOA:B1YGP1"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP1"
FT                   /protein_id="ACB59524.1"
FT                   /translation="MPKTLNEIRHVFETHVGERLTLKASGGRKKVVTRIGTLVETYPSV
FT                   FVVKLDAERHNVERVSYSYADVLTDSVQIEFANS"
FT   gene            53901..54761
FT                   /locus_tag="Exig_0038"
FT   CDS_pept        53901..54761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0038"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: bsu:BSU00460
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59525"
FT                   /db_xref="GOA:B1YGP2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP2"
FT                   /protein_id="ACB59525.1"
FT                   /translation="MTIIVKAPAKINLVLDATAKRPDGYHDVHMVMTTVDLADRLELTE
FT                   LASGEIRMNAQHAYVPNDERNLAYKAAAVLKERFDIKSGVEIYLEKQIPVAAGLAGGSS
FT                   DAAATLRGLNELWKLNLTLEQLAEIGSEVGSDVPFCVMGGTAIATGRGEKLEKLVSPPP
FT                   CWVVLAKPTIGVSTADVYGALDLETAERPDVGAMIDAVKNQDFTAICESLGNVLESVTL
FT                   PMHPEVEQIKAFMTSCGAEGVLMSGSGPTVFALTEHENRAQRLYNGLRGFCNEVYVVRL
FT                   LGENH"
FT   gene            54831..55670
FT                   /locus_tag="Exig_0039"
FT   CDS_pept        54831..55670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0039"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM:
FT                   phosphoribosyltransferase; purine repressor; KEGG:
FT                   gka:GK0040 purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59526"
FT                   /db_xref="GOA:B1YGP3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP3"
FT                   /protein_id="ACB59526.1"
FT                   /translation="MKIRRSGRLVDMTRYLLDHPHHLVSLTIFAERYSSAKSSISEDLD
FT                   IVSEMLEHEGTGRLVTVPGAAGGVMFIPTWSSEKALPFIDELCERVARPDRLLPGGYLY
FT                   LTDLLGDPRMVKQMGQVFASVFSQKKVDVVMTIATKGIPLAYAVAEQLGVPFVIVRSDS
FT                   RVTEGSTVSINYVSGSSKAIRTMALARRSLPRGANVLLIDDFMKAGGTIRGMMSLLSEF
FT                   EANVAGVGVLIEAEGAEKKMVNEYVSLMKLSDVDVDLGQIQVKRGNVDQYFTDGENT"
FT   gene            55833..56144
FT                   /locus_tag="Exig_0040"
FT   CDS_pept        55833..56144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0040"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bpu:BPUM_0033
FT                   stage V sporulation protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59527"
FT                   /db_xref="GOA:B1YGP4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP4"
FT                   /protein_id="ACB59527.1"
FT                   /translation="MNVTDVKIRRVVAEGRMKALASITLDHEFVVHDLRVIEGNSGLFV
FT                   AMPSKRTQEGIFRDVAHPINALMRKKVEDSVLEAYAIREENGEASELELAALEATDPS"
FT   gene            56312..57661
FT                   /locus_tag="Exig_0041"
FT   CDS_pept        56312..57661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0041"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: bcy:Bcer98_0044
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59528"
FT                   /db_xref="GOA:B1YGP5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP5"
FT                   /protein_id="ACB59528.1"
FT                   /translation="MNHFAVILAAGKGTRMKSKLYKVLHPVAGKPMVQHVVDQLTTLGV
FT                   TRQVVIVGHGAESVKEVLGTSVEYALQSEQLGTGHAVQMAEPVLGQEKGSTLVVCGDTP
FT                   LLTSETLQSLLQHHAETGAKVTVLTAHADDATGYGRIVRGEDGNVSKIVEHKDANAEEL
FT                   LIKEINTGTYVFDNEMLFEALKQVKNDNVQGEYYLPDVIEIAKADGETIAAYAASTFEE
FT                   TIGVNDRVALAQAETSMRKRTNEHWMRQGVTFIDPASTYIGPDVVIGSDTVLYPGTQLL
FT                   GNTTIGSECIIGPNSDIRNSEVADQAVVRQSVVTDSKIGPAAQVGPFAHLRQQAVLGAN
FT                   TRIGNFVEVKKSTFGEGSKSAHLSYVGDATIGTNVNLGCGSITVNYDGTNKFQTVIEDD
FT                   AFIGCNVNLIAPVTVGKNALVAAGSTVTDDVPENGLAIARERQTTKPDYR"
FT   gene            57727..58683
FT                   /locus_tag="Exig_0042"
FT   CDS_pept        57727..58683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0042"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: gka:GK0044 ribose-phosphate pyrophosphokinase;
FT                   TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59529"
FT                   /db_xref="GOA:B1YGP6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP6"
FT                   /protein_id="ACB59529.1"
FT                   /translation="MSTVLEHEIRIFALNSNKPLAEEIAKVIGIPVSESSVKHFSDGEI
FT                   SMNIEESVRGDDIYIIQSTSQPVNENLMELLIMIDALKRASARTINVVIPYYGYARQDR
FT                   KARSREPITAKLVANLLEVAGATRVVTMDLHAAQIQGFFDIPVDQLMGVPLLASYFEKK
FT                   NIDPNELVIVSPDHGGVTRARKLAEQLKAPIAIIDKRRPKPNVAEVMNIVGQVDGKIAI
FT                   IIDDIIDTAGTITLAANALIENGAKQVYACCTHPVLSGPAMERIENSAIEELVVLNTID
FT                   LTQRECASKIKQISVARLLAEAIIRVHEQKSISPLFS"
FT   gene            58791..59348
FT                   /locus_tag="Exig_0043"
FT   CDS_pept        58791..59348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0043"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: bcz:BCZK0046
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59530"
FT                   /db_xref="GOA:B1YGP7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGP7"
FT                   /protein_id="ACB59530.1"
FT                   /translation="MKCIVGLGNPGAKYTNTRHNIGFLAIDALAKEHGIKLTESKFKAV
FT                   FGTGMIKGERVVLVKPLTYMNLSGEAVRPLLDFYKIAVEDVLVIYDDLDLPLEKMRLRS
FT                   KGSAGGHNGVKSLIQHLGTQDIKRLKLGVGRPPAPIQVIDWVLMPFAKSEQTTLQHVLS
FT                   DSVNIATDFIDTPFLALMNRYN"
FT   gene            59403..62918
FT                   /locus_tag="Exig_0044"
FT   CDS_pept        59403..62918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0044"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bcy:Bcer98_0048 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: helicase domain protein; transcription factor CarD;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59531"
FT                   /db_xref="GOA:B1YGP8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP8"
FT                   /protein_id="ACB59531.1"
FT                   /translation="MKQLQNLLLGIPEIKTVRERFRDGVNAQLITGLMNSGKALFIAGI
FT                   YQETKKRFVIVTHNMFQAQKLYDDLIELVPEQDVMLYPVDETLAAELSYGASPELRATR
FT                   IETRHRLLTTDDGILIIPLVGLRRYVPTASDFLDHTKRIKPGDVLSIPDFIQELVDAGY
FT                   ERTATVTTPGEFAVRGSIIDLYPLTVERPYRLDLFDEEVDSIYTFDAETQRSLGVIAEA
FT                   LVPPATEHFATREGLKTAGDKLRRLYDATKERVQSTEVLAALEEGIAYDVEVLEGGDRP
FT                   KQLAKYAPLLYETTLLDDIKDAVLIVDEVARIEEAAEVQDTEEAEWMASLIERGQSVSD
FT                   YTLSVPMLNVFKQRQLLYLSLLPTRRSGVPESAAIHFSIKPIAPFHGQMERLKQEVDRY
FT                   GRADMWMVFLASNRERAERMRQTLSDYGVEASLHTTEDEIRRGHPSILIGGIHGGFEMT
FT                   NARLVVITEEEVFKQPARRRKQTTKLTNAERIKSYQELKTGDYVVHIHHGIGRYHGIKT
FT                   IDVAGNHQDYLHLIYAGEDSLYVPVDQIDLIQKYVGAEGKEPKIYKLGGMEWKKVKAKV
FT                   QKSVEDIADELIKLYAAREAAVGFAFPEDDDSTQAFEASFPYEETVDQLRSIEEIKKDM
FT                   ERPRPMDRLLCGDVGYGKTEVAIRAAFKAVMAGKQVALLVPTTVLAQQHYETMLERFSD
FT                   WPINVSVMSRFRSAAELKATKKGLKEGTIDVVVGTHRVLSKDVQFADVGLLIIDEEQRF
FT                   GVKHKERLKQLKTNVDVLTLTATPIPRTLHMSMIGIRDLSVLETPPENRYPVQTYVMEY
FT                   DGIVMREALERELGRGGQAFFLYNRVEGIERKAEEIRALVPEARVVTAHGRMTETELES
FT                   QLIAFFEGDADVLVSTTIIETGIDIPNVNTLIVNDADQMGLSQLYQLRGRVGRSSRVAY
FT                   SYFTYRPQKRLTEVAESRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGSQQSGFIDSV
FT                   GFDLYSQMLSEAVEERKERMKGRKKVQKFVPDFTFSLDAYIPSHYMADSELKIEFYKRL
FT                   KYVDTPESLESLETEMLERFGEFPTEVARLIQLTRMRIFAERARVERVKQTDPKIEIVL
FT                   SEQTTQTLDVADFVKWTVPIGRGLGMGQEEGKLVLTLNRGKQTVQQMTEQAERLLAEID
FT                   RRIVQ"
FT   gene            62915..64465
FT                   /locus_tag="Exig_0045"
FT   CDS_pept        62915..64465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0045"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: bay:RBAM_000660 YabM"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59532"
FT                   /db_xref="GOA:B1YGP9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGP9"
FT                   /protein_id="ACB59532.1"
FT                   /translation="MSQRRTIAQGAALLAISSYVSKLLSFFYRIPYQNMAGDFGLYVYQ
FT                   TVYPVFAIAAALGIYALPVVVAKLTLHHPEEKREVLWSIFFVLLAMSLTLGTIGWWVAP
FT                   EVAALFGDEQLVQPLRAVTFTFYLLPVIAVLRGMFQADLEMRPTAFSQITENAVRVCLL
FT                   LIVTYYGVQAGANPYQVGANAHMTALGGSIASLALLLRFAKGKIGRPVISGRHLRRVGR
FT                   VLLTSGLAVSIASLALLLMQLIDGLTFVNLLGDSMETKIEKGIFDRGYPLLQFAILFAT
FT                   SISLASVPTLLMEYRKRNDTATKLHLETLLRSGLLIAAAATVGLVGVMRPLNIALYQDD
FT                   NGTAALSWLAATAFTASLSMIIVSCLQSVDAEKYAFVGVVAGLLIKLGLNIYLIPLYGM
FT                   VGAGMATFGGFAVMAAAQLLLLNRKFGRVTAGRPFYVRLLKAVIPMALFLYIIEQLFRL
FT                   SGWENRIGATLEVGLLVLGGAGVFCLFALRMGVLTEREWALLPFGEKLYRMHQHRRII"
FT   gene            64462..65892
FT                   /locus_tag="Exig_0046"
FT   CDS_pept        64462..65892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0046"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; MazG
FT                   nucleotide pyrophosphohydrolase; KEGG: bha:BH0072
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59533"
FT                   /db_xref="GOA:B1YGQ0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ0"
FT                   /protein_id="ACB59533.1"
FT                   /translation="MIHQITVVGLGVGELEQLPYGIYKRLKETKQPIYLRTADHPVVSE
FT                   LMAEGMKFTSFDSVYEKHDQFEGVYREIVATLLEQAEKEPIIYAVPGHPLVAESTVQQL
FT                   LAQTEHLDIIGGQSFLDPMFAAVGVDPIEGFQLLDATAFDIDEAQIRQHLLIGQVYDQL
FT                   VAGDLKVMLMERYPDEHNVTLVTAAGTSRQHVTTVPLHELDHITTLSNLTTVYVPPVTD
FT                   QTVLNRDFTTLKHIIARLRGEGGCPWDQEQTHESLKKHLIEESYELLEAIDLQDDNLMI
FT                   EELGDVLLQVMLHAQIGLDEGYFDVRDVIGSVSDKMIRRHPHVFGDVEVDSAADVVNNW
FT                   QEIKAQEKSDRTYLLDGVTKGAPALLRAEQIQKKVARVGFEWETVAGALDKVQEEIQEL
FT                   KEAPAEEQLGEFGDILFSLALVGKYMELSAEDALQQTNDKFIRRFTRMEQLADRPLTEL
FT                   SLTEQDALWNQSKQEEQS"
FT   gene            65889..66161
FT                   /locus_tag="Exig_0047"
FT   CDS_pept        65889..66161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0047"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   btl:BALH_0054 heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59534"
FT                   /db_xref="GOA:B1YGQ1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ1"
FT                   /protein_id="ACB59534.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRIKINGLVAKASSTVAVGD
FT                   EMTIRFGNKIVTVQIDSIKEHAKKEEASDMYQIIREEKVNSEESM"
FT   gene            66227..66607
FT                   /locus_tag="Exig_0048"
FT   CDS_pept        66227..66607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0048"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   bwe:BcerKBAB4_0055 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59535"
FT                   /db_xref="GOA:B1YGQ2"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ2"
FT                   /protein_id="ACB59535.1"
FT                   /translation="MPAPLESGRDTPPKIKPLNDRKKQLSQNAIENRLRLKRRFLVCMS
FT                   IFLIVLSLMGWSYIEKKQLIAEQKQSFQVANQEQAKAEKETVRLKEEIERLNDKKYVAN
FT                   LARSELLYSKKGETIFYFSPED"
FT   gene            66690..67220
FT                   /locus_tag="Exig_0049"
FT   CDS_pept        66690..67220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0049"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   bcl:ABC0099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59536"
FT                   /db_xref="GOA:B1YGQ3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ3"
FT                   /protein_id="ACB59536.1"
FT                   /translation="MSIEVGSKVQGKVTGITNFGAFVELPTGKTGLVHISEVADSYVKD
FT                   INDVLTVGQEITVKVLSVENDGKIGLSIKKAVDRPEGERPRPPARQFDRGPRPAGQDRG
FT                   PRSFDNKGPRGGSGGGGNRGGFNKGGRGAPAPRKEQTFDTLMTSFLKDSEDRLATLKRQ
FT                   TDSKRGGRGAKRQ"
FT   gene            67374..67450
FT                   /locus_tag="Exig_R0027"
FT                   /note="tRNA-Met1"
FT   tRNA            67374..67450
FT                   /locus_tag="Exig_R0027"
FT                   /product="tRNA-Met"
FT   gene            67460..67531
FT                   /locus_tag="Exig_R0028"
FT                   /note="tRNA-Glu1"
FT   tRNA            67460..67531
FT                   /locus_tag="Exig_R0028"
FT                   /product="tRNA-Glu"
FT   gene            67613..68857
FT                   /locus_tag="Exig_0050"
FT   CDS_pept        67613..68857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0050"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: efa:EF0263 tRNA(Ile)-lysidine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59537"
FT                   /db_xref="GOA:B1YGQ4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGQ4"
FT                   /protein_id="ACB59537.1"
FT                   /translation="MEFEIHLPKEPLLVAVSGGCDSMVLAHLLYEANHDLMIVHVHHGL
FT                   RKESDEEAEAVRAWAEARRVGIRMTRLEWEGQAPSQAACRTRRYAFFQEVMAETGRRHL
FT                   VLAHHRDDQLETLLIQLIRGEAGVDGIPRIRSFATGQIHRPLLPYSKQQLYDYAKARQV
FT                   VWHEDETNAGTKYLRNQMRHRLLPLLAELRPGYEEATVQAAMVRYEQKQEHLKYVTSYV
FT                   KEQMTDRGLPLEAIQKLPTDFRRLVLRALLPDHDFTSEDYNRFLTLLRVDMPSGEVYYG
FT                   NWRIQRTYGYVTCVRCPEKNLLPEALEVGIDLGTYHYGEQTITFSRTTTGIPFSAVQFP
FT                   LTIRSVLPGDRIRLAVGTKKVSRILVDAKVPRASRAEIPVVVDAAGQVLAVIGHRIAIF
FT                   GSFELLAESCLMIEW"
FT   gene            68891..69436
FT                   /locus_tag="Exig_0051"
FT   CDS_pept        68891..69436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0051"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: gka:GK0061 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59538"
FT                   /db_xref="GOA:B1YGQ5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ5"
FT                   /protein_id="ACB59538.1"
FT                   /translation="MTLMNDMEKVLISEEEIQHKVGELAGELTADYGDRFPLLVCVLKG
FT                   AMPFMSDLVKKMDMHLEMDFMDVSTYHGGTTSTGEVKIEKDLNTSVEGRDILIVEDIID
FT                   SGLTLGYLVDLFKYRKAKSVKIVTLLDKPSGRKNDLHADYSGFVIPHEFVVGYGLDYEE
FT                   KYRNLPYVGVLKPAVYGG"
FT   gene            69557..71563
FT                   /locus_tag="Exig_0052"
FT   CDS_pept        69557..71563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0052"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bwe:BcerKBAB4_0060 ATP-dependent
FT                   metalloprotease FtsH; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59539"
FT                   /db_xref="GOA:B1YGQ6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ6"
FT                   /protein_id="ACB59539.1"
FT                   /translation="MNRAVKNTLVFGVIFLALILFLQYLQSPVNKSKEINYTQFVESVE
FT                   KGDVKTATFQYEGQTYNVTGELREKDTTYETVVPAVDTELTDLYTQLRSQNVKMDFKAA
FT                   ETNGGWIALLTTIVPFIIIFILFFFLINQAQGGGGGGRVMNFGKSKARLYDTEKKKITF
FT                   DDVAGADEEKQELVEVVEFLKDPRKFARLGARIPKGVLLVGPPGTGKTLLARAAAGEAG
FT                   VPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHD
FT                   EREQTLNQLLVEMDGFSENEGIIMIAATNRADILDPALLRPGRFDRQITVERPDVVGRE
FT                   AVLKVHARNKPLDTTVDLKAIAQRTPGFSGADLENLLNEAALIAARTDRDKISIVDLEE
FT                   AIDRVIAGPAKKSRIISPKEKKIVAWHEAGHTIIGVTLDDADEVHKVTIVPRGNAGGYV
FT                   IMLPKEDRYFMTKPELEDKITGLLGGRVAEDIVFGEVSTGASNDFQRATGLARKMVMEF
FT                   GMSEKLGPLQFGSGQGGNVFLGRDFQNEQNYSDAIAHEIDMEIQAIINKCYQKAKTILT
FT                   EKRDQLDLIATTLLEVETLDQKQIHHLLETGEYKKHEPAAITEPKAEEKTPESTTPVID
FT                   QPTESPTQRGSVIDEGQNVDTENPDQPRRDDQI"
FT   gene            71776..72537
FT                   /locus_tag="Exig_0053"
FT   CDS_pept        71776..72537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0053"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bce:BC0073 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59540"
FT                   /db_xref="GOA:B1YGQ7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGQ7"
FT                   /protein_id="ACB59540.1"
FT                   /translation="MILVIDVGNTNIVLGVYDEQTLLQHWRIATDRTRTTDEYGMLVKA
FT                   LFRDAELNVEDIEGIVLSSVVPPVVFPLENMCVRYFNRRPFVIGPGIKTGLDLKVDNPR
FT                   EVGADRIVNAVAATVKYDGPLIIVDFGTATTYCYIDAQKRYYGGIISPGVMVSTEALYN
FT                   KAAKLPRIEIAKPQSTIGRNTVHAMQSGTYFGYVAQVDGLVHRMKEEMGEATVIATGGL
FT                   ARLISEESATIKIVDPFLTLDGLRIIYERNK"
FT   gene            72548..73474
FT                   /locus_tag="Exig_0054"
FT   CDS_pept        72548..73474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0054"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: oih:OB0082 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59541"
FT                   /db_xref="GOA:B1YGQ8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ8"
FT                   /protein_id="ACB59541.1"
FT                   /translation="MKREELLAQLKDDYLVRALGFNGEVRAFAIRSTKTVYEAQLRHQT
FT                   TPVVTAALGRTLTIGAMMGTMQKGDTRVTLKVEGDGPIGKIIVDADAKGQVRGYVSHPR
FT                   VEMDTYVNGDGLTKLKVGDAVGRGNISVIKDLGLRDFVGGQSPIQTGEISEDFTYYFAV
FT                   SEQSPSVVGAGVLVYPEDESVIAAGGLIVQLMPGASEETIAALEQRVAALKPISILVGE
FT                   EKTPEEMLSLVLGESFEILDTIPVAFNCTCEREKLATAIVALGPDEIQAMIDEDGGAEA
FT                   VCHFCSEHYQYDVEELQSLREKSLERA"
FT   gene            73487..73798
FT                   /locus_tag="Exig_0055"
FT   CDS_pept        73487..73798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0056 possible peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59542"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGQ9"
FT                   /protein_id="ACB59542.1"
FT                   /translation="MGTVNSKYLWMLIFILLLTNFMTGAYAFMGELPKVDSPKIVQDSI
FT                   GGPLEDVVATVGDEEITRADLYQTMRKGHEKETLDRLIREAVEKQSENGSKPTVKRFD"
FT   sig_peptide     73487..73570
FT                   /locus_tag="Exig_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.954 at
FT                   residue 28"
FT   gene            73878..74825
FT                   /locus_tag="Exig_0056"
FT   CDS_pept        73878..74825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0056"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bpu:BPUM_0057 cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59543"
FT                   /db_xref="GOA:B1YGR0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR0"
FT                   /protein_id="ACB59543.1"
FT                   /translation="MRIANSVLDLVGRTPIVKLNHLTGPEDADVYLKLEYMNPGSSVKD
FT                   RIALAMIESAESAGHLKAGDTIIEPTSGNTGIGLAMVAAAKGYRSILVMPETMSMERRT
FT                   LLRAYGAELILTAGPEGMKGAIARATAEAEEHGYFMPQQFNNESNPVVHEKTTGPEIVE
FT                   AFEGLTLDAFIAGIGTGGTITGAGKVLREAFPGIEIIAVEPTDSPVLSGGKPGPHKLQG
FT                   IGAGFVPSILDTQIYDSVEQVTTEEAFDHARRAAKSNGVLGGISSGAAIAAALKTAKRL
FT                   GKGKTVLAIIPSNGERYLSTPLYQVEEETDSSKL"
FT   gene            74963..76351
FT                   /locus_tag="Exig_0057"
FT   CDS_pept        74963..76351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0057"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I domain
FT                   protein; Chorismate binding-like; KEGG: bca:BCE_0067
FT                   para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59544"
FT                   /db_xref="GOA:B1YGR1"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR1"
FT                   /protein_id="ACB59544.1"
FT                   /translation="MRQTVYESFTWTKEQFYNRYVERTAGQTGHIWLESGRIGSYTMAG
FT                   VRPVGHIRTKNGRTIIQEAGQEKQYTDAPFTLLEEIRARYASARPEGMPPFFGGLAGYV
FT                   SYDAVRYLERLPEQAEDDLATADLSLYWYDEVAVFDHQTERLFIAVTRETEAEATLALA
FT                   AEVSSWRQSSPAPMFAAPEEKTAERGRSFERSAFMQAADRIKQYIEAGDVFQVNLAVRQ
FT                   QEPLRTTPAHIYDVLRTINPSPYMGYFADKELVLVSASPELLVEKIGLSLATRPIAGTR
FT                   PRGQNEEEDLALAKTLLDNEKERAEHVMLVDLERNDLGRVSRYGSVHVDELMVIEKYSH
FT                   VQHIVSNVRGEIAADETGSSVLAAMFPGGTITGAPKIRTMEIIEELEPVRRGIYTGALG
FT                   FISWADDVIFNILIRTLVAKDGMAYIQAGAGIVTDSDSESEYEESLSKAKALWVAKEMA
FT                   EGTT"
FT   gene            76348..76929
FT                   /locus_tag="Exig_0058"
FT   CDS_pept        76348..76929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0058"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   gme:Gmet_2496 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59545"
FT                   /db_xref="GOA:B1YGR2"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR2"
FT                   /protein_id="ACB59545.1"
FT                   /translation="MIVLIDNYDSFTYNVVQYFGELGQDIRVFRNDAITIEEIEQLAPD
FT                   HLVISPGPCTPNEAGISLEAIRYFAGRIPILGICLGHQAIGQVFGGKVVRAKTLMHGKV
FT                   SLLTHDGSGMFSGIEQQTPVTRYHSLVVERESFPDILTMTAEADGEVMALRHKEWPIVG
FT                   VQFHPEAILTRDGKQMLKNFLELTHYVSLA"
FT   gene            76913..77752
FT                   /locus_tag="Exig_0059"
FT   CDS_pept        76913..77752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0059"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: gtn:GTNG_0068
FT                   4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59546"
FT                   /db_xref="GOA:B1YGR3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR3"
FT                   /protein_id="ACB59546.1"
FT                   /translation="MYLWHDGNVKREEEIRISPFDHGYLYGMGVFETFRTYEGHPFLFD
FT                   DHIERLQMSCAAIGIQLPYGREQLLRAVEDLYRVYEEQDLYIRLNVSGGARDIGLSSEP
FT                   YAEPTVLLYAKPIGQRQPAERALETVRLARSTPETSYRLKSHHYMNNLVAKRHLFNQEA
FT                   EGLFLTKEGFICEGLTSNIFWRYGNQWYTPPLETGALNGITRQFIMEQVPVEERLALLP
FT                   QLIEADEILCTNSIQEVIAVSSLDGRTFPGLTGQGYQSIRTLFDQVVQTKWSRRKQG"
FT   gene            77749..78540
FT                   /locus_tag="Exig_0060"
FT   CDS_pept        77749..78540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0060"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: bha:BH0093 dihydropteroate synthase
FT                   (dihydropteroate pyrophosphorylase); TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59547"
FT                   /db_xref="GOA:B1YGR4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR4"
FT                   /protein_id="ACB59547.1"
FT                   /translation="MTKIMGILNVTPDSFSDGGNYVDLEQAVRHAKQLVADGADAIDVG
FT                   GESTRPGAVFVSAAEEIERVVPVIRRLKRELDVLVSIDTYKPDVAEAAVRAGADIINDV
FT                   WGSKWGDCSMVNVAAHYDVPIILMHNRLEPHGPDMLAEVRADLEDSIRLAKQAGVSENQ
FT                   IWLDPGIGFMKTHQENLFLMRHLSITTDFGYPVLLGTSRKSMIGLTLGLPADQRVEGTI
FT                   ATVCYGIQQGCEWMRVHDVKAVKRAAVMMDAMLETELTGGE"
FT   gene            78543..78914
FT                   /locus_tag="Exig_0061"
FT   CDS_pept        78543..78914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0061"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   bsu:BSU00780 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59548"
FT                   /db_xref="GOA:B1YGR5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR5"
FT                   /protein_id="ACB59548.1"
FT                   /translation="MDRIEVTGMRFYGYHGVFAEETKLGQRFNVDLSIGLDLLRAGQTD
FT                   DLRESVNYAELYEVTKQVVEGTPLQLVEALANRIAEQVLALDNRILETTVKVIKPDPPI
FT                   AGHYEHVAVEIHRKRADYL"
FT   gene            78911..79402
FT                   /locus_tag="Exig_0062"
FT   CDS_pept        78911..79402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0062"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: gka:GK0071 7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase
FT                   (2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase); TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59549"
FT                   /db_xref="GOA:B1YGR6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR6"
FT                   /protein_id="ACB59549.1"
FT                   /translation="MNRAYIALGSNIGDKAGHLRAAIEAMRSLATTHALRPSSVYETAP
FT                   VGYVDQDLFYNMVVELDTTEPADRLLQALQRIEQQEGRKRLFKNGPRTLDLDIILYNDE
FT                   TIQADGLTVPHPRMQDRAFVLAPLRELTPSYVVPGLKQTVEELYRALPEAERTDVRRIE
FT                   "
FT   gene            79433..80431
FT                   /locus_tag="Exig_0063"
FT   CDS_pept        79433..80431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0063"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: bcl:ABC0116 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59550"
FT                   /db_xref="GOA:B1YGR7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR7"
FT                   /protein_id="ACB59550.1"
FT                   /translation="MMTGFKIGDVELNNRVILAPMAGVCNPAFRLIAKEFGAGLVCAEM
FT                   VSDKGILYENERTMQMLYVDDREKPLSLQIYGGSKETLVQAAQYVDANTNADIIDINMG
FT                   CPVPKVTKCDAGAKWLLDPDKVYEMVHAVSQAVDKPVTVKMRTGWDSHHIYCVDNVRAA
FT                   EAGGAKAVAIHGRTRSQKYEGVADWNIIGEAKRAVTIPIIGNGDVQTPQDAKRMIDEIG
FT                   VDGVMIGRAALGNPWMLYQTIQYLESGTLSVEPTPREKIDICLLHAERLVALKGEDLAV
FT                   REMRTHVAWYLKGLSGNGHVRKALFDTNTHTGLQKLLHEYVETLEMNAVHA"
FT   gene            80586..82079
FT                   /locus_tag="Exig_0064"
FT   CDS_pept        80586..82079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0064"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bpu:BPUM_0066
FT                   lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59551"
FT                   /db_xref="GOA:B1YGR8"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR8"
FT                   /protein_id="ACB59551.1"
FT                   /translation="MSQDMEMNDQMQVRLGKMNAMREQGLDPFGARFERTTDTTSIRAA
FT                   YGEHEKEELAELKPDVSIAGRVMTTRRKGKVGFTNVQDVNGQIQLYVRKDDVGEEAYEI
FT                   YKTCDLGDIVGISGYVFKTNVGELSVHVTSFTLLTKALRPLPDKYHGLKDVEQRYRQRY
FT                   LDLITNTESRETFIARSKVIRGIRQYLDSLGYLEVETPMLHTIAGGASARPFITHHNAL
FT                   DMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYND
FT                   IMNLTENLIAHVAQEVLGTTQVTYGEDVIDLSVGWKRAHMADLVKEATGVDFFEEISKE
FT                   RAHELAHEHGVEVQAHMTTGHILNEFFEQKIEESLVQPTFVYGHPVEISPLAKKNPEDP
FT                   RFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLVEKEAGNDEAHEMDNDFIEALEY
FT                   GMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPTMRHQQN"
FT   gene            82485..84039
FT                   /locus_tag="Exig_R0029"
FT   rRNA            82485..84039
FT                   /locus_tag="Exig_R0029"
FT                   /product="16S ribosomal RNA"
FT   gene            84222..87116
FT                   /locus_tag="Exig_R0030"
FT   rRNA            84222..87116
FT                   /locus_tag="Exig_R0030"
FT                   /product="23S ribosomal RNA"
FT   gene            87218..87332
FT                   /locus_tag="Exig_R0031"
FT   rRNA            87218..87332
FT                   /locus_tag="Exig_R0031"
FT                   /product="5S ribosomal RNA"
FT   gene            87341..87416
FT                   /locus_tag="Exig_R0032"
FT                   /note="tRNA-Val1"
FT   tRNA            87341..87416
FT                   /locus_tag="Exig_R0032"
FT                   /product="tRNA-Val"
FT   gene            87433..87508
FT                   /locus_tag="Exig_R0033"
FT                   /note="tRNA-Thr2"
FT   tRNA            87433..87508
FT                   /locus_tag="Exig_R0033"
FT                   /product="tRNA-Thr"
FT   gene            87570..87656
FT                   /locus_tag="Exig_R0034"
FT                   /note="tRNA-Leu3"
FT   tRNA            87570..87656
FT                   /locus_tag="Exig_R0034"
FT                   /product="tRNA-Leu"
FT   gene            87687..87760
FT                   /locus_tag="Exig_R0035"
FT                   /note="tRNA-Arg2"
FT   tRNA            87687..87760
FT                   /locus_tag="Exig_R0035"
FT                   /product="tRNA-Arg"
FT   gene            87766..87842
FT                   /locus_tag="Exig_R0036"
FT                   /note="tRNA-Pro2"
FT   tRNA            87766..87842
FT                   /locus_tag="Exig_R0036"
FT                   /product="tRNA-Pro"
FT   gene            87864..87939
FT                   /locus_tag="Exig_R0037"
FT                   /note="tRNA-Ala2"
FT   tRNA            87864..87939
FT                   /locus_tag="Exig_R0037"
FT                   /product="tRNA-Ala"
FT   gene            88069..89623
FT                   /locus_tag="Exig_R0038"
FT   rRNA            88069..89623
FT                   /locus_tag="Exig_R0038"
FT                   /product="16S ribosomal RNA"
FT   gene            89806..92700
FT                   /locus_tag="Exig_R0039"
FT   rRNA            89806..92700
FT                   /locus_tag="Exig_R0039"
FT                   /product="23S ribosomal RNA"
FT   gene            92756..92870
FT                   /locus_tag="Exig_R0040"
FT   rRNA            92756..92870
FT                   /locus_tag="Exig_R0040"
FT                   /product="5S ribosomal RNA"
FT   gene            93004..93459
FT                   /locus_tag="Exig_0065"
FT   CDS_pept        93004..93459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0065"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: bcy:Bcer98_0073 transcriptional
FT                   repressor, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59552"
FT                   /db_xref="GOA:B1YGR9"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGR9"
FT                   /protein_id="ACB59552.1"
FT                   /translation="MQNITDIIEAYLKQILHDEKKIEIKRQEIAERFDCVPSQINYVIN
FT                   TRFTIEKGYFVESKRGGGGYIRIQKIVILDSHDLLDEISRWVGNDLTEQAAEDYLVRLI
FT                   NEQLLTRREAILIQSLLQKESLPMALEDQRRMRAHLMQTVLQTIKRL"
FT   gene            93476..93904
FT                   /locus_tag="Exig_0066"
FT   CDS_pept        93476..93904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2350 UvrB/UvrC motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59553"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS0"
FT                   /protein_id="ACB59553.1"
FT                   /translation="MRCQRCGEREAVVRVKLPQDQEGTEQILCSVCVKELAKAYQETAC
FT                   PSCGMTRQQLLHLRKVGCATCYSFFKEEVDGMIRQFQHGHTKHYGSRPEEESVEKRLVQ
FT                   QLSRLREQLNRKILSEDYEEAEIIKQQIVNVEEDLRHV"
FT   gene            93897..94970
FT                   /locus_tag="Exig_0067"
FT   CDS_pept        93897..94970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0067"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   bsu:BSU00850 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59554"
FT                   /db_xref="GOA:B1YGS1"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS1"
FT                   /protein_id="ACB59554.1"
FT                   /translation="MFEELLTQPLSQKMDQQAPYDDIVVSTRIRLARNVAHYPFSTRMT
FT                   EDQANALINETERQLSGLKGFQFGRVDQVDALTRTALVEKHLISPALATHPRTGLFISE
FT                   DEQISVMVNEEDHFRIQTLLPGLQLEEAFRVAKQVDRLISERFKIAFDDTLGYLTTCPS
FT                   NVGTGLRASVMLHLPGLVLTNQIQGYIKHLRQLGFAIRGRYGEGSDASGRMFQLSNQRT
FT                   LGASEDMLITDYQFAVEALIEAEQAARKGLLETYQEELEDRLYRSSGILRSARLITARE
FT                   ATERLSDVRLADSLGLEVELPPNLFHHLLVSLQTGFLQKHFGKQLTSRERDIERATIIR
FT                   QMLTEQTNRDHTQGGFA"
FT   gene            94970..97417
FT                   /locus_tag="Exig_0068"
FT   CDS_pept        94970..97417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0068"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0103 class III stress
FT                   response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59555"
FT                   /db_xref="GOA:B1YGS2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS2"
FT                   /protein_id="ACB59555.1"
FT                   /translation="MMFGRFTERAQRVLALAQEEAVRLGHHNIGTEHILLGLVREGDGI
FT                   AAKALTALGLSSDKIQMEVEALIGRGQDGATTIHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHLLLGLIREGEGVAARVLNNLGISLSKARQQVLQLLGNSETTANASQAGSGVATPTL
FT                   DGLARDLTQQARETRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAVVEGLA
FT                   QQIINNEVPETLRNKRVMVLDMGTLVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDEL
FT                   HTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVA
FT                   EPTTDEATQILFGLRDRYEAHHRVTITDEAIQEAVTLSDRYISDRFLPDKAIDLIDEAA
FT                   SKVRLRSYTAPPNLKEVEAKLEGIRKDKDEAVQSQEFEKAASLRDTEQKLRDELERLKE
FT                   EWQNKQGNEKLEVTKDDIAQVVANWTGVPVTKIAEEETDRLLRLEEILHGRVIGQNEAV
FT                   KSISKAIRRARAGLKDPKRPIGSFIFLGPTGVGKTELARAVAEAMFGDEDAIIRIDMSE
FT                   YMEKHATSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVILLDEIEKAHPEVFNILLQVLD
FT                   DGRLTDSKGRTVDFRNTIIVMTSNVGASALKRNKYVGFAVSDDTDREYKDMKGKVMEEL
FT                   KRAFRPEFLNRIDETIVFHSLEKKHIEEIVKLMAKTLEKRLAEQQVHFELTPAALSKIA
FT                   DIGYDPEYGARPIRRALQREAEDRLSEALLAGDIQKGERVALDVEDGEFIVRRHQAEPA
FT                   TTE"
FT   gene            97488..98873
FT                   /locus_tag="Exig_0069"
FT   CDS_pept        97488..98873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0069"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: bsu:BSU00870 DNA repair protein RadA; TIGRFAM:
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59556"
FT                   /db_xref="GOA:B1YGS3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS3"
FT                   /protein_id="ACB59556.1"
FT                   /translation="MNRLAKIKTKFVCQSCGTESPKWMGRCSGCGEWNTMVEEVVEEKK
FT                   ARRGSAFVHTTTKQLKPERLSNILSQEESRVFTGSGEFDRVLGGGIVPGSMVLVGGDPG
FT                   IGKSTILLQTSARLAARGEKVLYISGEESLKQTKLRAERLGLPTQDLFVLSETDMNMIE
FT                   RVVDEENPAFLIIDSIQTVYIDEIQSAPGSVTQVRECTAMLMKIAKSRGIAIFIVGHVT
FT                   KQGSIAGPRLLEHMVDAVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMRESGLEEVL
FT                   NPSEIFLEERTSGVSGSTIVASMEGTRTVLVELQALISPTSFGNPRRMATGIDQNKVAL
FT                   LMAVLEKRSGLLLQTQDAYLKAAGGVKLDEPAIDLAICVAVASSFRDKPTRPTDVVIGE
FT                   VGLTGEVRRVSRIEQRVAEAAKLGFTRAIIPKNNLGGWTYPPGITVIGVESVDEALRET
FT                   IPF"
FT   gene            99005..100093
FT                   /locus_tag="Exig_0070"
FT   CDS_pept        99005..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0070"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: oih:OB0095 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59557"
FT                   /db_xref="GOA:B1YGS4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS4"
FT                   /protein_id="ACB59557.1"
FT                   /translation="MKIVIRIFFALLGLALGILLLPQLFQLIEAATKMAFPEWLMTTYV
FT                   TGTIGALIFLLIGLFITDSVIRLLRFLEEKLVKAPVADLFFGTFGLLVGLVMAFLVSML
FT                   IELVGIPLLSNVLTVIVAVLFGYLGFTVGYRKRHELTKVFLRNSNNQSEKKAAEPVVVA
FT                   KSNSKVLDTSVIIDGRITDIAKTGFVEGKLIVPQFVIGELQYIADSSDTLKRNRGRRGL
FT                   DVLKELQSIPGMEVEIYDGDFEDVPEVDIKLIKLAELMKGIVVTNDYNLNKVCEVRNVP
FT                   VLNINDLANAVKQVVIPGEEMTVLVIKEGKEQKQGIAYLEDGTMVVVEEGKHLISKTVG
FT                   VVVTSVLQTSAGRMIFAKPQEK"
FT   sig_peptide     99005..99097
FT                   /locus_tag="Exig_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.472 at
FT                   residue 31"
FT   gene            100152..100835
FT                   /locus_tag="Exig_0071"
FT   CDS_pept        100152..100835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0071"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   bha:BH0107 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59558"
FT                   /db_xref="GOA:B1YGS5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS5"
FT                   /protein_id="ACB59558.1"
FT                   /translation="MKEHTYRIVIPAAGAGKRMGADRNKLMLTLRNRSIIEWTLDVFEQ
FT                   DPACLEIILAINPAEQSWFEGITTPYKTPIRLVPGGRERQESVQRGLEALTEPGIVLIH
FT                   DGARPFVTIASIQQVVEAAERTGAAILGVPIKDTVKRIDGDTIVETVPREQLMAAQTPQ
FT                   AFKLETIRSIHAKAATEFLGTDDASLIEWDGGTVTWVTGQYENIKVTTPDDLLFGEAIL
FT                   TKRGK"
FT   gene            100835..101320
FT                   /locus_tag="Exig_0072"
FT   CDS_pept        100835..101320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0072"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: bwe:BcerKBAB4_0081 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59559"
FT                   /db_xref="GOA:B1YGS6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS6"
FT                   /protein_id="ACB59559.1"
FT                   /translation="MMIRIGQGFDVHAFAEDRKLILGGIEIPHTKGLLGHSDADVLLHT
FT                   IADAALGAIAAGDIGKHFPDTDPEFKDADSAKLLQHVYALVKAQGYELGNLDATVIAQA
FT                   PKLRPYIDTMRARIAELLEADIEQINVKATTTEWLGFTGREEGIACQAVILLKRIEE"
FT   gene            101366..102811
FT                   /locus_tag="Exig_0073"
FT   CDS_pept        101366..102811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0073"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: bca:BCE_0087
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59560"
FT                   /db_xref="GOA:B1YGS7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGS7"
FT                   /protein_id="ACB59560.1"
FT                   /translation="MAEVRVRYAPSPTGHLHIGNARTALFNYLFARHAGGKMILRIEDT
FT                   DQKRNIDGGVESQMKYLEWLGIDWDEGPGRGGEYGPYFQMERLDLYKKYTDELLEKGLA
FT                   YRCYMTSEELEAEREAQIARGEAPRYSGAHRNLTQEQEEAFVAEGRTPSIRIRVPESVT
FT                   YTWNDIVKEDVSFESKDFGDWVIVKKDGIPTYNFAVVVDDHLMAISHVLRGDDHISNTP
FT                   KQMMIYDAFGWEYPTFGHMTLIVNEEHKKLSKRDQSIIQYIEQYKDLGYLPEALLNFVT
FT                   LLGWSPVGEQEIFTKEEFIEIFDASRLSKSPAVFDQQKLAWINGQYMKHQSFEEVFEAS
FT                   LPFLQDAGRVSSEPTEEELVWAQNLVGLYREQMTHGAEIVELSEMFFEDELVYDEEANT
FT                   VLAGETVPAVLSEFASQLRTLEEWTPEAIKGAIKATQKATGQKGKNLFMPIRVATTGQT
FT                   HGPELPNTIQLLGKDRVLARLDA"
FT   gene            103075..103758
FT                   /locus_tag="Exig_0074"
FT   CDS_pept        103075..103758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0074"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   gka:GK0084 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59561"
FT                   /db_xref="GOA:B1YGS8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGS8"
FT                   /protein_id="ACB59561.1"
FT                   /translation="MTRMREDIRNVFKQDPAARSTIEVVLTYPGLHAVWMHRLAHRMWK
FT                   MNLHLAARMLSQFSRFLTGIEIHPGATIGRRFFIDHGMGVVIGETAIIGDDVTLFQGVT
FT                   LGGTGKETGKRHPTLGNGVLVSAGARVLGDITIGDSSKIGASSVVLKDVPSNATVVGIP
FT                   GRVVIQDGIKVDAPLDHQLPDPVRECQERVELELEQLKYEIERIKGGHRHDTTLQQHDR
FT                   KKGTV"
FT   gene            103712..105109
FT                   /locus_tag="Exig_0075"
FT   CDS_pept        103712..105109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0075"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: bcl:ABC0129 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59562"
FT                   /db_xref="GOA:B1YGS9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGS9"
FT                   /protein_id="ACB59562.1"
FT                   /translation="MIQLYNSMTGKKEPFKPLEEGKVKMYVCGPTVYNYIHIGNARPAI
FT                   VFDTVRRYFTYRGYDVKYVSNFTDVDDKIIRTANELGEDYHALTKRFIEAYHADTGALN
FT                   VQKADIHPLVTETMDDIIAFIEVLVKKGNAYASSGDVYFRTRSFKDYGQLSQQSIDELR
FT                   SGARIEVGEKKEDPLDFVLWKAAKPGEPAWTSPWGEGRPGWHIECSAMAKKYLGDTIDI
FT                   HAGGQDLKFPHHENEIAQSEACNSQKFANYWMHNGFLNIENEKMSKSLGNFLTVHEAIQ
FT                   AVDPMVLRFFMLSVQYRHPINYSRDLIDQAANGLARIRESVANVEHRLTMTADLGTATE
FT                   KWLNRIEEIKQHFVTSMDDDFNTANAVTDLFDLSKEANLYLGEDQVAKEVLERFLAVFQ
FT                   ELSTVLGVTLTIEKGLLDEEVEQLIRDRDTARKERDFARADAIRDQLRDQGILLEDTAQ
FT                   GMRWKRG"
FT   gene            105106..105510
FT                   /locus_tag="Exig_0076"
FT   CDS_pept        105106..105510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0076"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: gka:GK0086
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59563"
FT                   /db_xref="GOA:B1YGT0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT0"
FT                   /protein_id="ACB59563.1"
FT                   /translation="MKNYKQLNALALAYMGDVVYEMHVRERLLEKGFVKPGELHQAAIR
FT                   YVRAQAQAFVVTHWLNENTLTEEEQAVVRRGKNAKSGSVPKSTDVHTYRYATAFEALLG
FT                   YIYLAEGGDRLEELIGQAFELLEAEATDGK"
FT   gene            105599..106363
FT                   /locus_tag="Exig_0077"
FT   CDS_pept        105599..106363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0077"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: bha:BH0113
FT                   tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59564"
FT                   /db_xref="GOA:B1YGT1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT1"
FT                   /protein_id="ACB59564.1"
FT                   /translation="MIEPLAEGQDFLYGRNPVLEALRSGREMNKLFIQEGQQKGPLAVI
FT                   HAMAKEAGVQTQIVPRSKLHGLTGSDNHQGVVAAVAAYEYAELDDIFALAEKKDETPLM
FT                   ILLDELEDPHNLGSILRTADAVGAHGIIIPKRRSVGLTQVVAKASTGAIEHIPVVRVTN
FT                   LTRTMEDLKKKGIWFVGTDARESDDYRTLDGTMPLGIVIGSEGKGMSRLVREKCDFLVH
FT                   LPMAGHVTSLNASVAASLLLYEVYRTRKPYSR"
FT   gene            106360..106890
FT                   /locus_tag="Exig_0078"
FT   CDS_pept        106360..106890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0078"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   bcy:Bcer98_0087 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59565"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT2"
FT                   /protein_id="ACB59565.1"
FT                   /translation="MKYDRLIVDGYNIIGAWPEFRTLREQDFELARERLVDAMAEYQAV
FT                   TGISVTIVFDAYLQPGRESRIKKSGIEVIYTRENETADEWIEKTAAEWLQDIRVKLTVA
FT                   TNDFTEQWVIFTLGALRVSAQELRRDWKAAVAVIRGQTITSKTSQKPRSTIDMPADVIE
FT                   RLEEIRRRKNSDS"
FT   gene            107080..107721
FT                   /locus_tag="Exig_0079"
FT   CDS_pept        107080..107721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0079"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bwe:BcerKBAB4_0088 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59566"
FT                   /db_xref="GOA:B1YGT3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT3"
FT                   /protein_id="ACB59566.1"
FT                   /translation="MSLVSFDQFECMTDEALVEQAKVFDNSDALEFLIERYRNFVRAKA
FT                   RSYFLIGADREDIIQEGMIGLYKAVRDYRTDKLASFKGFAELCITRQMITAIKTATRQK
FT                   HIPLNSYISLDKPIYDDESERTLLDIITSTAPSDPQVLIVNREEYADIESKMDEILSDL
FT                   ERKVLALYLDGRTYQEISDDLDRHVKSIDNALQRVKKKLERYLEARKLTV"
FT   gene            107879..108025
FT                   /locus_tag="Exig_0080"
FT   CDS_pept        107879..108025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0080"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: ssp:SSP2221 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59567"
FT                   /db_xref="GOA:B1YGT4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGT4"
FT                   /protein_id="ACB59567.1"
FT                   /translation="MAKKVGLACDICGARDYTTMKKEDVSIRLELKKFCRRCNAHTIHK
FT                   EAK"
FT   gene            108070..108240
FT                   /locus_tag="Exig_0081"
FT   CDS_pept        108070..108240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0081"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bsu:BSU01000
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59568"
FT                   /db_xref="GOA:B1YGT5"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT5"
FT                   /protein_id="ACB59568.1"
FT                   /translation="MKFLRDVWNELKKTSWPKRKELTKYTLTVIGMVIFMGVFIFGVDS
FT                   GLSAFMSWLIK"
FT   gene            108260..108811
FT                   /locus_tag="Exig_0082"
FT   CDS_pept        108260..108811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0082"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KEGG: lwe:lwe0209
FT                   transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59569"
FT                   /db_xref="GOA:B1YGT6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT6"
FT                   /protein_id="ACB59569.1"
FT                   /translation="MDKQWFVVQTYSGFENNVKANLERRIESMNMDEKIFRVLVPIETV
FT                   QEEVTNKKGETKIKEREIKIFPGYVLVEMVMTDDSWYVVRNTPNVTGFLGSVGGGSKPT
FT                   PLLPEEAENILGSMGLVDMKSRYDFTMGQIVRIKEGVFANLEGTIEELETEAEKMKVSV
FT                   DMFGRETKVELDFSQVEKID"
FT   gene            108961..109386
FT                   /locus_tag="Exig_0083"
FT   CDS_pept        108961..109386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0083"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: bpu:BPUM_0087
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59570"
FT                   /db_xref="GOA:B1YGT7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGT7"
FT                   /protein_id="ACB59570.1"
FT                   /translation="MAKKVMKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQDQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRKKVATVKRDK
FT                   VREIAETKMPDLNAASVETAMLMVEGTARSMGIVIED"
FT   gene            109503..110189
FT                   /locus_tag="Exig_0084"
FT   CDS_pept        109503..110189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0084"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: btl:BALH_0096 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59571"
FT                   /db_xref="GOA:B1YGT8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT8"
FT                   /protein_id="ACB59571.1"
FT                   /translation="MGKKYKEAAKLIDRTVSYELAEAVDLTKKSATAKFDETIELAVRL
FT                   GVDPKKADQQIRGAVVLPHGTGKTQKVLVFAKGEKLKEAEAAGADFAGDSEYITKIQQG
FT                   WFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAINDIKAGKVEYRVD
FT                   KSGNIHVPVGKKSFDDAKLVENINTVIETLVKVKPATAKGVYLKNIAIASTMGPGVKVS
FT                   AVDFAK"
FT   gene            110449..110955
FT                   /locus_tag="Exig_0085"
FT   CDS_pept        110449..110955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0085"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: btl:BALH_0097 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59572"
FT                   /db_xref="GOA:B1YGT9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT9"
FT                   /protein_id="ACB59572.1"
FT                   /translation="MANEKVIAVKADLVSEIAEKMQASAGTIVVDYRGLTVDEVTELRK
FT                   QLREAGVEFKVYKNGLLRRAAVQSNLEGLDEVFTGPTAIAFSNEDVIAPAKILNNFSKD
FT                   HKALELKGGIIEGKVTSVEDVKALAELPSREGLLSMLLSVLQAPIRGLAVATNAIAEQK
FT                   EEQSA"
FT   gene            111032..111397
FT                   /locus_tag="Exig_0086"
FT   CDS_pept        111032..111397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0086"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bha:BH0122 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59573"
FT                   /db_xref="GOA:B1YGU0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU0"
FT                   /protein_id="ACB59573.1"
FT                   /translation="MAFNKEQFIEDLKGMTVLELNELVKTIEEEFGVSAAAPVAAAGAG
FT                   AAAAEEQTEFDVILTSAGSGKINVIKAVRELTGLGLKEAKALVDGTPAPVKEGVSKEDA
FT                   DAIKAKLEEAGASVEVK"
FT   gene            111481..112077
FT                   /locus_tag="Exig_0087"
FT   CDS_pept        111481..112077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0087"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: bcy:Bcer98_0095
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59574"
FT                   /db_xref="GOA:B1YGU1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU1"
FT                   /protein_id="ACB59574.1"
FT                   /translation="MADHYYTNDPSSKRDPKSWEFVLRGETFRFTSDHGVFSKGGVDFG
FT                   SRLLIEAFTEPDVSGAILDVGCGYGPMGISLAKTTGREAVLVDVNERALELAADNARAN
FT                   GVSVTTGVSDGYAGVVGQTFAAIVTNPPIRAGKTVVHRILREAYDHLDVGGALWVVIQK
FT                   KQGGPSAKKLMEEVFGSCETVTRDKGYSIFKSIRS"
FT   gene            112308..115865
FT                   /locus_tag="Exig_0088"
FT   CDS_pept        112308..115865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0088"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: btl:BALH_0100
FT                   DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59575"
FT                   /db_xref="GOA:B1YGU2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU2"
FT                   /protein_id="ACB59575.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTNSYEWFLREGL
FT                   REMFHDISPISDFTGNLVLEFIDYSLGEPKYSIDESKERDVTYSAPLRVKVRLQNKETG
FT                   ELKEQEVFMGDFPLMTESGTFIINGAERVIVSQLVRSPSVYYNNKLDKNGKRGFSATVI
FT                   PNRGAWLELETDAKDIVYVRIDRTRKIPVTVLLRALGFGTDQEIIDLLGDDEYLRNSLE
FT                   KDNTETTEKALIEIYERLRPGEPPTVENAKALLVSRFFDPKRYDLANVGRCKINKKLHL
FT                   KNRLFGQKLAETLVDPETGEVIAEEGTVLDRRMLDKVLPFLEGSVGYIEATPTGGVTQG
FT                   EAFNLQSIKVFAPDDAEGERIINIIGNGNIDRDIKHITPADMIAAINYFFNLLHEVGTT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMSIQDQNAITPQALINIRPVIAS
FT                   IKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYSRMCP
FT                   IETPEGPNIGLINSLSSFAKVNEYGFIEAPYRRVDPETGVVTNEIHYMTADEEDLYVVA
FT                   QANMLLTEEKTFQDTHVLSRFRGQNLSVEPARVDYMDVSPKQVVSAATACIPFLENDDS
FT                   NRALMGANMQRQAVPLLDPESPIVGTGMEYVSAKDSGAAVVAKHSGIAERVTAREILVR
FT                   RTTEVDGNIVQGELDRYKIQKFIRSNQGTCYNQKPIIKVGDPVDKGEILADGPSMDGGE
FT                   LALGRNVLVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYECESRDTKLGPEEITR
FT                   DIPNVGDDALKNLDDRGIIRVGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGDGIILDVKIFDRDNGDELSPGVNQLIRAYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPYMPDGTPIDIMLNPLGVPSRMNIGQLLELHLGMAARQLGIKVA
FT                   SPVFDGAREEDVWATIEEAGMDRDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDTIGR
FT                   VKAYEAIVKGENVPQPGVPESFRVLIKELQSLGMDVKMMSAEDEEIEMKDDDEDNIPNA
FT                   TPALEEVQAPVAPVVTEEE"
FT   gene            115886..119485
FT                   /locus_tag="Exig_0089"
FT   CDS_pept        115886..119485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0089"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: bha:BH0127 DNA-directed RNA polymerase subunit
FT                   beta'; TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59576"
FT                   /db_xref="GOA:B1YGU3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU3"
FT                   /protein_id="ACB59576.1"
FT                   /translation="MVDVNRFEYMKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECYCGKYKRIRYKGIICDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEIIYFASYVVTDPGESTLEKKQLLSEKEYRAYREKFG
FT                   SSFTAEMGAEAVRKLLRDVELEKEVAGLREDLRMIQGQRRTRAIKRLEVLDAFRNSGNN
FT                   PEWMVLEVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVSRGIAPNIKSAKRKIERVQPEIWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERENAIGEGKIFS
FT                   TVNEALIAYQNGYVHFHTRVAIPAGVLKNPTFTEAQNEKLLVTTVGKLIFNEILPTTFP
FT                   YLNEPSMNNLQEATPDQYFLEKGTDIAAEIKSRPIIEPFKKGFLGNVIAEVFKRFETTE
FT                   TSRMLDRMKNLGFKHSTRAGITVGIADIIVLPDKQEILVEAQDNVDRVMKSYRRGLITE
FT                   EERYERVVKSWNDAKDEIQSRLMKSLNRLNPIFMMSDSGARGNASNFTQLAGMRGLMAA
FT                   PSGRIIELPIKSSFREGLTVQEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IREDDCGTDRGIRVTALREGTEEIENLYDRLVGRTAFEKVVHPETGAVLVSTNELIDED
FT                   IARAITDAGIDNVEIRTAFTCNTSHGVCKKCYGRNLATGNDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQAVISEIDGQVIDFTESRDKRE
FT                   LTIQGLSETRTYTIPFGSRLRVQLGEEVKAGQVFTEGSIDPKELLNVKGVSGVQNYLLQ
FT                   EVQKVYRMQGVEIGDKHVEVMVRQMIRRVRVIESGETSLLPGSLVDISTFKEACKEALR
FT                   AGKALASAKPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKSDYLRGLKENVII
FT                   GKLVPAGTGMTRYRQIGLEIAGEAPVEADSPVE"
FT   gene            119566..119817
FT                   /locus_tag="Exig_0090"
FT   CDS_pept        119566..119817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0090"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gtn:GTNG_0100 LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59577"
FT                   /db_xref="GOA:B1YGU4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU4"
FT                   /protein_id="ACB59577.1"
FT                   /translation="MSYKKVVGADLKFVGQKQTLKALRSGKASEVIIADDADEHVKQAL
FT                   LDAAKQANVPVVNVPSKLELGKACGIDVAATAVAIKKV"
FT   gene            119943..120365
FT                   /locus_tag="Exig_0091"
FT   CDS_pept        119943..120365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0091"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: gtn:GTNG_0101 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59578"
FT                   /db_xref="GOA:B1YGU5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU5"
FT                   /protein_id="ACB59578.1"
FT                   /translation="MPTINQLVRKGRQSKVVKSDSPALNKGYNSFIKARTDISSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNTMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK"
FT   gene            120415..120885
FT                   /locus_tag="Exig_0092"
FT   CDS_pept        120415..120885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0092"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: bha:BH0130 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59579"
FT                   /db_xref="GOA:B1YGU6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU6"
FT                   /protein_id="ACB59579.1"
FT                   /translation="MPRKGQVERRDVMADPIYNSKLVTRLINRLMLDGKKGTAQQILYK
FT                   AFEAIAERSGRDAMEVFEEAMNNIMPVLEVKARRVGGANYQVPVEVRPERRTTLALRYL
FT                   VNYSRLRNEKTMDARLANEIMDAANNTGASVKKREDMHKMAEANKAFAHYRW"
FT   gene            121010..123088
FT                   /locus_tag="Exig_0093"
FT   CDS_pept        121010..123088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0093"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: bca:BCE_0107 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59580"
FT                   /db_xref="GOA:B1YGU7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU7"
FT                   /protein_id="ACB59580.1"
FT                   /translation="MAREFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGNRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   IPIGAEDEFKGIIDLVEKKTYMYGNDLGTDIEETEGFPAEFAEEAEELRASLIEAVADY
FT                   EEEMMMKYLEGEEITIEELKAGIRKATLTVDFYPVLVGSAFKNKGVQLMLDAVLDYLPS
FT                   PVDVKAITGINMDTDEEIVRESTDEAPFSALAFKVMTDPYVGKLTFFRVYSGTASAGSY
FT                   VKNSTKGKRERLGRILQMHANSREEIPMVFAGDIAAAVGLKDTTTGDTLCAEKDNVVLE
FT                   SMTFPEPVISVAIEPKTKADQDKMGQALAKLAEEDPTFRTETNPETGQTIISGMGELHL
FT                   DIIVDRMRREFKVEANVGAPQVAYRETIRQSAKIDSKFARQSGGRGQYGHVVVEFEPNE
FT                   EGAGFEFNNKIVGGVVPREYIPAVEHGIEEALQNGILAGYPVVDVKAALVFGSYHDVDS
FT                   NEMAFKIAASMAVKQLKDKSGAVILEPMMKVEIVIPDEYMGDIMGDVTSRRGRVEGMEA
FT                   RGNAQVVRSMIPLSEMFGYATGLRSRTQGRGTYSMHFDHYEEVPKSVAEEIIKKANG"
FT   gene            123206..124393
FT                   /locus_tag="Exig_0094"
FT   CDS_pept        123206..124393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0094"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bha:BH0132
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59581"
FT                   /db_xref="GOA:B1YGU8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU8"
FT                   /protein_id="ACB59581.1"
FT                   /translation="MGKEKFDRSKPHVNVGTIGHVDHGKTTLTAAISAVLAKSQGKAAT
FT                   KFDQIDGAPEERERGITIATAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSATDGPMPQTREHILLSRQVGVPFIVVFMNKVDMVDDEELLELVEMEIRELLSEYDF
FT                   PGDDLPVIQGSALGALNGEAKWEEKIMELMNAVDEYIPEPTRDTEKDFMMPVEDVFSIT
FT                   GRGTVATGRVERGVLKVNDEVEIVGLHEETKKSVCTGVEMFRKLLDYAEAGDNIGALLR
FT                   GVSRDDIERGQVLAKPNTITPHKTFKAQVYILSKEEGGRHTPFFGNYRPQFYFRTTDVT
FT                   GMCQLPEGTEMVMPGDNIELTVELIAPIALEKETRFSIREGGRTVGAGSVTEIVE"
FT   gene            124712..125020
FT                   /locus_tag="Exig_0095"
FT   CDS_pept        124712..125020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0095"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bpu:BPUM_0101
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59582"
FT                   /db_xref="GOA:B1YGU9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU9"
FT                   /protein_id="ACB59582.1"
FT                   /translation="MANEKIRIRLKAYDHRVLDQSAEKIVETAKRSGATVSGPIPLPTE
FT                   KAIYTVLRAVHKYKDAREQFEMRTHKRLIDIVNPTPKTVDALMRLELPSGVDIEIKL"
FT   gene            125089..125715
FT                   /locus_tag="Exig_0096"
FT   CDS_pept        125089..125715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0096"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bha:BH0134 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59583"
FT                   /db_xref="GOA:B1YGV0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV0"
FT                   /protein_id="ACB59583.1"
FT                   /translation="MAKGILGTKLGMTQIFNESGEVVPVTVVSVEGNVVLQLKTMEVDG
FT                   YEAVQLGFGDIKEGRQNKPQKGHAAKASATPKRFIKEIRTSVTDFEIGQEIKADTFAAG
FT                   EMVDVTGTSKGKGFAGAIKRHNQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKLLPGRM
FT                   GGEQVTVQNLEIVKVDVERGLLLVKGAIPGARKSQVVVKTAVKGN"
FT   gene            125745..126368
FT                   /locus_tag="Exig_0097"
FT   CDS_pept        125745..126368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0097"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bha:BH0135 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59584"
FT                   /db_xref="GOA:B1YGV1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV1"
FT                   /protein_id="ACB59584.1"
FT                   /translation="MPKVALLNQTGTQVGDIELADAVFGIEPNEAVVYDAIVMQQASRR
FT                   QGTHDTKGRSEVRGGGRKPWKQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYAYKLPKK
FT                   VRRLALRSALSSKVANNEFIVLEGLTIDAPKTKDMISVFAALSIERKVLVVTADYNETV
FT                   VLSTRNIPGVTVVDAAGVNVLDLVAHDKVIFTKDAVARVEEVLA"
FT   gene            126368..126652
FT                   /locus_tag="Exig_0098"
FT   CDS_pept        126368..126652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0098"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: btl:BALH_0110
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59585"
FT                   /db_xref="GOA:B1YGV2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV2"
FT                   /protein_id="ACB59585.1"
FT                   /translation="MANAHDIIKRPVITERSVNQMAEKKYTFEVDVKASKTQIKDAVEA
FT                   IFGVKVEKINTLISKPKAKRVGRHAGYTARRKKAVVTLTADSKELDYLG"
FT   gene            126685..127515
FT                   /locus_tag="Exig_0099"
FT   CDS_pept        126685..127515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0099"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: bcy:Bcer98_0107
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59586"
FT                   /db_xref="GOA:B1YGV3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV3"
FT                   /protein_id="ACB59586.1"
FT                   /translation="MGIKKFKPTTNGRRNMTALDFAEITASRPEKSLTEKLSKKGGRNN
FT                   QGRLTVRHQGGGHKRKYRIIDFKRNKDGIAGRIATIEYDPNRSANIALVHYIDGEKRYI
FT                   LAPKGLKVDMQVMSGVEADIKVGNALPLSNIPVGTLIHNIELKPGKGGQLVRSAGTSAQ
FT                   LLGKDGKYAIVRLQSGETRMILATCRATVGAVGNEEHELVNIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRAPIGRSGPLTPWGKPALGYKTRKKNKASDKYIVRRSKK"
FT   gene            127579..127857
FT                   /locus_tag="Exig_0100"
FT   CDS_pept        127579..127857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0100"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: gtn:GTNG_0110 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59587"
FT                   /db_xref="GOA:B1YGV4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV4"
FT                   /protein_id="ACB59587.1"
FT                   /translation="MGRSLKKGPFADHHLLAKVDKANEAGDKHVIKTWSRRSTIFPEFI
FT                   GHTIAVYDGRKHVPVYVTEDMVGHKLGEFAPTRSYKGHAGNDKKTKR"
FT   gene            127878..128210
FT                   /locus_tag="Exig_0101"
FT   CDS_pept        127878..128210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0101"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: gka:GK0111 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59588"
FT                   /db_xref="GOA:B1YGV5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV5"
FT                   /protein_id="ACB59588.1"
FT                   /translation="MQSKASANMVRIAPRKARLVVDLIRGKQIGEALSILAYTNKAATP
FT                   IVEKVLKSAIANAEHNFDMNIENLVVTEAYVNEGPTLKRFRPRAMGRASRINKRTSHVH
FT                   IVVSEK"
FT   gene            128223..128879
FT                   /locus_tag="Exig_0102"
FT   CDS_pept        128223..128879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0102"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: gka:GK0112 30S ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59589"
FT                   /db_xref="GOA:B1YGV6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV6"
FT                   /protein_id="ACB59589.1"
FT                   /translation="MGQKINPTGLRVGIIKDWESRWFADKDYADLLHEDYVVREYIEKR
FT                   LKDASVSKVEIERAANRLNISLHTAKPGMVIGKGGSEIETLRTDITNLAKGKRVHVNVV
FT                   EVKNPDAVAKLVAENIARQLEGRVSFRRAMKQSIQRSMRSGIKGIKTEVSGRLGGADIA
FT                   RSEKYSEGTVPLHTLRADIDYGTAEADTTYGKIGVKVWLHHGEVLPTKKAASNEQ"
FT   gene            128913..129350
FT                   /locus_tag="Exig_0103"
FT   CDS_pept        128913..129350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0103"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: bcl:ABC0157 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59590"
FT                   /db_xref="GOA:B1YGV7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV7"
FT                   /protein_id="ACB59590.1"
FT                   /translation="MLLPKRVKYRRVHRGNMRGKAKRGTTVHFGEFGIQAQEASWITSR
FT                   QIESARIAMTRYMKRGGKVWIKIFPHKPYTKKPLEVRMGSGKGAPEGWVAVVKPGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREENGGDTNESN"
FT   gene            129337..129540
FT                   /locus_tag="Exig_0104"
FT   CDS_pept        129337..129540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0104"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: bcl:ABC0158 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59591"
FT                   /db_xref="GOA:B1YGV8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV8"
FT                   /protein_id="ACB59591.1"
FT                   /translation="MKATDLRQQTTEELNGKVGSWKEELFNLRFQLATGQLENPARIRE
FT                   VRKSIARAKTVLRERELGINNA"
FT   gene            129572..129835
FT                   /locus_tag="Exig_0105"
FT   CDS_pept        129572..129835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0105"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: sgo:SGO_1976 30S
FT                   ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59592"
FT                   /db_xref="GOA:B1YGV9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV9"
FT                   /protein_id="ACB59592.1"
FT                   /translation="MERTNNRKVLTGRVVSDKMDKTIVVTVETKVKHKLYGKRVNYSKK
FT                   YKTHDENNTAKIGDVVRIQETRPLSKDKRFRLVEVVEKAVII"
FT   gene            129884..130252
FT                   /locus_tag="Exig_0106"
FT   CDS_pept        129884..130252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0106"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: oih:OB0129 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59593"
FT                   /db_xref="GOA:B1YGW0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW0"
FT                   /protein_id="ACB59593.1"
FT                   /translation="MIQQESRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVRAVVVRTKRGVRRKDGSYIRFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELREKDFMKIVSLAPEVL"
FT   gene            130287..130598
FT                   /locus_tag="Exig_0107"
FT   CDS_pept        130287..130598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0107"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: btl:BALH_0119 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59594"
FT                   /db_xref="GOA:B1YGW1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW1"
FT                   /protein_id="ACB59594.1"
FT                   /translation="MHVKKGDKVQVMTGKDKGKQGVVLTAMPKKDRVIVEGVNMIKKHS
FT                   KPSQLNPQGGIVEKEAPIHVSNVMLIDPKTGNPTRVGFTVVDGKKVRIAKKSGEALDK"
FT   gene            130630..131169
FT                   /locus_tag="Exig_0108"
FT   CDS_pept        130630..131169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0108"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: efa:EF0218 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59595"
FT                   /db_xref="GOA:B1YGW2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW2"
FT                   /protein_id="ACB59595.1"
FT                   /translation="MNRLKAKYQDEIVKVMMEKFNYTSVMQAPKVDKIVINMGVGDAVT
FT                   NTKALDMAVEELQLLTGQKPLITKAKKSIAGFKLREGMPIGAKVTLRGERMYEFLDKLI
FT                   NVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDRVSKVRGMDIVIVTTANTD
FT                   EESRELLTALGMPFQK"
FT   gene            131184..131453
FT                   /locus_tag="Exig_0109"
FT   CDS_pept        131184..131453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0109"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: spd:SPD_0206
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59596"
FT                   /db_xref="GOA:B1YGW3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW3"
FT                   /protein_id="ACB59596.1"
FT                   /translation="MAKKSMIAREVKRQALVERYAEQRAELKAQGDYIGLSKLPRNSSA
FT                   VRLHNRCSITGRPHGYIGKFGISRIKFRDLAHKGQIPGVKKASW"
FT   gene            131485..131883
FT                   /locus_tag="Exig_0110"
FT   CDS_pept        131485..131883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0110"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59597"
FT                   /db_xref="GOA:B1YGW4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW4"
FT                   /protein_id="ACB59597.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEMPASTIKREVAEILKREGF
FT                   IRDVEYLEDSKQGTLRVFLKYGASNERVITGLKRISKPGLRVYAKADEIPKVLGGLGIA
FT                   IVSTSKGVMTDKEARQQKVGGEVIAYIW"
FT   gene            131915..132451
FT                   /locus_tag="Exig_0111"
FT   CDS_pept        131915..132451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0111"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: gka:GK0121 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59598"
FT                   /db_xref="GOA:B1YGW5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW5"
FT                   /protein_id="ACB59598.1"
FT                   /translation="MSRIGKKPVVIPAGVTVTVENSTVTVKGPKGELTREFNPTMAINV
FT                   EGNELTVTRPNDEKANRTIHGTTRALIANMVEGVNNGFAKTLDIQGVGYRAQKQGNKIV
FT                   LNLGYSHPIEYTPEQGIEVEVPTNTQIIVRGISKERVGHVAALIRSYRQPEPYKGKGIR
FT                   YSDEVVRRKEGKTGK"
FT   gene            132489..132839
FT                   /locus_tag="Exig_0112"
FT   CDS_pept        132489..132839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0112"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bpu:BPUM_0118 ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59599"
FT                   /db_xref="GOA:B1YGW6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW6"
FT                   /protein_id="ACB59599.1"
FT                   /translation="MISKANKNATRKKRHGRVRRTIIGTAARPRLNVFRSNKNIYVQVI
FT                   DDATHATLASASSLDLEKGNTTDAASAVGKLAAERALEKGIETVVFDRGGYLYHGRIKA
FT                   VAEAAREAGLKF"
FT   gene            132862..133362
FT                   /locus_tag="Exig_0113"
FT   CDS_pept        132862..133362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0113"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   bcl:ABC0167 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59600"
FT                   /db_xref="GOA:B1YGW7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGW7"
FT                   /protein_id="ACB59600.1"
FT                   /translation="MRQLEINMDQLEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAIEDAKKNMVNVPIVNTTIPHEINGIFGAGHVFLKPASEGTG
FT                   VIAGGPVRAVLELAGINDILSKSLGSSTPINMVRATVKGLTSLKRAEDVAKLRGKTVEE
FT                   LRG"
FT   gene            133381..133566
FT                   /locus_tag="Exig_0114"
FT   CDS_pept        133381..133566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0114"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: gtn:GTNG_0123 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59601"
FT                   /db_xref="GOA:B1YGW8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW8"
FT                   /protein_id="ACB59601.1"
FT                   /translation="MAKLAVTLTRSMIGRPENQRVTTRTLGLRKMHQTVVVPDNAAMRG
FT                   MINHVSHLLTVKEIQE"
FT   gene            133603..134043
FT                   /locus_tag="Exig_0115"
FT   CDS_pept        133603..134043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0115"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: bha:BH0153 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59602"
FT                   /db_xref="GOA:B1YGW9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGW9"
FT                   /protein_id="ACB59602.1"
FT                   /translation="MKLHELKPAAGSRSERNRVGRGMSSGNGKTSGRGHKGQKARSGGG
FT                   VRPGFEGGQNPLFRRLPKRGFNNPTRKEFAVINLDTLNRFEDGTEVTPELLIETRAVKG
FT                   MKDGVKILSNGKIEKKLTVKAHKFSEAAKQAIEAAGGTVEVI"
FT   gene            134043..135332
FT                   /locus_tag="Exig_0116"
FT   CDS_pept        134043..135332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0116"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: bha:BH0154 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59603"
FT                   /db_xref="GOA:B1YGX0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX0"
FT                   /protein_id="ACB59603.1"
FT                   /translation="MFQAISNMWRVADIRRRILFTLALIIVFRIGAHIPVPMVNTEVFK
FT                   IDQNGILGFLNSFGGNALQNFSLFAMGIMPYITASIVVQLLQMDVVPKFAEWAKQGEAG
FT                   RKKLATVTRYGTIVLGLVQAFGIALGFNRIYPGLVDEQYGTWTYVMIALVLTAGTAFLM
FT                   FLGELITEKGIGNGISMIIFAGIVAGFPNAFRQIYETKLQNAGDALFVNVLYIVLLLLI
FT                   IIAVIVGVIYVQQAARKIPIQYAKRTVNRAPVGGQSTHLPIKLNAAGVIPVIFAVSFMV
FT                   TPPTVASFFASPENATKIRDIFDYTSPIGMSIYVALIIAFSYFYTFVQVNPEQMAENLQ
FT                   KQGGYIPGIRPGKQTEQYITKILYRLTFFGSLFLAVIAVTPTFFIKFAGLPNSVQIGGT
FT                   SLLIVIGVGLETMKQIESQLVKRHYKGFIR"
FT   gene            135405..136052
FT                   /locus_tag="Exig_0117"
FT   CDS_pept        135405..136052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0117"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein; KEGG: bha:BH0155 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59604"
FT                   /db_xref="GOA:B1YGX1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX1"
FT                   /protein_id="ACB59604.1"
FT                   /translation="MNLVLMGLPGAGKGTQAAKIIEDYAIPHISTGDMFRAAIKDQTPL
FT                   GQEAKSYMDKGELVPDEVTIGIVRERLAKEDCANGFLLDGFPRTVKQADALEVLLADLN
FT                   KQIDHVVHIGVNPEKLVPRLTGRRICPTCGATYHVIYNPPKVEGVCDIDGSALVQREDD
FT                   QEETVRRRLEVNVAQAQPLIDFYAEKGYLRNLDGDRPINEVYSDVQALLGGQ"
FT   gene            136052..136804
FT                   /locus_tag="Exig_0118"
FT   CDS_pept        136052..136804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0118"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: bha:BH0156 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59605"
FT                   /db_xref="GOA:B1YGX2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX2"
FT                   /protein_id="ACB59605.1"
FT                   /translation="MIITKAPREIDIMRQAGQIVARTHKELKAHIRPGITTGQLDAIAE
FT                   RYIRSQGATPSFKGYNGFTGSICASVNEELVHGIPGDRVLHDGDIISIDIGAEYNGYHG
FT                   DSAWTYPVGTISEETKRLLDVTEESLYKGLERAKAGVHLTDISHAIQSHVEAANFSVVR
FT                   EYVGHGVGQNLHEDPQIPHYGPPGKGPRLKTGMTLAIEPMVNVGKRYVRTLSDNWTVVT
FT                   VDGSMCAHFEHTIAITDEGYEILTVDAE"
FT   gene            136955..137173
FT                   /locus_tag="Exig_0119"
FT   CDS_pept        136955..137173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0119"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bha:BH0158 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59606"
FT                   /db_xref="GOA:B1YGX3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX3"
FT                   /protein_id="ACB59606.1"
FT                   /translation="MAKQDVIEVEGTVIEPLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRFK"
FT   gene            137207..137320
FT                   /locus_tag="Exig_0120"
FT   CDS_pept        137207..137320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0120"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: cbe:Cbei_0176
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59607"
FT                   /db_xref="GOA:B1YGX4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX4"
FT                   /protein_id="ACB59607.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            137341..137706
FT                   /locus_tag="Exig_0121"
FT   CDS_pept        137341..137706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0121"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: bld:BLi00159 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59608"
FT                   /db_xref="GOA:B1YGX5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX5"
FT                   /protein_id="ACB59608.1"
FT                   /translation="MARIAGVDIPREKRIVISLTYIYGVGKTTAQKVLKEAGISEDTRT
FT                   RELTEEQLNQLRDGLDKVKVEGDLRREISLNIKRLIEIGCYRGVRHRRGLPVRGQNTKN
FT                   NSRTRKGPRRTVANKKK"
FT   gene            137723..138118
FT                   /locus_tag="Exig_0122"
FT   CDS_pept        137723..138118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0122"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bpu:BPUM_0129
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59609"
FT                   /db_xref="GOA:B1YGX6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX6"
FT                   /protein_id="ACB59609.1"
FT                   /translation="MAKRKQNVRSKRKVKKNIESGIVHIRSTFNNTIVTITDMQGNAIS
FT                   WATAGNMGFKGSRKSTPFAAQLASETAAKTAMDNGMRTVEVNVKGPGAGREAAIRALQA
FT                   IGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            138256..139200
FT                   /locus_tag="Exig_0123"
FT   CDS_pept        138256..139200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0123"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bsu:BSU01430 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59610"
FT                   /db_xref="GOA:B1YGX7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX7"
FT                   /protein_id="ACB59610.1"
FT                   /translation="MIEIEKPKIETVELSDNATFGKFVVEPLERGFGTTLGNSLRRILL
FT                   SSLPGAAVTAVQIDGVLHEFSTIDGVVEDVTQIILNLKKLALKVYSEEEKTLEIDIQGA
FT                   GVVTAANITHDSDVEILNPELHIATLAEGASLHMRLTARRGRGYVQAEDNKRDDMPIGV
FT                   IPIDSIYTPIQRVNYQVEKTRVGQDASFDKLTLDVWTDGSIRPEEAVSLGAKIMTEHLN
FT                   IFVGLTDEALHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKS
FT                   EDEMMKVRNLGRKSLEEVQAKLDELGLGLRKED"
FT   gene            139234..139605
FT                   /locus_tag="Exig_0124"
FT   CDS_pept        139234..139605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0124"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: bcl:ABC0178 50S
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59611"
FT                   /db_xref="GOA:B1YGX8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGX8"
FT                   /protein_id="ACB59611.1"
FT                   /translation="MAYSKLGRTSSQRKALLRDLATDLIINERIQTTEQKAKELRPVVE
FT                   KLITLGKRGDLHARRQVASFVRREAAGQNEAGKTQDAIQKLFADVAPRFAERQGGYTRI
FT                   MKMGPRRGDGAEMVIIELV"
FT   gene            139702..140532
FT                   /locus_tag="Exig_0125"
FT   CDS_pept        139702..140532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lwe:lwe2551 cobalt ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59612"
FT                   /db_xref="GOA:B1YGX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGX9"
FT                   /protein_id="ACB59612.1"
FT                   /translation="MTKLIELEQVTYRYPEQEQPALRNVSLSIHSQEWVAIVGHNGSGK
FT                   STLTKLFNGLLLPEEGTVTVNETFSSAVPEQLWEMRRAIGIVFQNPDNQFVGTTVRDDV
FT                   AFALENWGVPREEMVRRIDDSLARVGLTDFVDREPHQLSGGQKQRVAIASALAMRPDVL
FT                   VLDEATSMLDPIARTEVMSTVQELYEQHPMAVVAITHELDEVLRASRVIVMDAGQIVLE
FT                   GTPQEVFAQSAFLEQIGLDVPFVVRVQEQLSVRGLTYEDTILDERDLVNRLCQS"
FT   gene            140520..141377
FT                   /locus_tag="Exig_0126"
FT   CDS_pept        140520..141377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0126"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bpu:BPUM_0133 cobalt (Co2+) ABC superfamily ATP
FT                   binding cassette transporter, ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59613"
FT                   /db_xref="GOA:B1YH81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH81"
FT                   /protein_id="ACB59613.1"
FT                   /translation="MPILIQELNYTYQLNSPFERVALRDVNLEIPSGALVAFVGHTGSG
FT                   KSTLVQHINGLLKPTAGKVQVDDIIIEPKRKQDLKALRKRVGLVFQYPEYQLFEETVLK
FT                   DVMFGPMNFGHAPAEAERLAKDALRTVGLDEVFWSRSPFDLSGGQMRRVAIAGVLASQP
FT                   DVLIVDEPTAGLDPQGRKQMLSLFAELHAQSGMTLLLITHDMDQVLEYTNRVVVMEEGQ
FT                   VAYDGEPMGLFRQETLLRQFHLDLPHVLAFAWQMADQLNQPRPSLQTEAELIDWILHVR
FT                   EDKR"
FT   gene            141374..142165
FT                   /locus_tag="Exig_0127"
FT   CDS_pept        141374..142165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0127"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   bay:RBAM_001720 YbaF"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59614"
FT                   /db_xref="GOA:B1YH82"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH82"
FT                   /protein_id="ACB59614.1"
FT                   /translation="MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLL
FT                   LFTFFALASSKLPIRYVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLR
FT                   LAIIVSLRFFYLVSITTLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRF
FT                   LPTLAEETEKIMKAQQARGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEAR
FT                   GYRGGEGRTRLRESKWTTRDTGLILLLVALGLLLVYLRGGF"
FT   gene            142165..142914
FT                   /locus_tag="Exig_0128"
FT   CDS_pept        142165..142914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0128"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: bce:BC0163 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59615"
FT                   /db_xref="GOA:B1YH83"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH83"
FT                   /protein_id="ACB59615.1"
FT                   /translation="MRRFKCTIQYDGTDYSGYQVQPNGLTIQEVLEKTLGRMHKHPVKV
FT                   IGSGRTDARVHAQGQVIHFDTELSIAPASMVKALNTLLPDDIRVRDCKEVASDFEARYD
FT                   VVGKEYRYFVRRTENAFRRHQSVLIPYSLDVAQIRLGLAHLVGTHDFSSFCVAKTETDN
FT                   RVRTIYEAELIEQGEELIFRFQGSGFLYNQIRIMVGTLLDVGRGRFAPDDIKRMLEAKD
FT                   RNVAGVTAPPHGLYLWEVFYPESKKGI"
FT   gene            143070..143507
FT                   /locus_tag="Exig_0129"
FT   CDS_pept        143070..143507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0129"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: bha:BH0168 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59616"
FT                   /db_xref="GOA:B1YH84"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH84"
FT                   /protein_id="ACB59616.1"
FT                   /translation="MRTTFMAKATDVERKWLLIDAEGKTLGRLSSEVASLLRGKHKPTF
FT                   TPHVDCGDHVILINVEKIVLTGNKLDKKVYYRHSGHPGGLKQTVARDLLANKPERMLEL
FT                   AIKGMLPKGSLGRQMFNKLHVYAGDTHKQEAQQPEVYELRG"
FT   gene            143536..143928
FT                   /locus_tag="Exig_0130"
FT   CDS_pept        143536..143928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0130"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bcl:ABC0184 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59617"
FT                   /db_xref="GOA:B1YH85"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH85"
FT                   /protein_id="ACB59617.1"
FT                   /translation="MADVRYYGTGRRKHAAARVFLVAGDGKVTVNGRDISEYFGYETLI
FT                   MTAKEPLVLTETEGKYDIMVTVKGGGFTGQAGAIRHGISRALLQADPDFRGTLKAKGFL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
FT   gene            complement(144022..144312)
FT                   /locus_tag="Exig_0131"
FT   CDS_pept        complement(144022..144312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59618"
FT                   /db_xref="GOA:B1YH86"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH86"
FT                   /protein_id="ACB59618.1"
FT                   /translation="MKKLLVFASVIAVLLHIGYAIYFYAGHEANIAYQPALPENSTVLS
FT                   QETSFTGAVGSQTANDPLAFLQHLFLRSIPLTFIALTALLFLIRTIRRRTF"
FT   gene            144414..145046
FT                   /locus_tag="Exig_0132"
FT   CDS_pept        144414..145046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0132"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   peptidase M15B and M15C DD-carboxypeptidase VanY/endolysin;
FT                   KEGG: lin:lin0128 L-alanoyl-D-glutamate peptidase
FT                   [bacteriophage A500 from Listeria]"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59619"
FT                   /db_xref="GOA:B1YH87"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH87"
FT                   /protein_id="ACB59619.1"
FT                   /translation="MTVSVSWLLERANRKLNVPGLSPEVARKTRQVIRELHVRGIYVGV
FT                   AQGFRSYAEQEKLYAQGRTTPGAIVTNARGGQSNHNRGIAVDLFQYSMDGTEAIFNTDE
FT                   NFQQIVHAMKRQGFSWGGDWSGFKDYPHFELNKTTTDVLVPYLGNPLYKGAVNMNSRDI
FT                   ERIQRAVKATVTKRFDAETAEKVRAYQKRQGLTVDGVVGPATWNRMF"
FT   gene            145230..146261
FT                   /locus_tag="Exig_0133"
FT   CDS_pept        145230..146261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0133"
FT                   /product="ATP-binding Mrp protein"
FT                   /note="KEGG: bcl:ABC0195 ATP-binding Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59620"
FT                   /db_xref="GOA:B1YH88"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH88"
FT                   /protein_id="ACB59620.1"
FT                   /translation="MLNEQEIREVVGQMIDPTIERSLTDTNGIRDVRIKGDYVSLKIAL
FT                   AQAGSGEQLALQQQIVKELKEKGFKTVGLRFEALGDHGIQAATTPSILKPESGTTFIAI
FT                   ASGKGGVGKSTVSVNLAVALARAGKKVGLIDADIYGFSVPDMMGIETRPTVVNDRIVPP
FT                   ERFGVKVISMGFFVEDNAPVIWRGPMLGKMLNNFFSDVEWGDLDYLLLDLPPGTGDVAL
FT                   DIHSMLPSCQELIVTTPHATAAFVAARAGAMAIKTNHRLLGIIENMAYFESKVTGEKEY
FT                   VFGSGGGEKLSEALKTDILAKIPLGQPYANDTDFAPSIYRDDHPFETHYNELAARVIEK
FT                   VEG"
FT   gene            146265..146870
FT                   /locus_tag="Exig_0134"
FT   CDS_pept        146265..146870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0134"
FT                   /product="activation of the KinB signalling pathway of
FT                   sporulation"
FT                   /note="KEGG: bha:BH0242 activation of the KinB signalling
FT                   pathway of sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59621"
FT                   /db_xref="GOA:B1YH89"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH89"
FT                   /protein_id="ACB59621.1"
FT                   /translation="MKTRGFLKLFWMTLLIGTLAGFVFNLVAEPGYVRNQSISGYVTAL
FT                   AYSSTWTAISLMGFFSYLILHRVGLDIFRGAKLWDRVQIVLIAFALFDGIYLRGLAFGF
FT                   EKTNLYIGEMVVLLIIAFFVARTKARETNFTAFVPTLFLMTVITLIEWVPALQATQDKR
FT                   MLWAALATLLVCNAYQILMLHRLQEKPNSANAASGKRA"
FT   sig_peptide     146265..146351
FT                   /locus_tag="Exig_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            147219..148773
FT                   /locus_tag="Exig_R0042"
FT   rRNA            147219..148773
FT                   /locus_tag="Exig_R0042"
FT                   /product="16S ribosomal RNA"
FT   gene            148856..148932
FT                   /locus_tag="Exig_R0043"
FT                   /note="tRNA-Ile2"
FT   tRNA            148856..148932
FT                   /locus_tag="Exig_R0043"
FT                   /product="tRNA-Ile"
FT   gene            148951..149023
FT                   /locus_tag="Exig_R0044"
FT                   /note="tRNA-Ala3"
FT   tRNA            148951..149023
FT                   /locus_tag="Exig_R0044"
FT                   /product="tRNA-Ala"
FT   gene            149155..152049
FT                   /locus_tag="Exig_R0045"
FT   rRNA            149155..152049
FT                   /locus_tag="Exig_R0045"
FT                   /product="23S ribosomal RNA"
FT   gene            152105..152219
FT                   /locus_tag="Exig_R0046"
FT   rRNA            152105..152219
FT                   /locus_tag="Exig_R0046"
FT                   /product="5S ribosomal RNA"
FT   gene            152236..152310
FT                   /locus_tag="Exig_R0047"
FT                   /note="tRNA-Asn1"
FT   tRNA            152236..152310
FT                   /locus_tag="Exig_R0047"
FT                   /product="tRNA-Asn"
FT   gene            152313..152387
FT                   /locus_tag="Exig_R0048"
FT                   /note="tRNA-Glu2"
FT   tRNA            152313..152387
FT                   /locus_tag="Exig_R0048"
FT                   /product="tRNA-Glu"
FT   gene            152400..152472
FT                   /locus_tag="Exig_R0049"
FT                   /note="tRNA-Thr3"
FT   tRNA            152400..152472
FT                   /locus_tag="Exig_R0049"
FT                   /product="tRNA-Thr"
FT   gene            152507..152590
FT                   /locus_tag="Exig_R0050"
FT                   /note="tRNA-Tyr1"
FT   tRNA            152507..152590
FT                   /locus_tag="Exig_R0050"
FT                   /product="tRNA-Tyr"
FT   gene            152595..152667
FT                   /locus_tag="Exig_R0051"
FT                   /note="tRNA-Lys2"
FT   tRNA            152595..152667
FT                   /locus_tag="Exig_R0051"
FT                   /product="tRNA-Lys"
FT   gene            152674..152745
FT                   /locus_tag="Exig_R0052"
FT                   /note="tRNA-Gly2"
FT   tRNA            152674..152745
FT                   /locus_tag="Exig_R0052"
FT                   /product="tRNA-Gly"
FT   gene            152759..152834
FT                   /locus_tag="Exig_R0053"
FT                   /note="tRNA-Ala4"
FT   tRNA            152759..152834
FT                   /locus_tag="Exig_R0053"
FT                   /product="tRNA-Ala"
FT   gene            153056..153964
FT                   /locus_tag="Exig_0135"
FT   CDS_pept        153056..153964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0135"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: gka:GK0149
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59622"
FT                   /db_xref="GOA:B1YH90"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH90"
FT                   /protein_id="ACB59622.1"
FT                   /translation="MNIAYISVPYRYGQGKPGTEQGPAAVEQAGLLETLAANGQEAVRY
FT                   GEAAVLSEDAVREEDPQLKRLEGVVHTTNDLHLLVREALTEQRFPLLVGGDHSMAIGTI
FT                   AGMRQVVPRLGVIWFDAHGDLNTPETSPSGNIHGMPLAVALGEGHQRLTEIGGDGVKLQ
FT                   PEHLVFIGLRDVDAGEQELIDRLGIRVYDMEAIRTRGMDAIMKEAVAYLKETTDAFYLS
FT                   FDMDGLDPSLVEGTGTRVADGIMLDDAKTVLRHCAEQDEFIAAEFVEVNPLLEEGNGTA
FT                   ILANDLIGNLLQYMRTHRLVK"
FT   gene            154091..154654
FT                   /locus_tag="Exig_0136"
FT   CDS_pept        154091..154654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0136"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-W factor; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bld:BLi00199 RNA polymerase
FT                   sigma factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59623"
FT                   /db_xref="GOA:B1YH91"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH91"
FT                   /protein_id="ACB59623.1"
FT                   /translation="MEETTLRLIERVKQGDRDAFAALVDLYKEGAFLVAFRVLRDRMEA
FT                   EDATQEAFIRVFTKIESYNAQWKFRTWLYRIVTNVSIDRLRKKRPDYSLDAEMSGTEGL
FT                   TLYSQLESKDQLPEDQVIDSEQRQDVGEAIAGLPEKYRIPLVLKYVEDLSLKEISEMID
FT                   LPVATVKTRIHRGREALKKHFGKR"
FT   gene            154676..155290
FT                   /locus_tag="Exig_0137"
FT   CDS_pept        154676..155290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0137"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: bld:BLi00200 YbbM"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59624"
FT                   /db_xref="GOA:B1YH92"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH92"
FT                   /protein_id="ACB59624.1"
FT                   /translation="MTREKVYERIQDYLDQNQPPEDFKRLEAELREANAMDEFEEYRLL
FT                   DAELRALSAPKLSADFTSRVLAQLPEQVEQPNVTPLRKTSRFGGKMKQYPLLAAASIFM
FT                   LLSVGSLGGYLTQEEHDLSYTNVPGIVAENGEVVVPEGVTVNQDLYVEGGNVRIEGKVN
FT                   GDVMTVDGKAYTASAGNVTGEIKQIDQLFERVWYGIKRIFE"
FT   gene            155371..156231
FT                   /locus_tag="Exig_0138"
FT   CDS_pept        155371..156231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0138"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   bha:BH0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59625"
FT                   /db_xref="GOA:B1YH93"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH93"
FT                   /protein_id="ACB59625.1"
FT                   /translation="MNYFNWQPLQFQLLKLGENVHWYDYINDVIDIAVVTFVIYRLMII
FT                   VKGTKAVQLIKGISVILISWFLSGFFGLKTLQFLLNQIITYGLLGIIIIFQPELRRGLE
FT                   HLGRTSKFFSRSAISDEDEQVRIVDALVTSAQYMSKRRIGALVTIERETGLSEYVETGI
FT                   PLGSQITSQLLINLFIPNTPLHDGAVIVQQGKLAAAACYLPLSESAHISKDLGTRHRAA
FT                   IGVSEVTDSVTLVVSEETGGVSLAINGRLYRELDEESLRTKLLETIVKAEPTNTSFLNW
FT                   MGAKK"
FT   gene            156231..157517
FT                   /locus_tag="Exig_0139"
FT   CDS_pept        156231..157517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0139"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: gtn:GTNG_0150
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59626"
FT                   /db_xref="GOA:B1YH94"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH94"
FT                   /protein_id="ACB59626.1"
FT                   /translation="MFEKWFNERWFLRIVAVLLAVMLYLMVAGTNSTVKSDAASLLPIA
FT                   GQGSAKFDVPVSVNYDETQWVAYNIPETIETTVKGPSSSLTMLRLVKDFGLSIDLTGLD
FT                   PGYHRVRLSADGFGKDVEVTPKQETIEVFLDKKVTKEVPVQVALLNKNKIAEGYVVGEA
FT                   QPTQQTVSVTGGAEKLQAITAIQVPIDVTGRAETFTESFNVKATDANGNAISATYDPEQ
FT                   LEVTVPVYKESKTVPINVETKDAVKKGYKVVKIVPVTTEARLYGTKEELSRIGSVSTEA
FT                   VSLKGLTKTVDRTIKLIEPNNVTAMEPTSVTVSIVVEKENAKATTETVEDRAEKTISGV
FT                   TVTLNGFDESKYTIDYEQTIDLVVRGSEADLASIDATDIKAVIDVTGLKEGTHGLPISY
FT                   QTSKAFDVLRPDNMDITLKAVPRTSVQAN"
FT   sig_peptide     156231..156314
FT                   /locus_tag="Exig_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.189 at
FT                   residue 28"
FT   gene            157547..158902
FT                   /locus_tag="Exig_0140"
FT   CDS_pept        157547..158902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0140"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: gtn:GTNG_0151 phosphoglucosamine mutase;
FT                   TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59627"
FT                   /db_xref="GOA:B1YH95"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YH95"
FT                   /protein_id="ACB59627.1"
FT                   /translation="MGKYFGTDGVRGVANVELTPELAYRLGRTGGYVLTKHESTRPKVL
FT                   IGRDTRVSGQMLENALIAGLLSIGAEVMRLGVISTPGVAYLTKTMDATAGVMISASHNP
FT                   VEDNGIKFFGSDGFKLDDATELEIEGLLDEAEDTLPRPSGKELGFVHDYYEGAQKYLHM
FT                   LRQTSDEDFSGIHVAIDGAHGATSSLAPRLFGDLEAEVSTIGTTPNGLNINEGVGSTHP
FT                   EHLADFVLEKGADVGLSFDGDGDRLIAIDENGKIVDGDKIMFICGKYLNEIGRLKDNTI
FT                   VATVMSNLGFHKTVAEHGMTALQTAVGDRYVVEEMRKNNYTLGGEQSGHIIFMDYSTTG
FT                   DGMLSGVQLLQIMKATGKKLSELAAEMPVFPQRLVNIRVSDKNGAMNGPAVQAIIAEVE
FT                   AEMAGNGRILVRASGTEPLVRVMAEAPTQEACDMYVERIANVVRENYALQEN"
FT   misc_binding    159274..159433
FT                   /bound_moiety="glucosamine-6-phosphate"
FT                   /note="glmS glucosamine-6-phosphate activated ribozyme aspr
FT                   edicted by Rfam (RF00234), score 83.40"
FT   gene            159492..161288
FT                   /locus_tag="Exig_0141"
FT   CDS_pept        159492..161288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0141"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   gtn:GTNG_0152 glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59628"
FT                   /db_xref="GOA:B1YH96"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH96"
FT                   /protein_id="ACB59628.1"
FT                   /translation="MCGIVGMIGQVNTKEILLKGLEKLEYRGYDSAGLAFVNDGVQVHK
FT                   EVGRIAALREVVPAEADGLVGIGHTRWATHGVPSVPNAHPHQSASSRFTLVHNGVIEND
FT                   EQLKAELNVDLLSDTDTEVIVQMIEKNFAETNDVVEAFRQTLRVLHGSYALALIDAENP
FT                   DVLYVAKNKSPLLVGLGDGTFNVVASDAMAMLQVTDQFVELHDGEMIILTRDSVTIQDL
FT                   DGNVKEREAYTAEIDASDIEKGTYAHYMLKEMDEQPAVIRNIVQKYQNESGEITLDQSV
FT                   RDLVLGRDRVYIIGCGTSYHAGLIGKQLIEQIAGIPTEVHISSEFGYNMPLLTEKPLFL
FT                   FLSQSGETADSRAVLVEAKKLGHPALTITNVAGSTLSREANATLLLHAGPEIAVASTKA
FT                   YTAQIAVLAVLAFDLAQAKGVDVNFDLMKELGKISSAMESVMSQKERFQEIASEYLSES
FT                   RNAFFIGRGQDAYVGMEGALKLKEISYIQAEGYAGGELKHGPIALIEDNTPVIALVTQP
FT                   HVHLNNRGNVKEVVARGANACVIAAEGLELPTDAFVIPAVEPLLSPLLSVLPLQLISYY
FT                   AALGRDCDVDKPRNLAKSVTVE"
FT   gene            complement(161423..162685)
FT                   /locus_tag="Exig_0142"
FT   CDS_pept        complement(161423..162685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_012450 viral A-type inclusion
FT                   protein, putative Pfam: LRR_1 P4Ha_N HALZ bZIP_1 DUF904
FT                   EzrA DUF465 PLU-1 Baculo_PEP_C HR1 Not3 Alpha-2-MRAP_C
FT                   Myosin_tail_1 Microtub_assoc DegQ DUF1409 PspA_IM30
FT                   Tropomyosin TBPIP SspO PMC2NT Filament Laminin_I DUF827
FT                   TPR_MLP1_2 Prefoldin_2 Troponin Mod_r Vicilin_N
FT                   Apolipoprotein ATG16 Snf7 MbeD_MobD Spectrin Osmo_CC DUF837
FT                   IF2_N Rab5-bind Herpes_BLRF2 PROSITE: ASN_RICH GLU_RICH
FT                   LYS_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59629"
FT                   /db_xref="GOA:B1YH97"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH97"
FT                   /protein_id="ACB59629.1"
FT                   /translation="MDNALGIIAVIIILLLFSYLLFRKFSRHDAVTDSVLPPIPAKTDV
FT                   PELHADELPWEIESYFLTDMTSYRHSESLTVTQRLKDQVGNIIKLSPHAKNLIQKEQRV
FT                   IIKFSEEALAKLASGELRIMKAKGSVDQFRALAVDHQHKIRHHAKFEIQDIKKINPAQL
FT                   ANLALGVATMVTAQEHLDRINQQLTSLNRKIDILIRQSKNDKAGIIKGHIKYLLSILPS
FT                   IPDEEERYSVKLEDMAVISYQELESILPELDFLIRSANDIEEKTTFKLDKTVDEIKELA
FT                   ASFEQTILIGYGNLEVMSICLKIMNDWNQDSQTNATRLSDIEKYHQQITEYHHKFEKIL
FT                   SDKHVSIDATFRRNKTITSKKEDIDKQLTYHQEKIRSSKSIITDHIIQLKGQDYDSIPE
FT                   PVDLSVDFDETGDIHTIHRLK"
FT   gene            162805..163377
FT                   /locus_tag="Exig_0143"
FT   CDS_pept        162805..163377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59630"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH98"
FT                   /protein_id="ACB59630.1"
FT                   /translation="MNRKWNWAAAFPQSCTDDVRVVARLLPRRLFGTVTWGTIEVTFYG
FT                   EPLILPYRLYLNEVKEEKIQTLTDRQRWILYCMYTRHHDGYIREKHVRRLEQEQAKTDW
FT                   VLLYLIELTGEYVREILERIEPMLQIWSEEQLRTFAAANKRYLQRIERRIISYWDLHQR
FT                   RDYPVLWNSDYVGFRIAQYYWSSRAHS"
FT   gene            163439..164038
FT                   /locus_tag="Exig_0144"
FT   CDS_pept        163439..164038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0144"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   lin:lin1944 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59631"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YH99"
FT                   /protein_id="ACB59631.1"
FT                   /translation="MRILVVGASGTVGQAVVAQLSERHEIIRAGRTGMDVQVDIMSEDS
FT                   IRSMYETVGPVDAVISATGGAHFGPLTNLTPALNQIGIDSKLKGQVNLVLLGLDAVRDG
FT                   GSFTLTTGIMMDDPIRQGASAALANGGVKAFVHAAAIEMPRGIRINSVSPNVLIESLDK
FT                   YGPFFRGFEAVPASRVATAFEKSVEGAQTGQNYEVY"
FT   sig_peptide     163439..163495
FT                   /locus_tag="Exig_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.751) with cleavage site probability 0.660 at
FT                   residue 19"
FT   gene            complement(164084..164266)
FT                   /locus_tag="Exig_0145"
FT   CDS_pept        complement(164084..164266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59632"
FT                   /db_xref="GOA:B1YHA0"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA0"
FT                   /protein_id="ACB59632.1"
FT                   /translation="MELVPLFFVTFIIVLAVNLFLDKMIMNREMTRPVFLKNLLICFLI
FT                   SLVLLNVFYLQSLMS"
FT   gene            164412..164972
FT                   /locus_tag="Exig_0146"
FT   CDS_pept        164412..164972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0146"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bcz:BCZK1466
FT                   isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59633"
FT                   /db_xref="GOA:B1YHA1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA1"
FT                   /protein_id="ACB59633.1"
FT                   /translation="MRQAVLVIDFQQDLVEGTAEEAGVHAKENMIQVINQVVQEAENEG
FT                   HVMIFIRDLDVANGQGEGFAVHSSIQIPDQAVTFDKAATNSFHGTPLLDYLKQHRVEHI
FT                   VILGCKTEHCIDTAVRSATVNGFDVTLVADGHTTNGSDVLSAEQMIAHHNQVLHGHYNV
FT                   EHFAIVRPSTETVFEPIHHQYRK"
FT   gene            165261..167582
FT                   /locus_tag="Exig_0147"
FT   CDS_pept        165261..167582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0147"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bha:BH0336 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated helicase Cas3; CRISPR-associated HD
FT                   domain protein; PFAM: helicase domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; DEAD/DEAH
FT                   box helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59634"
FT                   /db_xref="GOA:B1YHA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA2"
FT                   /protein_id="ACB59634.1"
FT                   /translation="MRYIAHVHSTDGKIQEVKTHLLEARGLAENWGKDIGLMHVCGVAG
FT                   LLHDIGKLSDEFQTYIRKATSGEHVRRGEVDHATAGGRLLFEQLKGNRGQLLAEMVANA
FT                   ILSHHGNLQDYYLEEESPFLQRVERKELPSYKMCRERFFQVVIDEQEFNRYVERAVDEL
FT                   YSWILRDGGSTARVSLATKYIFSILLDADRTNTREFEQGITTMTTQVDFEELKRRLETH
FT                   LSTFSQQTEITPINRLRQEMSDACRVFANQPSGVYTLSIPTGGGKTLASLRYALHHATT
FT                   YQKKRIIYVVPFTTIIEQNARVARDVLGTDMILEHHSNVVEIEDASDDVMDIQAKLHLA
FT                   KDNWDAPIIFTTMVQYLNTFYAKGNRNTRRLHHLSEAIIIFDEVQKVPLKCISLFNESV
FT                   KFLKDSLESSVVLCTATQPALEFVKYQLHQDGEMIDALPQVMEAFRRTDLEVVEGEMDT
FT                   ARLAEVVTRQVEEKNSVLVILNTKSVVKKLYETLRQQHPDEEVIHLSTAMCAAHRMDIL
FT                   RTINQRLEQGERIICISTQLIEAGVDVSFACVIRSLAGLDSIAQAAGRCNRHGEVARQT
FT                   VYLVDHIEENLKHLPEIARGKEIVRAILIDFLRDEQSYEGNLLGTVAMTRYFQELYDAS
FT                   EVELDFPIRGTTLTLAPMLFKPRKVPELILSSRHRTVANHFKVIEDMTETVLVPYGEEG
FT                   KRLIASLNGQADWEDLRKWLKQAQQYSINLHAHERKKLEATQGLNVILDGTVLVLSERA
FT                   YDDHYGLNLEQDSLLEDLMM"
FT   gene            167598..168296
FT                   /locus_tag="Exig_0148"
FT   CDS_pept        167598..168296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0148"
FT                   /product="CRISPR-associated protein Cas5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5; KEGG: bha:BH0337
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59635"
FT                   /db_xref="GOA:B1YHA3"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA3"
FT                   /protein_id="ACB59635.1"
FT                   /translation="MRNTIEFKVYGEYALFTDPLTKLGGEKMSYQVPTYQAIKGIVESI
FT                   YWKPTILIVVDAIRIMHPIKMEAKGMRPIEYGGGNSLAHYTYLRDVCYHVRAHFEFNEN
FT                   RPDLVFDRNEGKHYSIMKRSLEAGGRRDIFLGARECQAYVEPIDFDSDDSFYDGADLHF
FT                   GTMVHGFDYPDETGRDELAVRLWNPVMKDGVIAFPRPETCSLVKTVKSMSAKPFDASNM
FT                   TGVVELYEQL"
FT   gene            168311..170176
FT                   /locus_tag="Exig_0149"
FT   CDS_pept        168311..170176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0149"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csd1 family;
FT                   PFAM: CRISPR-associated protein CT1133; KEGG: bha:BH0338
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59636"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA4"
FT                   /protein_id="ACB59636.1"
FT                   /translation="MSVWKQLYDTYEMNLKHVGQFESRWEGQDFTLLPLSHTTQTAHVT
FT                   VTVTLDGDFHSATVIEKGHGNTLIPCTEDSANRAGSVVAPYPLHDKLAYVAGDFLKYGG
FT                   VYKGENAHHAYLSQLKAWVETAPYDPLESIYCYVQKGQLIEDLIQEGIFSATGSGELRW
FT                   TWKEAGDKPPIYGLVTGGLEGTFVRFQVRSTEGVQRQPWRDKAFFDSFITFYGTRPGKE
FT                   GLCFVTGKQERLSSKHTNKIRNSGDKAKLISANDSSGFTFRGRFDKPDEAASISYQASQ
FT                   KAHNALKWLIQRQGRSIDQRVFLIWGNQQPSLPNPLENTLSLAQLFGEKEELISHTVQE
FT                   GALAFSDALLGFKRRLPKQEVNILTLDAATTGRMAILYYRTFDQETYFKRLEQWHTKYP
FT                   WEYIYQDADKKRQVYIGAPSLKDIALMTYGTRGNEKLIKATVERLLSCVIDERRVPMDI
FT                   IRCLTQRASNPVGMDHWEWEKTLSIACGMVNKKEEMTVSLDQEINDRDYLFGRLLALAD
FT                   YLERRALGQDNRATNAIRYMNAFSQNPARTWMTIQSALQPYQAKLGGKVLFINRQIDEI
FT                   GSRLTIEQFTNKPLSGKYLLGFYSQRHELYQKREETFDKEERGEA"
FT   gene            170173..171030
FT                   /locus_tag="Exig_0150"
FT   CDS_pept        170173..171030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0150"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, CT1132 family;
FT                   CRISPR-associated protein, Csd2 family; PFAM:
FT                   CRISPR-associated protein TM1801; KEGG: bcl:ABC3594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59637"
FT                   /db_xref="GOA:B1YHA5"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA5"
FT                   /protein_id="ACB59637.1"
FT                   /translation="MTTLDRKIDFTVILSVTKANPNGDPLNGNRPRQNYDGYGEISDVA
FT                   IKRKIRNRLQDMGESIFVQSNDRNLDGYASLRDRAEANDTIKKLMKTKNASDQVAAEAC
FT                   ATWMDVRAFGQVFAFKGDKAGGVSVGVRGPVSIHTATSVAPIDVTSMQITKSVNSESGK
FT                   ERGSDTMGMKHRVDHGVYVFNGSINTQLAEKTNFTQEDAEKFKLALVSLFENDASSARP
FT                   EGSMEVHKVYWWEHDSKLGRFSSAKVHRAVSVQALTDEPKSFLDYEIKVDALEGFTPEI
FT                   LDGL"
FT   gene            171020..171682
FT                   /locus_tag="Exig_0151"
FT   CDS_pept        171020..171682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0151"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; PFAM:
FT                   protein of unknown function DUF83; KEGG: bcl:ABC3593
FT                   exonuclease, RecB family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59638"
FT                   /db_xref="GOA:B1YHA6"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA6"
FT                   /protein_id="ACB59638.1"
FT                   /translation="MDYKRYDDTYLLLSGIQHFQFCPRQWTLIHIEQQWVENVRTIEGQ
FT                   ALHQKADDPFQREKRKEKLIVRGMAIKSEQLNISGQCDVVEFIEDASGVPIHGTPGTFI
FT                   PVPVEYKRGKPKVNPADELQLAAQAMCLEEMLLCAVPIGYLYYHETKHRHPIPITKELR
FT                   DLVLATVTKMNDYYSRRHTPRAKIGPHCKSCSLQEICLPRLTERESVADYMNRRLWE"
FT   gene            171679..172710
FT                   /locus_tag="Exig_0152"
FT   CDS_pept        171679..172710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0152"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: bha:BH0341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59639"
FT                   /db_xref="GOA:B1YHA7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA7"
FT                   /protein_id="ACB59639.1"
FT                   /translation="MKKLLNTLFINQSDSYLALDGGNVLVKADGQVLGRVPLHNLEGIV
FT                   AFGYTGASPALMGHCAENGIALTFMTKNGRFLARVIGESRGNVVLRKTQYRRSDDEVAS
FT                   ARLAKNFILGKLYNQKWMLERMTRDYPLRLDVERFKTTSQDMTETMREIQVCENLERLR
FT                   GLEGTIAVRYNRLFDSMILQQKEDFHFKGRTRRPPLDRVNAMLSFAYSLLARDVSAALE
FT                   AVGLDAYVGFLHRERPGRASLALDVMEELRGIYADRFVLSLINKKVIQGKDFLQKENGA
FT                   VIMTEEGRKTFLTAWQKKKQETIQHPYLKEKMMWGLVPYEQALLLARHLRDDLEAYPPF
FT                   LYK"
FT   gene            172724..173014
FT                   /locus_tag="Exig_0153"
FT   CDS_pept        172724..173014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0153"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: bha:BH0342
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59640"
FT                   /db_xref="GOA:B1YHA8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA8"
FT                   /protein_id="ACB59640.1"
FT                   /translation="MLVLITYDVNTVSPGGKKRLRHVAKLCQRYGQRVQNSVFECIVDQ
FT                   TEFMLLKLRLKEIINHERDSLRFYKLGNQYISKVEHYGIKSSLDVEGPLIF"
FT   repeat_region   complement(173195..174149)
FT                   /rpt_unit_range=173195..173227
FT                   /note="CRISPRs"
FT   gene            174418..175410
FT                   /locus_tag="Exig_0154"
FT   CDS_pept        174418..175410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0154"
FT                   /product="putative deoxyribodipyrimidine photolyase"
FT                   /note="KEGG: rba:RB9278 probable deoxyribodipyrimidine
FT                   photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59641"
FT                   /db_xref="GOA:B1YHA9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHA9"
FT                   /protein_id="ACB59641.1"
FT                   /translation="MEQQKRIGIIGGGLAGVFAARQLMTEGYAVEIIEKSQSVGGRMAT
FT                   RRIDEGTADHGAVFFTVRTDELAQEVDEWLEQGLVRKWFGDDFPRYVAVNGMNQLVQSI
FT                   ARGIPVHLNEQVERILAEGPALQTTAAAETRTYDAILLTAPVPQAYDLLSASPLMLVES
FT                   DHAHLGKVTFEPTFVGLFELEKSPDLGEIGLLDDGLVSGMLKIVNNAQKEVSATPLLSV
FT                   YMTGDWSEVWYDKGEDETLAEIERLLQEQLGPVQLVSKQLKRWRYAQARDVFRTPYLKL
FT                   EQHPLWLAGDAFLDPKDTSGRTRVESAVISGLRVASAMDTHFKAVLTEQ"
FT   gene            complement(175457..175804)
FT                   /locus_tag="Exig_0155"
FT   CDS_pept        complement(175457..175804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0155"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   mta:Moth_0373 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59642"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB0"
FT                   /protein_id="ACB59642.1"
FT                   /translation="MNPASTTDSPLSQRTACPVTRAQTIMAGKWKIVLLWHLSTGTKRF
FT                   HELEQLLPGISKGILTRQLRELEADSMINRRVYREIPPKVEYSLTEIGHSFLPILDQMA
FT                   AWSNQHFPPES"
FT   gene            175930..176787
FT                   /locus_tag="Exig_0156"
FT   CDS_pept        175930..176787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0156"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: 3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   TrkA-N domain protein; dTDP-4-dehydrorhamnose reductase;
FT                   NmrA family protein; KEGG: bld:BLi00243 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59643"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB1"
FT                   /protein_id="ACB59643.1"
FT                   /translation="MKLLVTGATGKLGTKIVEHLLTKIEAENVIVSVRDPKKANELASR
FT                   GIEVRHGDFDEPDTLQQAFAGVDRLLIISTDGEEATRIRQHTAAVEAAKAAGVGLIAYT
FT                   SIANAEASQNFLARTHQVTEQLIRETGIPFLFFRNNWYLENEQSTIDAVRAGQDWLTSA
FT                   GNGTVGWALQEDYAEAIATVLVDPKPTKSIYELSGPLHTQQDIAEALGQVLGRPVQVKQ
FT                   VDSATYTAIMQQAGVPEFLLPMLQAIQEGIAAGTLAVESQDFEHILDRPPVSLEDGLRQ
FT                   LVQR"
FT   gene            176861..177712
FT                   /locus_tag="Exig_0157"
FT   CDS_pept        176861..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0157"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bth:BT_0778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59644"
FT                   /db_xref="GOA:B1YHB2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB2"
FT                   /protein_id="ACB59644.1"
FT                   /translation="MDIKKYRVTPGESIHLSDYPTSDENRIAEDELLDQHIPKSVEELK
FT                   ELHWRLHAEEKNGVLVILQAIDAGGKDEAISYIFSNLNAQGLRTLSVKKPSDTEKKHDY
FT                   LWRIHEGLPEKGEVGILNRSYYEEVIAPRIHDLLEEEEVPDDQDVWKMRYRQINDFERY
FT                   LVENGFRVVKFLFNVSKDEQKKRLLERIKDPKKNFEFSFSDVEEREHWDEYQDIFAELV
FT                   SHTSTEHAPWHVLPADDEWFTRYIVTEVMNDVLREIDPQYPKLTDEDQEKLDEAIKKLE
FT                   NE"
FT   gene            177862..178200
FT                   /locus_tag="Exig_0158"
FT   CDS_pept        177862..178200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0158"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein; KEGG: bcz:pE33L466_0444
FT                   alkylphosphonate uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59645"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB3"
FT                   /protein_id="ACB59645.1"
FT                   /translation="MNEYPNCPKCGSAYTYEDGNVFVCPECAHEWTAADAEVAEEATVI
FT                   RDANGNVLNDGDTITVIKDLKVKGTSLVVKQGTRVKGIRLVDGDHDIDCKIDGLGAMKL
FT                   KSEFVKKI"
FT   gene            178339..178764
FT                   /locus_tag="Exig_0159"
FT   CDS_pept        178339..178764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0159"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1775 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59646"
FT                   /db_xref="GOA:B1YHB4"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB4"
FT                   /protein_id="ACB59646.1"
FT                   /translation="MRGILFAISGGFFLTLQSVANARISNGIGTWQAATLTQMTGFVVA
FT                   LLITLILRDRTFRQMKDVKVLYLSGGALAAAVLFSNMTAVHLMGVTLTISLFLIAQLGL
FT                   ALVIDWNGWFGMIKRRLQLPQVIGILMMIGGVLILKW"
FT   sig_peptide     178339..178407
FT                   /locus_tag="Exig_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.725 at
FT                   residue 23"
FT   gene            178777..179445
FT                   /locus_tag="Exig_0160"
FT   CDS_pept        178777..179445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0160"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: bpu:BPUM_1774
FT                   possible Crp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59647"
FT                   /db_xref="GOA:B1YHB5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB5"
FT                   /protein_id="ACB59647.1"
FT                   /translation="MEQAQLDEYLDRFQLTDVFAGGLREHLQPVAFQAGDWLCRQGDAA
FT                   DRMYLLLEGKLKITHMSATGKRLVLSFKHPFDLVGDIEYVRRTPLMNTVEAVTPVKAVS
FT                   ISYAALEQKGADNPALLRFLLETITMKFELKSHSMSFNLLYPVEVRLASYLLSMTPETP
FT                   TLPVSDLVDAADLIGTSYRHLNRVLRQFSQDNLIERTNRTITIIDREGLTERVGESIYE
FT                   "
FT   gene            179458..179928
FT                   /locus_tag="Exig_0161"
FT   CDS_pept        179458..179928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0161"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1773 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59648"
FT                   /db_xref="GOA:B1YHB6"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB6"
FT                   /protein_id="ACB59648.1"
FT                   /translation="MTLGIVLALFGGMMVCIQNTFNAKVKEQVGAWATTTLVLGLGFLA
FT                   SLTIGLLVEGGGLFSTSGMQPWFWFSGIIGVGVVLCVTQGVQQLGPSYAISIVMVSQIL
FT                   FALLWDTLGWFGLDQVAFTWTKAVGVVLIGGGVLLFQLGGKLTERRMLRKGA"
FT   gene            179932..180645
FT                   /locus_tag="Exig_0162"
FT   CDS_pept        179932..180645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0162"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bld:BLi00219 YfnB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59649"
FT                   /db_xref="GOA:B1YHB7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB7"
FT                   /protein_id="ACB59649.1"
FT                   /translation="MNYTTLLFDIDHTLLDFDATERAALRQLFEDEQLEWTEEREARYR
FT                   TINRSLWQALERGEITRQEVITSRFVTFFAEQGRTVDGSRMDTRYRAYLSQGTELIAGA
FT                   IELLDSLKEKYQLYVVTNGVAATQRARLKGSGLAPYFDGIFVSEETGYQKPMPAFFDYV
FT                   FDRIPNVRRDQTIIIGDSLTADIQGGILAGIATCWFNPTHAAAPAELMPTYTINQLNQL
FT                   VTLLGTKEVVWTTSK"
FT   gene            180804..181244
FT                   /locus_tag="Exig_0163"
FT   CDS_pept        180804..181244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0163"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hau:Haur_2347 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59650"
FT                   /db_xref="GOA:B1YHB8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB8"
FT                   /protein_id="ACB59650.1"
FT                   /translation="MQIELRPVTNENWEACCALELTAEQQGFIEPNVYSIAQAGFEPAL
FT                   VMRAIYAADELTGFLMYNSEREELDGYWIYRLMVDHRHQGAGIGREAVRLLLAEMQQLP
FT                   QAACIVVGYHPDNHVAHQLYGRLGFIDYGDRFGKEMAVRYTF"
FT   gene            181349..181894
FT                   /locus_tag="Exig_0164"
FT   CDS_pept        181349..181894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0164"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-70 factor, TIGR02954 family;
FT                   PFAM: sigma-70 region 2 domain protein; sigma-70 region 4
FT                   domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bld:BLi04171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59651"
FT                   /db_xref="GOA:B1YHB9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014300"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHB9"
FT                   /protein_id="ACB59651.1"
FT                   /translation="MDLRTKHTELVRRAIKQDEAAFEQLILLHNEQLYRTAYVYVKNEQ
FT                   DALDVVQETVYKAFISIGQVKEPKYFVTWLTKILIRNCYRVLNQQTAVADLIEQIPVKE
FT                   SSREEHLDLIDALSHLRKEYRDVLVLFYFHDVPMKEIASFIGITLNTVKTYLRRGREEL
FT                   KKQLGGLDYVEARSSKGV"
FT   gene            181863..183224
FT                   /locus_tag="Exig_0165"
FT   CDS_pept        181863..183224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi04170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59652"
FT                   /db_xref="GOA:B1YHC0"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC0"
FT                   /protein_id="ACB59652.1"
FT                   /translation="MSKHDLQKEYDQIPVPQAALQERIRQGIKQGKREQQIKRPKRLRR
FT                   LVVSTGLAASLLITSTFVIPSFATAMAKVPLLGQMYRPFLEQENTGTAIGQKQLATTIH
FT                   QVASDQGIDIQVIDAYYDGATIGMNLIATVVPDVKPEIRSGLYELFKGDQRFAGTETKE
FT                   VVQFKQVKGIWQARIEYTLGEIKLQDKIQIPVVLTDVFGVHGNWTFNVPVKRLPVTEQV
FT                   YGTTVKNPIYRTDITLNRLIQGKGSTSFDYTTRSPKKERARVEMTLLDQFGKEIIRNWT
FT                   WSTQSVKRTKTATEAVEQSRLILGNYVIPKGSYLLQPSLRIDLKTQPIPLTKPLPYREQ
FT                   SETHPLKMEITSIETTSEQVVVEFSTNSRSSQFDTKLDIRNSMYLLKGTEPPDGREIKA
FT                   KVTVLDADKQTFRATFQLPEPSEHTREEYYLETGYSNTLVNTPLELQPIPFTVD"
FT   gene            183288..183767
FT                   /locus_tag="Exig_0166"
FT   CDS_pept        183288..183767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0166"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH0433 phosphinothricin N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59653"
FT                   /db_xref="GOA:B1YHC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC1"
FT                   /protein_id="ACB59653.1"
FT                   /translation="MNVRAMTATDYPEVGRIYQQGIETQNATFRTEVPPFDYWDAHHHK
FT                   HSRLVAEEDGKLLGWVAISPFSSIPAYRGVAEVSLYIDEKLRGKGVGTALMQAVIEASE
FT                   AAGIWTLHSQIFPENTASLKLHQRFGFREVGRRERIGQLAGVWRDTILLERRSRI"
FT   gene            complement(183822..184379)
FT                   /locus_tag="Exig_0167"
FT   CDS_pept        complement(183822..184379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59654"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC2"
FT                   /protein_id="ACB59654.1"
FT                   /translation="MRKFWMICLLTAFSLSGCLAPQKETVTVTPLKLKAGEQAFAAIND
FT                   QEIAAFHLKGKLKKPYLLKGIEYLPNHKERTLFYMEIPAKTYDSTLRIVQSSSSKSVRF
FT                   GANLDGGSFRAHEDLKIKPDAVNTQNPSSEFTLTDYNVLFLRQLSADGKLSSNPFNDIQ
FT                   GPENVTVKKGEQVFAFVLTKQN"
FT   sig_peptide     complement(184308..184379)
FT                   /locus_tag="Exig_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.722 at
FT                   residue 24"
FT   gene            complement(184457..185059)
FT                   /locus_tag="Exig_0168"
FT   CDS_pept        complement(184457..185059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0168"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59655"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC3"
FT                   /protein_id="ACB59655.1"
FT                   /translation="MKKWLYISFAALVLTGCNQEQAQEPATKKAASTAYTSNLNISPVK
FT                   ITEGEEKFAALGNQQIGSVKLKGTLKTTHWLKGVEYLPNKKERTLFTLELEPKKYDTQV
FT                   RFSQSFSDDKIHLGLDVDDTTVQGDDSFKHLDDYMIRGADFRSRASAATPYNLLMVYHM
FT                   TTKNGIRGFNLNEVTRPADVPLKKGERIFGIVLSNQK"
FT   sig_peptide     complement(184991..185059)
FT                   /locus_tag="Exig_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.799 at
FT                   residue 23"
FT   gene            185181..186233
FT                   /locus_tag="Exig_0169"
FT   CDS_pept        185181..186233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0169"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: oih:OB2644
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59656"
FT                   /db_xref="GOA:B1YHC4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC4"
FT                   /protein_id="ACB59656.1"
FT                   /translation="MDDFFGEGLETNEQKRKRKLEEVFDQSFESERRDFNQSLEQEVTV
FT                   ALIGDVNAGKSSTLNAILGREVATVGAKPGETTRIDQIRQHPEDKVVFVDTPGLNDANS
FT                   LNSDTTWKFYQSADVILYFLNAAGTVLSETETKNFKKIYAHNKNIVIVVTKIDATNDLA
FT                   TILSHIELQLPGPKVVPVSALDGTNIDRLRREVLDILKKFNKDNLFVREIDPALRGKIA
FT                   NNWIVGAGTAAGAIGAVPFPGADIIPLTSIQIGLMLKLSNLYERNLSKESAKELLVVTI
FT                   VGNSGKTAFRQLAKMVPGYGAVIGAGVASTATLALGYGTKYAYENKLELTPESLMGFIK
FT                   KFRKKSDGAK"
FT   gene            186291..186925
FT                   /pseudo
FT                   /locus_tag="Exig_0170"
FT   gene            complement(186928..187941)
FT                   /locus_tag="Exig_0171"
FT   CDS_pept        complement(186928..187941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0171"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cac:CAC2405 predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59657"
FT                   /db_xref="GOA:B1YHC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC5"
FT                   /protein_id="ACB59657.1"
FT                   /translation="MRKSLLFLTSSDVQNPDADFSDYLLHELFKRMTDEYDVTCLTPAF
FT                   FGGRDVESIGGVTYIRRGTSGSFLWHVFCQIRSRPEAFVFLANLPFLEYLFQWGTVPHA
FT                   RFLTRSSKYPMASPSQTSFVFHPSVLTAESAQTDQPFVLLPEGLDLLSPESARLEKEKR
FT                   PTFVYVSRPSQPKELFDACQAFIAVYQEFPEVQLWIIGHCPTRFDSSIPETMRAYLHYL
FT                   GDMEPAARNRYISRATALLVPSREDNWGMIIYEAARVGTPAIVYETPGLCDAVQYGMTG
FT                   YLAKINHPGGLAAEMRSCLLDQTTYQMLRYAAHQFSTTKHHHDLEPHFREWLRTQL"
FT   gene            complement(188050..189576)
FT                   /locus_tag="Exig_0172"
FT   CDS_pept        complement(188050..189576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0172"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   pat:Patl_4183 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59658"
FT                   /db_xref="GOA:B1YHC6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC6"
FT                   /protein_id="ACB59658.1"
FT                   /translation="MKRRNQLMFWISFLVVTLSFIVHGLQRFTDFAEGYQLIRGNVTAA
FT                   SPTTLAWIALLPFVCWIASAVLYRIRPDSIIVALLLTLTLTFSSMSIVAGGNGLVEYHF
FT                   SIFMVLALIAYFRRINLILVSTILFALQHFAGFFFAPSLICGTTGYPFSILMIHAVFLI
FT                   LTSVALIIQIAVQNQERSVSLKRETEATALMTNASHQIEALVGNLKTNTKHLQQAAVQS
FT                   VEATNQIATAIAPIVQSADGQHQSMQHGTDQLHQVNASIASIQAKMAQTVMTTEHMTKR
FT                   ALTGNEEMNLMDRRVEEMVKSTNGLHTSVTAMASRSDKIQKILASLEAIAGQTNLLALN
FT                   AAIEAARAGDAGRGFAVVATEVGHLAVQSRSYANEVTEVLQALIADTDQIKTTAAGYTK
FT                   TLAENQKMTSRVRQTFSDITHLVQEVEQSISSIQTARQGVGVQMLNIEQRMETTRTASL
FT                   EVRHGIESTAVSLEQQTTVQHEFESMTESLSTMTASLEYLVDELTQHMTR"
FT   sig_peptide     complement(189502..189576)
FT                   /locus_tag="Exig_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.933 at
FT                   residue 25"
FT   gene            189782..190627
FT                   /locus_tag="Exig_0173"
FT   CDS_pept        189782..190627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0173"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rba:RB133 predicted
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59659"
FT                   /db_xref="GOA:B1YHC7"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC7"
FT                   /protein_id="ACB59659.1"
FT                   /translation="MKWKGRERSSNVEDRRGMGGKGVAGIGGGLGIIILIVVTLMGGNP
FT                   ADILGGLSDSQGDSQGEYQETAKEKEAADFVSVVLADTEKVWTKEFKQDGMTYKEPTLV
FT                   LYTDQVSSACGQAGKSVGPFYCPGDQKLYIDLSFYDELQNKYGAPGDFAMAYVIAHEVG
FT                   HHVQTLLGTSDEIMPLRQKMSEEKFNKYLVRFELQADYYAGVWANHAQGQNLLEEGDLE
FT                   EALGAANAVGDDTLQKKGQGYVVPESFTHGTSAQRERWFQKGFDNGTIEGGDTFKAKNL
FT                   "
FT   gene            complement(190676..191068)
FT                   /locus_tag="Exig_0174"
FT   CDS_pept        complement(190676..191068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59660"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:3ER7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC8"
FT                   /protein_id="ACB59660.1"
FT                   /translation="MMNTTTLDRYFDLFDASRTDEKAFDDLISLFSDEITFVLNGQEQH
FT                   GIDAWKQFVRMVFTANQDIKHMYAGWVPSETGDTMETRWAVCGKSADGSVFTQDGTDIA
FT                   RLNADGKIVYLANVPDDTAMFNQYND"
FT   gene            complement(191080..191562)
FT                   /locus_tag="Exig_0175"
FT   CDS_pept        complement(191080..191562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0175"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   bsu:BSU37580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59661"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHC9"
FT                   /protein_id="ACB59661.1"
FT                   /translation="MQMKTGVEQSVYAMLLLTFLPEKGVLPGEFISQQLGASPTYFQKL
FT                   LRKLVSADLLISVPGAKGGFRLKASPETIRVFDIYEAIEGKQSLYASSGVFEDLMGIQD
FT                   QNICLLSDLMAEAEQSWQSILKRETIDSIRREIYLNCPPDHLTKLQSLIEEKMIRN"
FT   gene            191774..193504
FT                   /locus_tag="Exig_0176"
FT   CDS_pept        191774..193504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0176"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: oih:OB1047 ABC transporter ATP-binding
FT                   protein; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter transmembrane region; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59662"
FT                   /db_xref="GOA:B1YHD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD0"
FT                   /protein_id="ACB59662.1"
FT                   /translation="MNPLKGIITIPRTIFIQLMLAAVLMGVAVIGQSYLIVIIVDRIFL
FT                   QGDPFAAVMPLLGFLLLMLMLRVGVTYWNGRLGTSLAARVKQDLHQALVAKYTRNSVES
FT                   MLEGQSGQKVSILLDSVDEMDSYYSQYLPKVIQTSIVPLMVLIAAFSYDWVTGLVMMIT
FT                   APFIPLFYIVIGIMTQKRADTQLEKMNAFSGTFLDTLQGLTTLKLFGRAKAQQDVIERS
FT                   SLDFRDATLTVLKLAFLSSLMLEFISMLSMGMIALEVSLRLILFQSLTFVPAFLMLVLA
FT                   PEYYLALKEMGAAFHTGRGSVAAAKQIAAELTDDDRNVAFGRTDLPAARPPRIELKDVA
FT                   FSYRDARFAMEQLNLTIEPYQKVALIGRSGAGKSTVLQLLAGLADPQDGQLLLDGQNRQ
FT                   TVTETSWFSQLSYISQHPYLYAGTLADNIAIGELREASRAAIEQAASDAGLTELIAQLP
FT                   NGLDTVIGEGGRGLSGGEKQRVALARAFLKRPNVILFDEPTTGLDVKTERVLQEAMTVL
FT                   GREATVITVAHRLHTIERSDQIVVLEAGRIVDRGTHEELLGRESEYAMMRAVQRGEETR
FT                   "
FT   sig_peptide     191774..191869
FT                   /locus_tag="Exig_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.609 at
FT                   residue 32"
FT   gene            193501..195219
FT                   /locus_tag="Exig_0177"
FT   CDS_pept        193501..195219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0177"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="KEGG: bha:BH3972 ABC transporter required for
FT                   expression of cytochrome bd (ATP-binding protein); TIGRFAM:
FT                   ABC transporter, CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59663"
FT                   /db_xref="GOA:B1YHD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD1"
FT                   /protein_id="ACB59663.1"
FT                   /translation="MKELMGIFRLMLHQKRDIVLSIIFGVLAGITAVGMFAASGFLISK
FT                   AALLPPIQTLAVLIALQKISSLTRAVSRYAERYYSHRATFTILSDLRTTFYKRLEPLAP
FT                   GIFAKYRSGDLLARIVGDVESLQNTFLRVVYPPIILVLVFLCTIFFVSFFSLSVALVLV
FT                   FGLILTGFIIPGWFAYREQRFARSVRARRGELSTEVTELFQGYRDLKIYQQLGNKEAEL
FT                   NAVAARYVAEEKRNGLHAVSNLALNTLATLVISWIVLGLGAYLVADGQLDGVFLALLVM
FT                   TSLTVFENAAPMAILPGFFEDSRHAARRLDDVVEATAEPEYRPFALTQAPELRAEHVSF
FT                   TFPGQDRPVLRDVSVTFPAGSKTAIVGASGSGKSTLLQLLLRMYPADGIRIEGTPGLEI
FT                   NPEALWQQSNVVLQQNHFFYGTIRDNLKLASSKATDEQMIEALEHVGLSLLELDDRVLE
FT                   KGENLSGGEKQRLAIARIFLRQTPLYLLDEPTSSVDALTEQMILRHLFSRAVDATLLLV
FT                   SHRLAGLETMDQIVVMEQGQVVEVGTYADLMTKQGAFYALKQVEQSVFTPDQLVR"
FT   sig_peptide     193501..193641
FT                   /locus_tag="Exig_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.467 at
FT                   residue 47"
FT   gene            195341..195994
FT                   /locus_tag="Exig_0178"
FT   CDS_pept        195341..195994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_2830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59664"
FT                   /db_xref="InterPro:IPR017018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD2"
FT                   /protein_id="ACB59664.1"
FT                   /translation="MMEILRCETQLEDQTIAYNHYYSDSDEICFMLSGAGYAYDHPYFY
FT                   FSRMMLLKRKVNVIEIQYVSDDLFSMPDEQGDAEMSRRIEAVIGDVLRARSYQTIHFIA
FT                   KSLGTVPLVSMMHRGMFPEARVVLLTPLLKDPAIVEKIANSRHHGLLIIGDQDRQYSPE
FT                   ALERFSNSNLVLELVTGANHSLDIDFDVKPSLQVLGQIMQRIEDVLFTVTVKEN"
FT   gene            complement(196038..196661)
FT                   /locus_tag="Exig_0179"
FT   CDS_pept        complement(196038..196661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0179"
FT                   /product="arylformamidase"
FT                   /note="TIGRFAM: arylformamidase; PFAM: cyclase family
FT                   protein; KEGG: gtn:GTNG_3169 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59665"
FT                   /db_xref="GOA:B1YHD3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR017484"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD3"
FT                   /protein_id="ACB59665.1"
FT                   /translation="MNRWMDVSQPLTSSITTWPGDTKFDYTINWSKADTGSVNVGQVTM
FT                   SLHTGTHIDAPFHFDDVGQKVIDLDPDLYIGHVRVIYLPGRTELVASDLDAFDLTDVRR
FT                   LIIKTDGWVDKSVFPETIPVLTPSLAERLGELGIELIGLDLPSVDAIDSKEMAAHHALA
FT                   AHGVHILEGLVLDTITPGDYHLNAVPLPLVDGDGSPVRALMRPY"
FT   gene            complement(196675..197514)
FT                   /locus_tag="Exig_0180"
FT   CDS_pept        complement(196675..197514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0180"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /note="TIGRFAM: tryptophan 2,3-dioxygenase; PFAM:
FT                   tryptophan 23-dioxygenase; KEGG: gtn:GTNG_3168 tryptophan
FT                   2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59666"
FT                   /db_xref="GOA:B1YHD4"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHD4"
FT                   /protein_id="ACB59666.1"
FT                   /translation="MKQTDATNIEESIQTDFKKDMSYGDYLQLDSLLTSQQRLSDHHDE
FT                   MLFIVIHQTSELWMKLILHEMTAAIQAIADDQLERSFKMLARVSKIQQQLIQSWSVLST
FT                   LTPAEYLEFRDSLGHSSGFQSYQNRQIEFSLGFKNAQMLRVYEHETALFAQLNDDLQTP
FT                   SIYDETVRAMHRRGLPIDEAVLNRDVTQDWEADASVEAAWAIVYQDVEQYWDLYELGEK
FT                   LLDIGSQQQMWRFNHMSTVERIIGQKPGTGGSSGVSYLRRVLDHRFFPELWSVRTKL"
FT   gene            complement(197535..198917)
FT                   /locus_tag="Exig_0181"
FT   CDS_pept        complement(197535..198917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0181"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gtn:GTNG_3167 probable amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59667"
FT                   /db_xref="GOA:B1YHD5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD5"
FT                   /protein_id="ACB59667.1"
FT                   /translation="MKEHPTELRRDLKTRQLTMIAMGCAIGTGLFLGSGLAISLAGPSV
FT                   LVSYAIGAFIVLLLMGCLAEMTVAHPTSGSFGTIAEKYIGPYAGFLVRYSYWVANVLAI
FT                   GVEVSAIAIYMKYWFPDVPGYIWIFVFAAALIYINATTVNTFATFEYWFSVIKISAILM
FT                   FMILGAYLVFGSSSPEIGPQNFTNDGGFMPFGFSGLWIAVFISLFSFLGTELIAVTAGE
FT                   AKDPDVAVPKALKATVFRLSTFYVITIALMLMIVPWQQAGGVDESPFVKVMEMLSIPGA
FT                   AGIMNFIVLTAALSAMNSQLYASTRMMYSLSKATYAPRMFSRLNAKGVPLFALAVSTLG
FT                   IFLAAVISSQSSVSYPFMMGISMFGAIFTWFMIFISHLYFRKAWERDGGRKLPVRMMGY
FT                   PYLTALGALLLFALVITTWFTDFQIVLKFGIPWLIFLTIAYVFWKRNHPPQADQTNRSQ
FT                   SL"
FT   sig_peptide     complement(198792..198917)
FT                   /locus_tag="Exig_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.509 at
FT                   residue 42"
FT   gene            complement(198927..200204)
FT                   /locus_tag="Exig_0182"
FT   CDS_pept        complement(198927..200204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0182"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase; PFAM: aminotransferase class
FT                   V; KEGG: gtn:GTNG_3166 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59668"
FT                   /db_xref="GOA:B1YHD6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHD6"
FT                   /protein_id="ACB59668.1"
FT                   /translation="MTLTAPRKHAIEQDQQDALAPYRNEFYLQEGSIYMDGNSLGLLSK
FT                   RAEATLLESLADWRELGIDGWMKGRHPWFDLSEKLAALNAPLVGGRADEVMVTGSTTVN
FT                   LHQLVATFFAPSGRRTKILADSLTFPSDIYALQSQLRLRGLDPAEHLVQVESRDGRFLD
FT                   EADIIAAMTDDIALIVLPTVLYRSGQILDMERLTREAHARGILIGFDGCHSVGAIPHAF
FT                   HDWGVDFAYWCNYKHLNGGPGTVGGLFVHERHFGTLPGLTGWFGSRKDKQFDMNHTMTP
FT                   AENAAAFQIGTPHVLSLAPQIGALELFAEVGIDAVRAKSLALTDYMMTLVDQELTAYGF
FT                   VIGNPRDAKRRGAHLSLEHPEAARICKALKAHQVIPDFRAPNIVRLAPVALYNSFEDVY
FT                   EVVSILKTIMDEKQYEQFKNEREVVA"
FT   gene            200310..200939
FT                   /locus_tag="Exig_0183"
FT   CDS_pept        200310..200939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0183"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gtn:GTNG_3165
FT                   transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59669"
FT                   /db_xref="GOA:B1YHD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD7"
FT                   /protein_id="ACB59669.1"
FT                   /translation="MTMKSDKFKVDKRHLRTVRTREKLLVAARHVFLENDFQTTTISQI
FT                   IKRAGVGYGTAYVHFEGKDELLIVLMEDVMDRFHQVAEQPFEPGTAEEAQKQIEQQAMA
FT                   FLQLAEQEREMLRVVEQAIGISYVIRTKWKQIRERFIERISCDIRYAQRTGLARPDLNP
FT                   ALVARGWFFANEMYLFEVVREETTASIEEIAKTLTAVYTTGLYEHG"
FT   gene            200985..201437
FT                   /locus_tag="Exig_0184"
FT   CDS_pept        200985..201437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: par:Psyc_2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59670"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD8"
FT                   /protein_id="ACB59670.1"
FT                   /translation="MAFDYDLDFKTTDFRKEPEKYRVGRGEQGVLLVEPYKGEILPHWR
FT                   FKTPEIAKESSEKIYQMYLDYKEAGDFVGMDMARKFIQMGHTRARRYTNYKGGRKYKNK
FT                   ETGELNERKIDPEKAKSAEIFQEKWDLIRADEEYLKLKKAHQKQYG"
FT   gene            201530..201862
FT                   /locus_tag="Exig_0185"
FT   CDS_pept        201530..201862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59671"
FT                   /db_xref="GOA:B1YHD9"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHD9"
FT                   /protein_id="ACB59671.1"
FT                   /translation="MRYTYWAALIGLIISMYLLVDYTVETVPVSILIGLLIYSIGLSIV
FT                   ATFEVSSFELTRRAFVTTLLFGLVLNHVLDLRMTAFLLVLLVVETLVKTLRFLQVLWWD
FT                   RATLHG"
FT   gene            complement(201944..203140)
FT                   /locus_tag="Exig_0186"
FT   CDS_pept        complement(201944..203140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0186"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bha:BH1775 multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59672"
FT                   /db_xref="GOA:B1YHE0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE0"
FT                   /protein_id="ACB59672.1"
FT                   /translation="MQADQRKKLTVLMINMFIAVGSFGIIIPILPAYLASIGQGGTAAG
FT                   LMIAIFAGAQLVMSPVAGKWADQYGRRKMIIYGLIGLTLSMFVFYFSNSVTILYISRAI
FT                   GGFGAALLIPAIFAYVADITTMDQRAKGNSFVSAAMSLGIVIGPGIGGFLAEFDLKLPL
FT                   LVSALVSLLAVLFSVLLLQESDVHDATAMAPDEGSMWKKLGASFHKPYFVPLVITLVMS
FT                   FGLMAYESVLGLFVDNQFGASPKDIAIMVTSTGIISVIAQIFVVDKLSRSLGEGKVLNI
FT                   FLLIATLGFLLSLLTASYGGFFAVTLVIFLATSILRPVLNTMISKLAGNEQGFAMGMNN
FT                   AYMSIGNVLGPTLAGLLYDVNILYPFMLGLVFLAVTLVGSVIWQRRQSRLIKKIEQTS"
FT   gene            complement(203345..204403)
FT                   /locus_tag="Exig_0187"
FT   CDS_pept        complement(203345..204403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0187"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: bpu:BPUM_1246
FT                   possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59673"
FT                   /db_xref="GOA:B1YHE1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE1"
FT                   /protein_id="ACB59673.1"
FT                   /translation="MNPTPKPMTFSYDHWLGNYKVLLIFMVVFGHLIETFRNLEQNDPV
FT                   QMVYNIIYLLHMPAFIFMSGYFFKEVRPKRIISFVVLYFIWQSIHEVYLAYVNEKTVDG
FT                   LIDGLLHPLVPSWTLWYLLGIIIWQIVTPGFLALRYPLLISIAFALLINANPVSITNFL
FT                   SLQKVVSFYPFFLMGYLIKERGWLADGQIRDRLTSPLGRLTGLIISVAIAVAMAVWTKN
FT                   GFDTVWLFYRDTYGEFDVPVLKGALIQLFLYAVSTVMIFSVLMMVPHRSFGERFDQIGI
FT                   QTLAIYLLHSFIVRLFRDFVPPWIAESPVLLIGSSFLLALFFVWILSSRPIVRLFRPLL
FT                   SPNVNWLFKKTP"
FT   gene            complement(204400..206148)
FT                   /locus_tag="Exig_0188"
FT   CDS_pept        complement(204400..206148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0188"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lpl:lp_1819 teichoic acid
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59674"
FT                   /db_xref="GOA:B1YHE2"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE2"
FT                   /protein_id="ACB59674.1"
FT                   /translation="MPTLQAHVNYLELAGTKFRFEARLFGLTDFIQAEQLLFENPAAPE
FT                   DTEETQPDDGYIQSEAPAEPIPLERAVIFRNKRNKRTFILRFPFEGDWTEETFSGELDL
FT                   NHLTPTGRPLPMGYFDAFFAIVQGKSILHEAPFGDTRSLIPVIYRVDTKHSNVLLKLEY
FT                   ELVVQYSEYSNTLGFHSLKQGETKRFIRLIEKFNKSKKNWRKRAFKFRRFTFKSIYNVT
FT                   KWTQPIQDNKVVFASDSRSDVSGNFAYILNEIERRDLNLDVKTFFKPNLQSRRDWRDKF
FT                   TLPYHLATAKTILVDDFYPMIYPLNIRKGSDLVQVWHAVGAFKTFGYSRLGKPGGPSAN
FT                   SLSHRNYTKAIVSSHNVARHYAEGFGLREDQVIATGIPRTDMFFDQTYIAEAKERIYEE
FT                   YPVFKTKKVIMFAPTFRGNGAKSAHYDFSQLDLDALYEAFHEDYVFVLKMHPFVRRRME
FT                   IPEVYADFFLDLTDYREINELLFVSDILITDYSSTCFEFSLLDRPMLFFAYDLEDYISK
FT                   RDFYYDFEEFVPGPIVRTSEELIERIKNEDFEMQNVKAFAEYFFEHQDGKSSQRFVDQI
FT                   ILGEDK"
FT   gene            206474..207187
FT                   /locus_tag="Exig_0189"
FT   CDS_pept        206474..207187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0189"
FT                   /product="D-ribitol-5-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.40"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; KEGG: lin:lin1071 similar to CDP-ribitol
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59675"
FT                   /db_xref="GOA:B1YHE3"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR034709"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE3"
FT                   /protein_id="ACB59675.1"
FT                   /translation="MIYAAILAGGKGTRMGNVDRPKQFLSIGERPIIVHTVEKFLLHED
FT                   FDQIIIVTPTAWINYTRDILEKYIGTDERIVITAGGSDRNESIMAAINWIENKNGLTDE
FT                   DVIVTHDAVRPFLTHRIIKENISTALEYGACDTVISAIDTIVASTDGKTISDIPVRDQM
FT                   YQGQTPQSFQITKLKNHYEALSSDERAILTDACKILLLKGEAVALVTGELFNIKVTTPY
FT                   DLRIANAILKEQIHQ"
FT   gene            207184..208209
FT                   /locus_tag="Exig_0190"
FT   CDS_pept        207184..208209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0190"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: sae:NWMN_0190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59676"
FT                   /db_xref="GOA:B1YHE4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR034710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE4"
FT                   /protein_id="ACB59676.1"
FT                   /translation="MINQVYQLVAPRQIEVTYDERSLNSDRVVVRPTYLSICHADQRYF
FT                   TGSRSAEVLAKKLPMAMIHEGIGKVVHDPSGTFKIGTLVAMVPNTPSETDDIIGENYLR
FT                   TSRFRSSGYDGYMQDYVFIQPDRLVEVPADLDPEVAAFTELVSVSVHAMTRFDQIAHSR
FT                   RETFGVWGDGNLGFITALMLRKLYPEAKLLVFGKTQSKLDYFSFADETYYIDQIPDDVS
FT                   FNHGFECVGGIGSQYAINQMIDYIIPEGTMALLGVSEDPVSVNTRMILEKGLRVYGSSR
FT                   STPADFARTMELYQMYPDIPAYLSNLVSGVFQIRQIEDIHQAFESDLTNRFGKTVMEWC
FT                   M"
FT   gene            208241..209449
FT                   /locus_tag="Exig_0191"
FT   CDS_pept        208241..209449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0191"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lwe:lwe1060 glycosyl
FT                   transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59677"
FT                   /db_xref="GOA:B1YHE5"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE5"
FT                   /protein_id="ACB59677.1"
FT                   /translation="MKQKLRLIQRRTVHYLLVVTYWISKFFPVQTKKVVFATYRSDKLV
FT                   DNFRAVYDELESRELGFQYVFLLKRFPQNLIGQIKYVFHMMRATYELATARYFIIDDYY
FT                   YPVYVSKLRKGTEVIQLWHACGAFKKFGYSVLDKSYSPDDDYLKMVAIHRNYSKVYVSG
FT                   EACIGPFAEAFGMDSTRIHPLGVPRTDQLLNRERQVQIEHKLYDRYPEWRSKKLILLAP
FT                   TFRGNGQTTAHYDQELDFQQFREQLGPDHILLLRMHPFVLNRPVVPAEFSNQIIDMTDY
FT                   PDINDLMQVADILVTDYSSVIFEFALLKKPIILLVNDLNAYREERDFYFPYESFVPGPI
FT                   VSSFNDVISWIKAGQFEPEQIEDFAARFFTYQDGLATKRIVNHILTGALPDAPMRPEER
FT                   KTV"
FT   gene            209412..209630
FT                   /locus_tag="Exig_0192"
FT   CDS_pept        209412..209630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59678"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE6"
FT                   /protein_id="ACB59678.1"
FT                   /translation="MHRCVQKNGRPFDLIEADETKQRWWILNPPPLFVVRNQTSKKASV
FT                   FYDSVWGGNEKKDALTIMMGLDWRGQG"
FT   gene            complement(209651..210208)
FT                   /locus_tag="Exig_0193"
FT   CDS_pept        complement(209651..210208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0193"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bsu:BSU08480
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59679"
FT                   /db_xref="GOA:B1YHE7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE7"
FT                   /protein_id="ACB59679.1"
FT                   /translation="MNTRQLILERRSVRAYTDQPVPNEMIEEILEAAIYAPTHKLREPW
FT                   RFVLVNEESQERYVDQLMTLLAKRGQLDQKTDEQRQMMRQKFADVPVYLTVLYEVKGTE
FT                   DQQMEDLLATAAMIQNVQLLATELGLGCCWKSGKHWFTEEYAEMIGASENERVAGIIQF
FT                   GWPALIPPLKKRTAARDKLTHF"
FT   gene            complement(210298..210834)
FT                   /locus_tag="Exig_0194"
FT   CDS_pept        complement(210298..210834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090038000415 predicted protein Pfam: TRP
FT                   E1_DerP2_DerF2 COX1 DUF221 7TMR-DISM_7TM BofA COPI_assoc"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59680"
FT                   /db_xref="GOA:B1YHE8"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE8"
FT                   /protein_id="ACB59680.1"
FT                   /translation="MVAFLQFYAFIFACCFAWQVGRPSSWSQKVTRAFLISINSLFIFF
FT                   RASVSIFLLIGPLLLVSYVLFPHLLYFAGPLSIIISILVIGLLDRLVSFVILPIIRSFF
FT                   LKKNRMMPQLLEAVLYTFSMGVLLFANLTVVPGVQINIMIAVFFGFTLYFAHYLFALFR
FT                   IRQLKKKIAASPDKR"
FT   gene            complement(210957..212660)
FT                   /locus_tag="Exig_0195"
FT   CDS_pept        complement(210957..212660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0195"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcy:Bcer98_3254 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59681"
FT                   /db_xref="GOA:B1YHE9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHE9"
FT                   /protein_id="ACB59681.1"
FT                   /translation="MSTTFLFGYIAFMVVTIIGVNLIARRSRPARLAGAADAPAPLDEV
FT                   QLNNPDSAPMPAPQVKTQERAPLVTADISIPKVLTVLLIGMFIAILNQTLINVALPVLI
FT                   NDFNVSTSTAQWLTTGFMLVNGILIPISAFLMRSYTFRQLFLVSMTLFFFGSIICSMAM
FT                   NFPVMMIGRVVQAAGAGILMPLGSNVFMTLFPPHKRGAAMGMLGIAMILAPAVGPTITG
FT                   YVIQNYDWHVMFYGMAFFGLLTLLLGVAWFKLVQPLSKPKFDALGVVFSTIGFGSLLYG
FT                   FSEAGNDGWDSPLVISTILIGILGIATFALRELSMDDPMLNIRVLKVPEFSFTLFINII
FT                   VTMALFGGMLLLPIYLQSIRGFSPIDSGLLLLPGSLIMGITGPIAGRLFDRFGIRPLAI
FT                   FGLTLMTYGTWELTQLDMNTSYNSIMSIYMLRSFGMAFIMMPIMTAGMNALPMKMIPHG
FT                   NATQNTLRQVAGSIGTAILVTVMTRQTTAHLADDANQFTTLDPTLSQHLNELGQQLGSS
FT                   QAASVSWMTQLTKQATISGITDAFWVATVLSALALILSFFLHGKKEPNLD"
FT   gene            complement(212673..213329)
FT                   /locus_tag="Exig_0196"
FT   CDS_pept        complement(212673..213329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0196"
FT                   /product="putative multidrug resistance protein A"
FT                   /note="KEGG: btl:BALH_4153 possible multidrug resistance
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59682"
FT                   /db_xref="GOA:B1YHF0"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF0"
FT                   /protein_id="ACB59682.1"
FT                   /translation="MNMKKVLLINILTLVVLIGGGAIGYYYYDQATSYVKTDNAKIDGK
FT                   MITIASPGAGKLTDWTAKTGQTLDSDATLGHVMMAQAGQKPVSTAISMPTKATVVQSMA
FT                   TENGVVGAGTPLAYGFNLNELWVTANVEETDIDEVKVGQTVDVYVDSYPDTTLSGEVEQ
FT                   IGMTTAGTFSMMPSSNGTANYTKVAQVIPVKVSLSQEKSLDIRPGMNVTVRIHKD"
FT   gene            213525..214133
FT                   /locus_tag="Exig_0197"
FT   CDS_pept        213525..214133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0197"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcy:Bcer98_3256
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59683"
FT                   /db_xref="GOA:B1YHF1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF1"
FT                   /protein_id="ACB59683.1"
FT                   /translation="MNSGQDPRPKRSRDRITKELFRLLDSHPFSTITVKMLTDGAAVNR
FT                   STFYAHFTDKYDLMNQIVDDHMRLLMEAIRIQGTGAPAAPSLDRVSRYFERLFIHIEQH
FT                   EQFYRTMLLNGPVKTFISRFLDTLKENYQRVFEAHTVTETQLVDRDLLLNYVIGGQLGL
FT                   LISWLRNGRPYSAAYMADQLSRMIVFGTVKSIGFPEQST"
FT   gene            complement(214184..215284)
FT                   /locus_tag="Exig_0198"
FT   CDS_pept        complement(214184..215284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0198"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; 5TM Receptors of the LytS-YhcK type
FT                   transmembrane region; KEGG: bld:BLi02306 YhcK"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59684"
FT                   /db_xref="GOA:B1YHF2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF2"
FT                   /protein_id="ACB59684.1"
FT                   /translation="MSIMNNFIINFCLLFTTITLLFLPFRNHPRITPKTNLNVRLVLGG
FT                   IAGLISVLLMLNSIQIDVARIDLRIVPVVIAMMFGGLPSALVTGAMIIVTRFILTPVEQ
FT                   MDAAVVSTIVIGVLILTIAVVRRYIRLTFWNFELMIGIGIVYSLPGIYLLTNSWTTFIE
FT                   ISLAYIFFNLIAGFVTYHLLTELRRHFENIQYQQKLAMTDALTGLANRRRLDDSLSLVG
FT                   SAEEGYSLILIDIDFFKHVNDTYGHDAGDDVLRQLGTTLASLARPDDLVGRYGGEEFLI
FT                   ILPNTSLADAKSIAELARTTVARNLFPTTAVPDLQITISLGIAHSSSSHTSLEALQQAD
FT                   KALYHSKDSGRNRSTTYTKQLQLEQA"
FT   gene            complement(215468..215917)
FT                   /locus_tag="Exig_0199"
FT   CDS_pept        complement(215468..215917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0199"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: btl:BALH_1242
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59685"
FT                   /db_xref="GOA:B1YHF3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF3"
FT                   /protein_id="ACB59685.1"
FT                   /translation="MPQERDQLTYRLEEQMRIILRTLRRELNRLFEGTATRSEFFILRS
FT                   LSENGPQRPTLLAEQFELATSQVTALTDRLYKAGFVTRTRSTDDRRSIVLALTEEGESA
FT                   FRELEIVRRKYLQDRFGTLTEEELNAMVLVFDKILLTMDEEAISS"
FT   misc_binding    216092..216276
FT                   /bound_moiety="lysine"
FT                   /note="Lysine riboswitch as predicted by Rfam
FT                   (RF00168),score 106.82"
FT   gene            216251..217882
FT                   /locus_tag="Exig_0200"
FT   CDS_pept        216251..217882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0200"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   esa:ESA_01082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59686"
FT                   /db_xref="GOA:B1YHF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF4"
FT                   /protein_id="ACB59686.1"
FT                   /translation="MTCGELSFTTVEWGASFYYVAFSSSFWKVRALFVFSKSVLSKNLN
FT                   KREANEMNTLQPQRKLDSTEEGLKRGLQARHMSMIAIGGAIGTGLFIASGASVAAAGPG
FT                   GALLSYAIVGLMVYFLMTSLGEMAAYMPVAGSFSTYGAKFVDPSFGFALGWNYWYNWAV
FT                   TIAVELVAAQIVMSYWFPDVPGFYFSALFLLLMIGLNYFSVKGFGEAEYWFAMIKVVTV
FT                   IIFLIVGVAMIFGVFTSEAPVGFKNFALGDAPFVGGIPAVIGIILVAGFSFQGTELVGI
FT                   AAGESEDPKKNVPKAVKQVFWRILLFYVFAIFVIGMLIPYTSPNLVSNDITDVAVSPFT
FT                   LVFEKAGLAFSAALMNAVILTSVLSAGNSGMYASTRMLYTLARQGDAPKLFAQVSKNGV
FT                   PRNALLATGAIGALCFLTSMFGGQVYLWLLNASGMTGFIAWLGIAISHYRFRKGFLAQG
FT                   HSLSDLPYVAPAFPFGPLFAFGLCFLVIVGQNYAAFLADQIDWVGIAATYVGIPLFLAF
FT                   WLGHKFKNRTSVVPYEEMEFPEHPRP"
FT   gene            218010..218192
FT                   /locus_tag="Exig_0201"
FT   CDS_pept        218010..218192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59687"
FT                   /db_xref="GOA:B1YHF5"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF5"
FT                   /protein_id="ACB59687.1"
FT                   /translation="MNYWYHFKRAFIPIAILLVTLAIYQMLYRMNNMWYSFGGLILVFA
FT                   AIYFVMRRLKANPED"
FT   gene            218262..219209
FT                   /locus_tag="Exig_0202"
FT   CDS_pept        218262..219209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0202"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A; Methionine sulfoxide reductase B;
FT                   KEGG: bcy:Bcer98_3954 methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59688"
FT                   /db_xref="GOA:B1YHF6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF6"
FT                   /protein_id="ACB59688.1"
FT                   /translation="MAKAIFAGGCFWCMVKPFHKYDGVEQVISGYTGGHTENPTYKEVC
FT                   SETTGHLEAVEVTYDPSVITYDELLEIFWRQIDPTDGGGQFNDRGQSYEPAIFYVDEDQ
FT                   KQAAERSKAALDASGRFSKPVAVDIRPAKPFWPAEEYHQDYYKKNPFRYQMYSVGSGRA
FT                   KFVKEAWKDQGKEQELKQRLTPIQYKVTQENGTEPAFRNEYWDEERPGLYVDIVDGTPL
FT                   FTSKDKFNSNCGWPSFAKPISEDKMEVELDTSHGMTRTEVRSANADSHLGHIFDDGPTE
FT                   LGGLRYCINSAALRFIPVEELDSAGYGEYKKHFE"
FT   gene            219273..220562
FT                   /locus_tag="Exig_0203"
FT   CDS_pept        219273..220562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59689"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF7"
FT                   /protein_id="ACB59689.1"
FT                   /translation="MFTQVYEEIRQLTISKVLDFYDHEVRRLDEAARQTKYQKMSASPF
FT                   LFFRGSSHLFYYDVTRIPLGFDTPPETPTWIQGDLHFENFGVHGNAKGEIIYDVNDFDE
FT                   GYLGSYLYDLIRMAVSVQLFAEEAGYDAKPAIAAYVQHYLDDLRQYAKGKNPSKVCFTT
FT                   DNTKGPIRKLIKKAEKKKAELLGERTTVVDGQRRFADLPDMKRLDSSAYTAIEAVWPEY
FT                   IASIDAEDRQEDGFYAIKDIVYKLDSGTASIGLERYYILVEGTGGEHEDLILEMKQAQS
FT                   SVPSLFVPAYLQEVETVHQGRRIVTSQKAMQAHEDPYLGYVTMHGKEYYVRERSPYKKK
FT                   LKAKHIKSQDDLENVLSIQGQITAKIHARADMDAGVDVDILHHHADVVIIESIGVSDAE
FT                   FIRQIQRWSSAYAARTTLDFQVFLSWLANR"
FT   gene            220793..222226
FT                   /locus_tag="Exig_0204"
FT   CDS_pept        220793..222226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0204"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   reh:H16_A0277 APC transporter, CAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59690"
FT                   /db_xref="GOA:B1YHF8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF8"
FT                   /protein_id="ACB59690.1"
FT                   /translation="MSLTRKKDVSAMIAASQRNSGLARNLGAMDLTFLGIGAIIGTGIF
FT                   VLTGTGALTAGPGLIVSFILSAIACGLAALAYAEFASTIPVSGSVYTYTYATMGEIFAW
FT                   IIGWNLILEYGLASSAVAAGWSGYFQSLLGGFGIHLPTALSAAPGAVEGAKTFFNLPAF
FT                   LILLAITGLLSMGIKETKRVNNIMVIIKLAVVVLFIVVGVGYVEPTNWAPFTPFGWGGV
FT                   FSGAAIVFFAYIGFDAVTSAAEEVREPQKNLPRGIIGSLAVCTVLYVIVAAIMTGIVPY
FT                   QKFAGVDHPVSLAIQMAGQNWVAGFIDLGAILGITTVILVMTYGMVRLAFAISRDGMFP
FT                   KVFSEVHPKYKTPFKATWMIGLGSATVAGLVPLDVIANLVNMGTLAAFVLISVAVLILR
FT                   KTQPDLPRAFKCPGMPYVPIAAIASCLFLMFNLKLETWIAFFIWLAIGLVLYFAFARKN
FT                   SNLEPGNMPAAELAASDDK"
FT   gene            complement(222278..223936)
FT                   /locus_tag="Exig_0205"
FT   CDS_pept        complement(222278..223936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0205"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bay:RBAM_009560 GlpD"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59691"
FT                   /db_xref="GOA:B1YHF9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHF9"
FT                   /protein_id="ACB59691.1"
FT                   /translation="MFSSTERTAWLEEMGQELLDVLVIGGGITGAGILLDAQSRGMRTG
FT                   LIEMQDFAEGTSSRSTKLVHGGLRYLKQFEIKLVAEVGKERAIVYENAPHVTTPEWMML
FT                   PLVEGGTFGSFSTSIGLRVYDQLAGVRRHERRTMLSKEETLRYEPLLRSEHLVGGGRYV
FT                   EYKTDDARLTVEVLKAAVGYGGRAVNYTKAESLVYHNGKVVGVEVQDVLTGKTYTIRAK
FT                   KIINATGPWVDELREKDGSKSGKSLHLTKGIHLVIDQAHFPLQQAVYFDVPDGRMIFAI
FT                   PREGKTYVGTTDTNYQGDILEPGVTEEDRDYILDATNKMFNVDLQPEHVESTWSGLRPL
FT                   IHEDGKDPSELSRKDEIFVSKSGLMSIAGGKLTGYRKMAERIIDMVADQFKEEENRIYL
FT                   ASRTHDILLGGGHPDGSKGFARYLKEQQPKGEALGLSPKEATWLIQRYGTDVERVFELI
FT                   RSRGSEAERYQLPLHWFGGLLYGLEAELVMQPGDFLNRRASAVFFDFPNAEKYADGVLA
FT                   LMRSELGWSAEEEAKANASIQREFDAVRIKTSLPS"
FT   gene            complement(223972..224940)
FT                   /locus_tag="Exig_0206"
FT   CDS_pept        complement(223972..224940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0206"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   csa:Csal_2663 oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59692"
FT                   /db_xref="GOA:B1YHG0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG0"
FT                   /protein_id="ACB59692.1"
FT                   /translation="MIRTALIGFGLAGEHLHAPYLTAPDYQLVAVQSSRPEAVATRYPD
FT                   VPVYSSLEELLAAETIELVVIATPNAEHYPLAKTALSAGCHVLVEKPFTVTLLEAEQLT
FT                   DLARQQNRLLTVYHNRRYTKDFRTLLELVQADELGVVQTFEAHYDRYRPTVRARWREQD
FT                   VPGAGLLYDLGSHLIDQALMLFSERPDRVFCDQTIQRPDGPVEDYTHLILAFGTRRAIL
FT                   HIGSLVPAPGPSLAVHGTKASYFVDSVDTKRSTYTWGRPEQPLEERPFVDSGFADYYHD
FT                   LAHALRHESPLTVTTEQALLVMKIIDCAQKSVKEGTWIEVD"
FT   gene            224996..225262
FT                   /locus_tag="Exig_0207"
FT   CDS_pept        224996..225262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59693"
FT                   /db_xref="InterPro:IPR035218"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG1"
FT                   /protein_id="ACB59693.1"
FT                   /translation="MITEQQVIEKMRQTMSKIEQSSGTGQIEQIAAMKAYCELLLDQPQ
FT                   SVREPSVITPTTQPKPPEVDPMLARFMGVAPEKEEKGPSLLDF"
FT   gene            225320..225970
FT                   /locus_tag="Exig_0208"
FT   CDS_pept        225320..225970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0208"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mfa:Mfla_1148 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59694"
FT                   /db_xref="GOA:B1YHG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG2"
FT                   /protein_id="ACB59694.1"
FT                   /translation="MKTVIVIGAGPGNGAEISKRFGKEGFQVVCAARTQETLAAVITEL
FT                   KEQGIEAVGVECDASRRADLESLVEWTKEQYGQVDVLVYNASILHQASVLEVSAEQITK
FT                   EFEIDVLGALHAAQIVAPDMVARKDGAILITGGGAALHAIKSLPGLSIGKAGVRQLTHM
FT                   LHDTLKDDNVYVGTVTIAGEVKRGTALDPKNVAEAFYTLYTNRTDVEKVLEAK"
FT   gene            226071..226811
FT                   /locus_tag="Exig_0209"
FT   CDS_pept        226071..226811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0209"
FT                   /product="Micrococcal nuclease"
FT                   /EC_number="3.1.31.1"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   bsu:BSU21610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59695"
FT                   /db_xref="GOA:B1YHG3"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG3"
FT                   /protein_id="ACB59695.1"
FT                   /translation="MKRIVSQLFLVMTILFLSGCALDSEPDDPQTGIPQPDEAKVTEAT
FT                   VERVIDGDTVKVRLKNGQTEDVRFLLIDTPETVNPEKPVQPYGPEASRFTKEALPAGSE
FT                   VLLERDESKTDRYGRLLAYVWADGKMINQELLRKGLARVAYIYEPDTRYVETFQEIEDE
FT                   AKEEKLGIWQTDGYATDRGFDTSVMKGTPAEPTDCADIKGNINRQGKKIYHIRGGRSYD
FT                   EVNPEEMFCSEREAKEAGFVRAAN"
FT   sig_peptide     226071..226145
FT                   /locus_tag="Exig_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.402 at
FT                   residue 25"
FT   gene            complement(226911..227882)
FT                   /locus_tag="Exig_0210"
FT   CDS_pept        complement(226911..227882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0210"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: lwe:lwe1715
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59696"
FT                   /db_xref="GOA:B1YHG4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG4"
FT                   /protein_id="ACB59696.1"
FT                   /translation="MSNFFTLLRRGNKSALAAAIVNTVIALIKFVAYILTGNIAMFAEM
FT                   MHTIGDAANQFFVYVGSALSKKAPTKRFPNGFGRLVNLVLLAAILVVAILAYETIREGV
FT                   LHILHAPGEKTSGLWIILTALGIGVVLEVGVFYKAMTEIAHETGLKSRGLTLVGQSFAN
FT                   LSQAKPATRLVFMEDLVATLGGVIAIIAVLISHYTSFYQAEGIASILIGLMMFYVVYNV
FT                   FIQNAAGALGEIDEVLTAKIGEILMRDPDVRDIEKLEVIKEGDHFHVEIEIEVDPGLTI
FT                   AQADDIKDRLELQIRILKGITDVTISFDEDDKIQHYQPPTQP"
FT   gene            complement(227921..228706)
FT                   /locus_tag="Exig_0211"
FT   CDS_pept        complement(227921..228706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0211"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bcz:BCZK4466 glucose-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59697"
FT                   /db_xref="GOA:B1YHG5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG5"
FT                   /protein_id="ACB59697.1"
FT                   /translation="MYNSLKGKVAIVTGGSMGIGEAIIRRYAEEGMRVVINYRSHPEEA
FT                   KKIAEDIKQAGGEALTVQGDVSKEEDMINLVKQTVDHFGQLDVFVNNAGVEMPSPSHEM
FT                   SLEDWQKVIDVNLTGAFLGAREALKYFVEHNVKGNIINMSSVHEIIPWPTFVHYAASKG
FT                   GVKLMTQTLAMEYAPKGIRINAIGPGAINTPINAEKFEDPKQRADVESMIPMGNIGKPE
FT                   EISAVAAWLASDEASYVTGITLFADGGMTLYPSFQAGRG"
FT   gene            complement(228725..229579)
FT                   /locus_tag="Exig_0212"
FT   CDS_pept        complement(228725..229579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0212"
FT                   /product="sugar transport family protein"
FT                   /note="PFAM: sugar transport family protein; KEGG:
FT                   lwe:lwe0150 glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59698"
FT                   /db_xref="GOA:B1YHG6"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG6"
FT                   /protein_id="ACB59698.1"
FT                   /translation="MIDILIALVPALMWGSLPLVVSKIGGSTEQQIIGTTLGALAFAII
FT                   TFFFVSPELSTTAWVAGFFSGAFWALGQMNQFAAFKQMGVSKTMPISTGMQLVGTSLFG
FT                   VLAFGEWSNRTALILGISALVLIVAGAAFTSYKEDKSKQDENIGKGLLLLLISTVGYVG
FT                   YVVIARWFNINGWEAVLPQAIGMVISAVLLSLRKGNLFTKKTAGNTIGGLMWAVGNIAL
FT                   LFATAKVGVATSFSLSQTGVVISTIGGVVLLKEAKTKKEMTFVVIGCILVVVGGIMIGF
FT                   TKQ"
FT   gene            complement(229714..231342)
FT                   /locus_tag="Exig_0213"
FT   CDS_pept        complement(229714..231342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0213"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: swo:Swol_1468
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59699"
FT                   /db_xref="GOA:B1YHG7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG7"
FT                   /protein_id="ACB59699.1"
FT                   /translation="MKRWALYRIFIIVTMFARYIWTIYRFTRKNRPGTNNEEFERIMIT
FT                   IARDYKKKALRLEGLLIKLGQFLSIRADLFPPSVLMELTELVDKVPSSKLGESRKIIEE
FT                   DWGTAIEDIVDDISPRPIASASIGEVYSATLKSNGRKVAIKVQRPNIEQIIKTDFRAMR
FT                   LVIAMLRRTSLNKSTDLQSLYRQMVFVIGDELNYRTELKNGLYFKKMYETNPVIYIPDY
FT                   FEEHCTNRVLVMEWIEGTRITDLDYLAEHNIDRDELARNLFLNAGEQLLFGGKFHADPH
FT                   PGNVLVQSDGRIVLLDFGMIGATTADDMRAIQRILQSFVTLDYDAIVDGLEDLRFLLPN
FT                   ANKQNIRQAIEKAVTFYLESDMENIDTKLIEKVLSDIELLVRNEPIQLPAEFAFFGRAA
FT                   STILGILQILSPKINLLELAKPMVRRWLDEEGKNQNRYLQIAGSYGARLLAFPRLVNDA
FT                   LSEPTRWRLFEQQKFSRVANMESLKIRQWTSSLVGIVSLPVSYTGYFLAHYDLMGISLA
FT                   IAIVALWNGRRIGRQIVRIADEPFK"
FT   gene            231509..232120
FT                   /locus_tag="Exig_0214"
FT   CDS_pept        231509..232120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0214"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   gtn:GTNG_1178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59700"
FT                   /db_xref="GOA:B1YHG8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHG8"
FT                   /protein_id="ACB59700.1"
FT                   /translation="MSWDLLNIIGTVAFAMSGAIVAMEEKYDLFGVWLLALITAFGGGA
FT                   IRNLLIGVPVSALWSQGGLFLIAILVALLIFILPQLFLPHWTRWGVLADALGLSAFAIQ
FT                   GALMASAKGLPLSATISAAVLTGVGGGVIRDLLAGRKPLVLHKEIYAMWAVMAALVIDR
FT                   FELTNPLHLFTLLGLITILRMLSYYYEWNLPARRLGGDKE"
FT   sig_peptide     231509..231577
FT                   /locus_tag="Exig_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.790 at
FT                   residue 23"
FT   gene            232117..232485
FT                   /locus_tag="Exig_0215"
FT   CDS_pept        232117..232485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0215"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   bcl:ABC3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59701"
FT                   /db_xref="GOA:B1YHR7"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHR7"
FT                   /protein_id="ACB59701.1"
FT                   /translation="MKIFIMIGALSMMLAVALGAFGAHALKDMLSERMLANWQTGVLYQ
FT                   MVHSLGILALGGMLLKVSISQFSLAGWLMLAGIVFFSGSLYVMALTGVTKLGAVTPIGG
FT                   VLFIAAWIFVAIGAYKGL"
FT   sig_peptide     232117..232194
FT                   /locus_tag="Exig_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.836 at
FT                   residue 26"
FT   gene            complement(232622..232771)
FT                   /locus_tag="Exig_0216"
FT   CDS_pept        complement(232622..232771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59702"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHR8"
FT                   /protein_id="ACB59702.1"
FT                   /translation="MGNAMNRSTRSRELQFAVLSKELKPVAERVLDRYEQALSKLNKTQ
FT                   PAKR"
FT   gene            complement(232865..233641)
FT                   /locus_tag="Exig_0217"
FT   CDS_pept        complement(232865..233641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0217"
FT                   /product="Chlorite dismutase"
FT                   /note="PFAM: Chlorite dismutase; KEGG: bcl:ABC3912 putative
FT                   heme peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59703"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHR9"
FT                   /protein_id="ACB59703.1"
FT                   /translation="MQHQSSEPTVTQQAAETLDGWYTFHDFRRIDWARLKQVDASVRTK
FT                   MVQEFQAFLGELAQVEDQKEGSHALYTIIGQKADLVLMVLRPTMEEIQDVEVKMQKLDL
FT                   YDYLIPTYSYVSVVELGTYRGSGEGNPYENPYVRDRLYPILPKSKHICFYPMSKSRRDG
FT                   DNWYTLSMEKRKELMYRHGMIGRSYAGKIQQIIGGSTGFDDWEWGVTLFANDILQFKKI
FT                   VYEMRFDEVSAKYGEFGEFFIGNRLETTDLEAHFAL"
FT   gene            233988..234974
FT                   /locus_tag="Exig_0218"
FT   CDS_pept        233988..234974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0218"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: bwe:BcerKBAB4_5180 phosphate
FT                   acetyltransferase; TIGRFAM: phosphate acetyltransferase;
FT                   PFAM: phosphate acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59704"
FT                   /db_xref="GOA:B1YHS0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS0"
FT                   /protein_id="ACB59704.1"
FT                   /translation="MQLFEMLETKVKAHQPTIVFPEGIDARVLGAAVRLKKDGLVTPIV
FT                   IGPRGQIEETASANNIDVADLETIDPASYEGIEELVASFVERRKGKATEEQARALILKD
FT                   VNTFGTMLVHTGKAEGLVSGAMHATGDTVRPALQIIKMQEGYKKTSGVFIMVRDDEQYV
FT                   FADCAINIAPDANDLAENAIASAKTAKTFGIDPKVALLSFSTKGSAKSPETERVVEATC
FT                   LAKERAPELSIDGELQFDAAFVPSVAKSKAPESDVAGQANVFIFPSLESGNIGYKIAQR
FT                   LGGFEAIGPILQGLNKPVNDLSRGCNEEDVYKLAIITAAQAVEERQA"
FT   misc_binding    235041..235141
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch as predicted by Rfam
FT                   (RF00167),score 67.17"
FT   gene            235215..235799
FT                   /locus_tag="Exig_0219"
FT   CDS_pept        235215..235799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0219"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /note="TIGRFAM: xanthine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: bha:BH1514 xanthine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59705"
FT                   /db_xref="GOA:B1YHS1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHS1"
FT                   /protein_id="ACB59705.1"
FT                   /translation="MKRLEEMIKQEGLVLSDQVLKVDSFLNHQVDPTLMWEIAYEFMDR
FT                   FKDAGITRILTIEAGGIAPAMMTALRLGVPMVYARKTKSLTLNEGTISAEVYSFTKQQT
FT                   STITVAEQYLQAGERVLIIDDFLANGEAAFGLAKLVEQAGAEVAGFGIVIEKSFQPGRQ
FT                   KLLDAGFRVESLARIKKLEAGEATFVDPVTV"
FT   gene            235796..237103
FT                   /locus_tag="Exig_0220"
FT   CDS_pept        235796..237103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0220"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: bld:BLi02347 PbuX"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59706"
FT                   /db_xref="GOA:B1YHS2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS2"
FT                   /protein_id="ACB59706.1"
FT                   /translation="MKTLSNVKAASLGLQHVLAMYTGAAIVPLIVGSAIGLSGEELAYL
FT                   VAIDLFMCGVATLLQVFVTKYTGVGLPVVLGCTFTAVGPMIAIGSLQGITAIYGALIAS
FT                   GLIIFVISGWFSRIAILFPPVVLGSVVTIIGISLIPAAINDIGGGQGAKDFGDMRYLAL
FT                   AGLTIVLILVFNRYGTVFSKAAAVLIAVLIGTLVAFGMGMIDFSPVAEASWFQMVTPFY
FT                   FGVPTFNATAILTMTLVGLVSMVESTGVFLTLGEITDKKLTDKDLARGYRAEGAATIIG
FT                   GIFNSFPYTTYSQNVGLVQLTGVKTRKVIVFAGFFLIVLGFLPKVATFTTLIPKPVLGG
FT                   AMLVMFGTVAASGIRILSRVDFAKNDNVITVALALGVGLGISMNPAIVASLPDQVRVLT
FT                   DSPIVAGSVTALLLNGLFRLTEKKTAMRKTPLAKVE"
FT   gene            237327..238703
FT                   /locus_tag="Exig_0221"
FT   CDS_pept        237327..238703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0221"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   gtn:GTNG_3393 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59707"
FT                   /db_xref="GOA:B1YHS3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS3"
FT                   /protein_id="ACB59707.1"
FT                   /translation="MKQQTELNRGLEERHITLMSLGAAIGVGLFLGSAKAIQLAGPGIL
FT                   IGYLIGGLIIFIIMRALGELAVREPVSGSFAEYARKYVSPLAGFLTGWNYWLLWIFTCM
FT                   AEITAVGIYMQEWFPNSPTWMWALGALILMTSINFIAVKFYGEFEFWFALIKIVAIVAM
FT                   IILGTLTIVIGFGNGGTPVGISNLWSHGGFLPNGFGGVLLAMQMVMFAFLGIEVIGVTA
FT                   GEAKNPKKTIRKAVNNVFLRILVFYIGALFVILSIYPWDQVGQNNSSPFVLLFDSLGIP
FT                   AAAGIINFVVLTAALSSCNSGIFSTARMMMNLSQNQEAPKRFAKISKNGVPALATILSG
FT                   VALLVGVALNYFLPDDVFAIVTSIATFGAVWTWAMILIAQMRARKVHGSAEFGVPFFPI
FT                   ANYLALAALVGVIVLMAFDAGTRIALIVGPLWYVILIAVYYARGMHKQKRQPLDRASGE
FT                   "
FT   gene            238796..239095
FT                   /locus_tag="Exig_0222"
FT   CDS_pept        238796..239095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0222"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gtn:GTNG_1980
FT                   molybdopterin biosynthesis MoeB protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59708"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS4"
FT                   /protein_id="ACB59708.1"
FT                   /translation="MKTIHVDELQEKLEAGEALHVVDVREQDEYDAGHIPNVRFIPMSE
FT                   IGERYTELQEGETYYLICKAGGRSENVGRFLEQYGYDVINVEGGMMNWKGDQEA"
FT   gene            239226..241205
FT                   /locus_tag="Exig_0223"
FT   CDS_pept        239226..241205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0223"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   bsu:BSU31260 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59709"
FT                   /db_xref="GOA:B1YHS5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS5"
FT                   /protein_id="ACB59709.1"
FT                   /translation="MEQKKKRTLSIKQKLILTSMLLLLIPSLLIGFVSYSQAKQKIMNE
FT                   ILQSAHAGVDRMNDEIMNIIDPMRRDVAFFADRIDGTLYQSGKQNLDLKEKMTEYLDTH
FT                   PQAANIYYATTSGEMTIYPEQSMPDDYDPRERPWYKAAEDASGKVVITDPYVDAASGKM
FT                   MVTLSQTGGNGRGVIAIDVDVDRIADIAKKIKIGKEGYVTILDSKKNFVTHPTLKPGET
FT                   ATGNWVGPLYAGKEGRFSYLFEDEDKQMDFMTNGLTGWKVAGTLYDREITDETASILWT
FT                   TLGVIAGTFLLAGLLLFFILRSIISPLNRLTKSAERIQEGDLTEEVVVESNDEIGKVAE
FT                   SFNTMILSLRGIISNLDQSIGQVAASSEELMANAAQTTAASEQIAGSIQEMAAGAGQSK
FT                   RQLDGNAVSLQAITSGVMRIAESSTNVSELSRATASEAEDGTAAVTKNVEQMKAIDSSV
FT                   ENFGEVIQSLAHRSNEIGKIVDVINGIATQTNLLALNAAIEAARAGENGKGFAVVASEV
FT                   RKLAEQSQESTKQISHLIQNIKQETERSVFLMKEVSHHTKAGLETTEDSAVRFKQIMLR
FT                   TQEMTPRIEDVTATVEEIAANVQEVSASATEIAHIADENSAASERVAATTEEQLGSMED
FT                   ISQSAKTLSDMAEELQVLVSRFKI"
FT   sig_peptide     239226..239342
FT                   /locus_tag="Exig_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 39"
FT   gene            241359..242552
FT                   /locus_tag="Exig_0224"
FT   CDS_pept        241359..242552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0224"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmr:Mmar10_1086 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59710"
FT                   /db_xref="GOA:B1YHS6"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS6"
FT                   /protein_id="ACB59710.1"
FT                   /translation="MARQTKLMEWQQAGLIDAETVDRIKAYEGHRQKKKRVPLLLIVGL
FT                   TFVGLALLSFLAANWQAIPALIKIGLVLVIMVSCYVLADVSERRTIWNPVAFRILGLVA
FT                   FAGALIVTVQSFHMSMQGSFIGWAVFLAALAHFFTWRHPAYAIVAFISGLNIFTGVGGF
FT                   GTEHATFLDWTSIVLVVIVSLAWFYFSQSFPSLILSWLFLYLSGLELFALVSYDGVLWP
FT                   IWTLFVLVPLLLVVKQDSDRHFLYHLYLIVAAINSLVYLTVRAETTDSVIPLGEAVALA
FT                   VFGLAIGYLIYQKFRPLLWILPLGLFGFLWLDEQAILIAALVEIIAFVYLIVQERQGRR
FT                   LTIPFVYFIAVQLTIYFIYAWDRLDMSLFFLVGALLVFLIAGVLWWIRKRHEGGVPS"
FT   gene            242549..242992
FT                   /locus_tag="Exig_0225"
FT   CDS_pept        242549..242992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59711"
FT                   /db_xref="GOA:B1YHS7"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS7"
FT                   /protein_id="ACB59711.1"
FT                   /translation="MKRYLFPVLQIIVVLGVILSFYSISWFGDSYRFRAEPYDPFSPVY
FT                   GEYVMLQYPDLKPADSVKKGLVYVTFTTDSDGYAKIDRISNDRFFGSVAGDYYDKYVTI
FT                   PQLNQYYVEQGTGKGYEDAKKLVVKADVSPWGTVRATDLSVRN"
FT   gene            complement(243455..245248)
FT                   /locus_tag="Exig_0226"
FT   CDS_pept        complement(243455..245248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0226"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   bpu:BPUM_2525 carbon starvation-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59712"
FT                   /db_xref="GOA:B1YHS8"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS8"
FT                   /protein_id="ACB59712.1"
FT                   /translation="MSATPIVIAVICILLIVYRLYGTFMAVKVLKIKEDRETPAHKFAD
FT                   GKDYVPTNKWVSFGHHFAAIAAAGPLVGPVLAAQFGYLPGLLWLLIGAVIGGAVHDMVV
FT                   LFASMRQDGQSLSEVAKKELGPVAGFCAGLAMLFIITITMAGLSMVVLHALEHNPWGTF
FT                   AVFSTIPIAMGVGIYLRKGGNLALASVVGFLLILAAIGFGPQLTDTFIGTWFDLSSRQL
FT                   AIALPIYAFFAAALPVWLLLAPRDYLSSFMKIGVFFALIVGVFIINPDIRFPAFTKFVN
FT                   GGGPIIAGPVWPFISITIACGAISGFHAFVGSGTTPKMINRWSDIKPVAFGAMLVECLV
FT                   AVMALIAATSLEVGDYFAINSTPEVFATLGMSTVYLDELSREIGLDLAGRTGGAVSLAV
FT                   GMTFIFRAIPWFREIAGFFFQFVILFEAVFILTAIDAGTRVARYLIQDFFGEFYKPLKR
FT                   VDWIPGAIFASALGTFFWGYLLFSGDIGSIWALFGVSNQLMASIGLIIGTTIILKIADK
FT                   KVYALTTFIPLVYLLVTVTFADIWMVANVYANPASAGFSILNTILSFTMGILAIVITIS
FT                   AVRKWIELLNSPRWEKVKKSA"
FT   gene            complement(245384..246079)
FT                   /locus_tag="Exig_0227"
FT   CDS_pept        complement(245384..246079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0227"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: bcy:Bcer98_3958 two component transcriptional
FT                   regulator, LytTR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59713"
FT                   /db_xref="GOA:B1YHS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHS9"
FT                   /protein_id="ACB59713.1"
FT                   /translation="MRTILIEDEPLARDELRYHVVRAGLDVIAETGHVGEAEQLVRTLQ
FT                   PDLVFLDIELIDGSGLDVAKRLQSMPHPPAILFVTAYDTHALEAFELNAYDYILKPYDP
FT                   SRISRAIEKIMRKPALKTPRIERLAVESGEQLKLLSPQDVDYIVAESGKTKLVTRSESY
FT                   PSNDTLQELERKLSGHRFLRVHRSYLVNLAAIEAIEPWFNGAYTIKIQQIDVPVSRTYV
FT                   KVLKEALGI"
FT   gene            complement(246060..247826)
FT                   /locus_tag="Exig_0228"
FT   CDS_pept        complement(246060..247826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0228"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase internal region; 5TM
FT                   Receptors of the LytS-YhcK type transmembrane region; KEGG:
FT                   bay:RBAM_025970 LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59714"
FT                   /db_xref="GOA:B1YHT0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT0"
FT                   /protein_id="ACB59714.1"
FT                   /translation="MFELIPFLLERLGIMIILAFILAQWGPTRRLLKQPEAGWQFGLLI
FT                   LIFATYGILSNYTGVKVDLAKFLPHTWLEQVDGTSAIANTRTMIVVISGLLAGPIGGTI
FT                   TGLLVGIHRYTLGGFTAFACALSTVVAGGVSGLLRPYWRDRLGSRALLPICLTGFLMVF
FT                   EMSLILLFSDPFPAALELIQFIFLPMTVVNVLGVWLFLSIIRLAAREEEHVRAREAERS
FT                   LHIADLTLPHLTRGLTIQTAEAVADILLQQTRADAVSLTDQSVILAHIGVGSDHHQSGG
FT                   HWTTRPTEHVLTDGQLRLVTDRDEIGCPKADCPLQAGIIAPLTIGETTIGTLKVYYPHP
FT                   ELLDAVEVELIEGLAKLFSTQLALGKAERQAGLLKDAEIRALEAQIHPHFLFNAINTIY
FT                   ALCRTDVEQARTLLLELSTFFRSNLQGARSTKIPLQKELEHIEAYISLEAARFPSRPFV
FT                   DIDLEDGTEQLLVPPFVLQPLIENAFQHAFSPGQTGYVGVTAWLTADQLVLEVVDNGRG
FT                   IDAERLTRLGREVVESNGTGTALFNTAERIKSLYAENGSFRLTSQPGEGTTITIHLPIE
FT                   TGKEVSHAHDPN"
FT   gene            complement(247926..248831)
FT                   /locus_tag="Exig_0229"
FT   CDS_pept        complement(247926..248831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0229"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   bld:BLi00762 YciA"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59715"
FT                   /db_xref="GOA:B1YHT1"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHT1"
FT                   /protein_id="ACB59715.1"
FT                   /translation="MSTYPVTLPTKEERHKLFGSVPPIKGTKPTEKDKMIDLQNTPKNF
FT                   LFALDAVGISNVKHPVVIQDGETTQATIATFELSTSLVQDRKGINMSRLTEQLDQYHNE
FT                   GWVVTNESLIQFARELAERMEQSEGQLTIRYPWFFTRKAPATGLSGLMNAEVWQTVSVN
FT                   TETNEATLSVGLTINVTTLCPCSKEISEYSAHNQRGYVTMEASLRDEADDFNWKQELLD
FT                   AAESNASAPLHPVLKRPDEKRVTEMAYENPRFVEDMVRLIAADLYEMDPIASFFVECRN
FT                   EETIHQHDAIARITFDKDAQ"
FT   gene            249142..249999
FT                   /locus_tag="Exig_0230"
FT   CDS_pept        249142..249999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0230"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bwe:BcerKBAB4_1224 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59716"
FT                   /db_xref="GOA:B1YHT2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT2"
FT                   /protein_id="ACB59716.1"
FT                   /translation="MDWQLVLQYAWVLLVLIALEGLLSADNALVLAVMVKHLPGEQQKK
FT                   ALFYGLAGAFVLRFAALFAISFLVDIWQIQALGAAYLLIMGLRHIYKTVKARRIGENHG
FT                   AENELDAEPKSEEPVSKAEFWKTVAKIEFADLAFAVDSILAAVALAVALPNWGTGEIGG
FT                   LNTGHFVVILTGGLMGVVLMRFAARVFVKLLAERPGLETAAFAIVAWVGVKLAVLALEH
FT                   PKYHASIEGTIFEALKLPEGFAHSTPWQIFFWTVMVGLALWGWFSSPKTKSNPDAEKKI
FT                   EKNL"
FT   gene            250153..250908
FT                   /locus_tag="Exig_0231"
FT   CDS_pept        250153..250908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0231"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bwe:BcerKBAB4_1224 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59717"
FT                   /db_xref="GOA:B1YHT3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT3"
FT                   /protein_id="ACB59717.1"
FT                   /translation="MDIGLITQYATVGLVLIILQGLLSADNAMVMAVLVRPLPDDQRKK
FT                   ALFYGLIGALVLRFVAIFFASYLATIWELQALGAIYLFYVAFKGIVEARSNKHQIPESA
FT                   SAKKASPNFWWTVVKVEFSDLAFAVDSTLAAVAMATTLPMIGGTIGGLNTGQFWVVFFS
FT                   GIIGLVIMRYFASWFVVLLQKRPGIEEAAFWLVAWVGVKLVVMTLAHPSIHVLPHEFPE
FT                   STLWQTIFWVVLALILVLGWFRSGPKTDK"
FT   gene            250968..252101
FT                   /locus_tag="Exig_0232"
FT   CDS_pept        250968..252101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0232"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: lca:LSEI_0955 predicted hydrolase of HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59718"
FT                   /db_xref="GOA:B1YHT4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT4"
FT                   /protein_id="ACB59718.1"
FT                   /translation="MQNGNFIRMLTRMQNVPRWDEYAPRFPDNAASHSFRVALFSLMAS
FT                   YLEEEATDIKYDRLTLLGKALFHDMNEVITGPIKHRTKKEPTLHAHIQAMERQASEKLV
FT                   ALLSKSLQPDFTNYLVFAEDDSPEGQLVEAIDTFDAMLFAKREAEVTGSAFFLAKTNEL
FT                   KAALEIHPSPAIRTLTASVWAKDDMSRFIDNVLMMDTIRRWKGRFNTIDDNDATHAFRA
FT                   ASLGLFNGLIESKKYGVNINTAEVVSRLLCHDLVEGTTGDVLGPVKHATPVTAAAFEAY
FT                   ERTEGEALINLLPSSMRKEFHRFVVEAKDETYEGQMVDVVDKLDALIKMNMERKLNGVE
FT                   YETGYRAQLKKVQTVYENPSVVFFLAYVLHDLDYVTS"
FT   gene            252118..253317
FT                   /locus_tag="Exig_0233"
FT   CDS_pept        252118..253317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0233"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   btl:BALH_0182 drug resistance transporter Bcr/CflA
FT                   subfamily, possible bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59719"
FT                   /db_xref="GOA:B1YHT5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT5"
FT                   /protein_id="ACB59719.1"
FT                   /translation="MTNTSPIQTKRLTLILILGSLAALGPLSIDMYLPAFPDMSRSFGA
FT                   SASSIQLSLTACMLGMALGQIIVGPLSDVRGRKRPLLLALSAYLLASLACAFAPTIEVL
FT                   IALRFVQGAAGASGIVISRAIVRDLFEGPELTKFFAALSLVNGTAPILAPIIGGQILRF
FT                   GDWRIVFYLLAVLSTLMLIAVAFRLPETLPVHHRVEGNLKTTFQTFGRLLSDRTFIGYA
FT                   FAQAFAMGAMFAYISGSPFVLQNIYGASPQQFSFLFGLNGIGIILAAQTAGRLAGRVDS
FT                   EKMMRIALTVVAMAGICLFLALTLSDSLILVMIPLFFVVSSVGMISTLGFTLAMQNYGS
FT                   TAGSASALLGLLPMLVGSLVSPLVGVMGEESALPMGLIIMTLDCLALLVYTLLIVRRTQ
FT                   "
FT   sig_peptide     252118..252204
FT                   /locus_tag="Exig_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.539 at
FT                   residue 29"
FT   gene            253484..253735
FT                   /locus_tag="Exig_0234"
FT   CDS_pept        253484..253735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59720"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT6"
FT                   /protein_id="ACB59720.1"
FT                   /translation="MKKRSFSDTRPVSESNNPRTLESLLARHYAAQKKYARRYQEADSP
FT                   REKELAELLYEENRHAYLQAYRQLYGSNPFIEVTEDGR"
FT   gene            253725..254246
FT                   /locus_tag="Exig_0235"
FT   CDS_pept        253725..254246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0235"
FT                   /product="YuaF"
FT                   /note="KEGG: bay:RBAM_028120 YuaF"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59721"
FT                   /db_xref="GOA:B1YHT7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT7"
FT                   /protein_id="ACB59721.1"
FT                   /translation="MDVSTLYLYALAAAACGVLLSVVFSDLIPGIDQIFHPTLILSFVI
FT                   LTSAFGFGLEHLTLLGSLVILLISAGISLILTSLLHLFIFVPLAKAEQSISFSEQTLEG
FT                   RSAIVILPIPEDGYGEILVDDVSGRIAKSAVLFEGPALAQGTKVIIIEIKQGVAHVMTY
FT                   PTQWKEEMFS"
FT   sig_peptide     253725..253802
FT                   /locus_tag="Exig_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.775 at
FT                   residue 26"
FT   gene            254243..255763
FT                   /locus_tag="Exig_0236"
FT   CDS_pept        254243..255763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0236"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: bay:RBAM_028110 YuaG"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59722"
FT                   /db_xref="GOA:B1YHT8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT8"
FT                   /protein_id="ACB59722.1"
FT                   /translation="MNPIIIVAIIAGALILALIALFVTKYRTVGPEEALIVSGSYLGNS
FT                   PTVNTDESGNRVKIIRGGGAFILPVFQQASPLSLLSSKLEVTTPEVYTEQGVPVMADGT
FT                   AIIKIGSSISEIATAAEQFLGKSKEDREGEAREVLEGHLRSILGSMTVEEIYKNRDKFS
FT                   QEVQRVASQDLAKMGLIIVSFTIKDVRDKNGYLESLGKPRIAQVRRDADIATADAEKET
FT                   RIKRAEASKDAKKAELERATEIAEAEKENQLKMADYRREQDIAKAKADQAYDLENARAQ
FT                   QEVTEQQMQIKIIERQKQIELEEREILRREKQYDAEVKKRADADRYSIEQAAQADRAKQ
FT                   YAEADATKYRIEASAKADAERIRLDGLAKAEAERAQGETEADIIRLKGLAEAEAKEKIA
FT                   QAFEQFGQAAILDMVVRMMPEYAKQVAAPLGNIDKITVVDTGSGEGGGANRVTGYATDL
FT                   MASLQETLKASSGIDVKDLIENFSGKGTAKPLTVNLNQGEPVASGKSE"
FT   sig_peptide     254243..254320
FT                   /locus_tag="Exig_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.622) with cleavage site probability 0.351 at
FT                   residue 26"
FT   gene            complement(255889..256737)
FT                   /locus_tag="Exig_0237"
FT   CDS_pept        complement(255889..256737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0237"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: bld:BLi01197 YitS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59723"
FT                   /db_xref="GOA:B1YHT9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHT9"
FT                   /protein_id="ACB59723.1"
FT                   /translation="MVRFITDSGADAPKELLDAYGFTVMPFGVLIDEETFFDGESISPV
FT                   ELYEKMRNGAAPKTFQVEVSRMVEVFTEHFKQGEPFLYLAFSSELSGTYQTATMLAAEL
FT                   AETYPDVPYAIINTKTASTGQGLFVLDVAEFSKTHNFEETKAYAEQKVNTIRHLFTVES
FT                   LEYLMRGGRVSRASAFIGGLLSILPLLTVEDGKLIPKEKIRGQKKVMNRIVEWMEEARP
FT                   SIDGHRIIIGHGDSIERAEQLKQLIEAQFSPSEVLITIAGAAIGSHTGPGLIVIGYDLP
FT                   A"
FT   gene            complement(256755..257576)
FT                   /locus_tag="Exig_0238"
FT   CDS_pept        complement(256755..257576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0238"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bce:BC5386 lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59724"
FT                   /db_xref="GOA:B1YHU0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024897"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YHU0"
FT                   /protein_id="ACB59724.1"
FT                   /translation="MGIELLKQEHYRIFDQTSLGNTFHATQSFAMDDTLCASVATEGAA
FT                   IRSWVHHETVVLGIQDARLPHLDDGIDVLHAHGFQPVIRNSGGLAVVLDAGVLNISLVL
FT                   PERGGIDIDSGYEAMLALVRRMFAEETDAINAGEVVGSYCPGSYDLSIAGKKFAGISQR
FT                   RVRGGVAVQIYLCVNGSGSARAQLVRDFYAAALQGETTKFVYPTVVPETMASLEELLQR
FT                   PLTVEDCLVRVYRSLMELGATLTPSVLSEVENERFGVNLGRMLDRNEKVLG"
FT   gene            257732..259036
FT                   /locus_tag="Exig_0239"
FT   CDS_pept        257732..259036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0239"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: bsu:BSU37600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59725"
FT                   /db_xref="GOA:B1YHU1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU1"
FT                   /protein_id="ACB59725.1"
FT                   /translation="MYQSLGQLKETKVFKDPVHRYIYVSDQLIWQLIGTKEFQRLRRIK
FT                   QLGTSFLTFHGAEHTRFHHSLGVYEITRQLIDVFNGRADWDDQYRELTLVAALLHDVGH
FT                   GPFSHAFENVFGVDHEEWTERIILGDTEIKQVLDQVGEGFAEEVASIINKTHPNQLLVT
FT                   MISSQLDVDRMDYLLRDAHFAGVSYGKFDLERMLRVLRPAPNQMVVKQSGMHSIEDYIM
FT                   RRYQMYWQVYLHPVTRSSDYLLKAILERAKELYTSEYAFTIDPVHLSPLFTKEMSLKNY
FT                   LALDETIVYFYFQQWAEEEDTVLSDLARRFVDRKLFKYVDYPAEKRALVHEKLCTLFEK
FT                   IGLDPTYYLLEDKLSRLPYDLYGDNGEISKQPIMLQMKNGQMKEISQVSPLVQAIANSR
FT                   QTDEKLFFPQEILHDLREFANEKMQIDQLLLGEEI"
FT   gene            259033..259884
FT                   /locus_tag="Exig_0240"
FT   CDS_pept        259033..259884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0240"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   oih:OB0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59726"
FT                   /db_xref="GOA:B1YHU2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU2"
FT                   /protein_id="ACB59726.1"
FT                   /translation="MNNIIATILKYAGLEGKAVIPLKGATSSYVFRAGDSVFRIHTNPA
FT                   WLEQEPDLVAHEVFALRATGRLGPDVENYQLTWEGEIPPWIQMTCLPGEVRLEPLNRAY
FT                   LKQLAKTLVAIHQLPVPEARYQYAPYVTKRTVPFWAVQKEMWQRAVAEPPATSQQVRFI
FT                   HRDFHPVNVLYESAEKYNVVDWINGCVGPIEADVAHCRLNLMLLESVEAADQFLAEYIA
FT                   YSGFSYDRKWDLTAVFDFEPDTLNVYPGWKAYGKANISQGNVRERMENIVLKVYENDES
FT                   GY"
FT   gene            260009..261187
FT                   /locus_tag="Exig_0241"
FT   CDS_pept        260009..261187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0241"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter;
FT                   nucleoside recognition domain protein; Na+ dependent
FT                   nucleoside transporter domain protein; KEGG: bcz:BCZK0517
FT                   nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59727"
FT                   /db_xref="GOA:B1YHU3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU3"
FT                   /protein_id="ACB59727.1"
FT                   /translation="MKYLIAILGLVIVFGLAYLVSSNRKSIKLKPLAVMLVLQLVLGYI
FT                   LLNTSFGYVVIKGVAQVFEKLLSYAAIGINFVFGGLANEGAQPFFINVLLPIVFISALI
FT                   GILQFTKILPLLMRGIGLVLSKINGMGQLESYNAVASAAIGQSEVFITVKKQIGKLPPH
FT                   RLYTLCASAMSTVSMSIVGAYMTMVEPKYVVTAIVLNLFGGFMIVSIINPYTVDPKEDI
FT                   LEIVEEKQTFFEMLGEYILDGFKVAIIVGAMLIGYNALIGMVNDIFLMVLGISFQDILG
FT                   YIFAPFAFIMGIPWAEAVSAGSIMATKLITNEFVAMLSLPEYAKEFSARTLGIVSVFLI
FT                   SFANFSSIGIIAGAVKGLDDRQGSVAASFGLKLLYGATLVSVLTSIVVSILL"
FT   sig_peptide     260009..260068
FT                   /locus_tag="Exig_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.676) with cleavage site probability 0.486 at
FT                   residue 20"
FT   gene            complement(261274..261903)
FT                   /locus_tag="Exig_0242"
FT   CDS_pept        complement(261274..261903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0242"
FT                   /product="TrkA-N domain protein"
FT                   /note="KEGG: bwe:BcerKBAB4_1908 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59728"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU4"
FT                   /protein_id="ACB59728.1"
FT                   /translation="MAKVSLLGATGRTGRPLLDLLLEKGHEVRVLVRSEKHGLPDHPHL
FT                   TVIKGDATDADNLERVIEGTTAVFSCLGTDQKQILSVAVPNLIIKMKEQQIERIVFVGT
FT                   AGILDASEEPGKYRFQSSESRRRSTIAAEDHLKAYLTLKDADVDYTIICPTQLVEEDAI
FT                   EDVLIESNRFTHETGPIPRINVARFAYEVYDEGLFHRERVGIASRG"
FT   gene            complement(261979..262164)
FT                   /locus_tag="Exig_0243"
FT   CDS_pept        complement(261979..262164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0243"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bwe:BcerKBAB4_5171 4-oxalocrotonate tautomerase family
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59729"
FT                   /db_xref="GOA:B1YHU5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU5"
FT                   /protein_id="ACB59729.1"
FT                   /translation="MPYVTVKMLAGRTVEQKRALIEKVTAAVSESVDAPKENITVFIEE
FT                   MEKTDYGQAGVMFADK"
FT   gene            262333..262860
FT                   /locus_tag="Exig_0244"
FT   CDS_pept        262333..262860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59730"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU6"
FT                   /protein_id="ACB59730.1"
FT                   /translation="MEMEPVIRKKIHTLLIFDRALPEDNTYPLSGAKGLEVADVLFDQN
FT                   IPFGRLVTDKELAALVGNEEAKRYGMLTLLRDEDRFKPIFQNRKPTTDIEDELAERIRE
FT                   LAKQLRAIRSKCSSLERIVLFGRASQTLYDRALVQLEELNPPAHEELTSLECLRLPTIR
FT                   RVTREQLEILKR"
FT   gene            262931..263425
FT                   /locus_tag="Exig_0245"
FT   CDS_pept        262931..263425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0245"
FT                   /product="Protein of unknown function YwhD"
FT                   /note="PFAM: Protein of unknown function YwhD; KEGG:
FT                   bha:BH3813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59731"
FT                   /db_xref="InterPro:IPR014852"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU7"
FT                   /protein_id="ACB59731.1"
FT                   /translation="MEKKINFNIISDNSTDGHGGFGVGTLSLNSMSPVIISPEDGEAYI
FT                   DMGAMHAKAAIEKRIKFTTDKADSPNGKLYWIVWVTVGRKPEGFYYGGVAACDLLVDVE
FT                   ARRGFKILADHVNKMDKSLKGRIVVDHMDETSKHLLRDFLQTHKPEMWENAEPELHEAL
FT                   A"
FT   gene            263595..265178
FT                   /locus_tag="Exig_0246"
FT   CDS_pept        263595..265178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0246"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bha:BH0682 cassette chromosome recombinase B1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59732"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU8"
FT                   /protein_id="ACB59732.1"
FT                   /translation="MFKNYTMNQLVLPLDLEIRLQENDIAFAVHHLVESIPDDAFEPFT
FT                   RTTGCPAYHPRMMMKIILCAYTQSVFSGRKIEGLLQDSLRMMWLAQGNEPSYRSINRFR
FT                   VHPAVTPILKQAFVTFRCHLVEMGEIKEEAIFIDGTKLEANANRYTFVWRKSVERYSAS
FT                   LVEKSNLLYEELVAQEILPEIERESPDELTLPELEHIGDVLEGRIASINQEIEASSDTQ
FT                   ERKRLRSERKQPHLFRKKFAEFVERKRKYAVQKETFDGRNSYSKTDTDATFMRMKEDHM
FT                   QNGQLKPGYNVQIATEGQYTLAYDVYPNPTDARTLIPFLDEVSSYLTLPKHIVADAGYG
FT                   SQENYQEILMRRGRIPLVPYTMFQKEKTRKWRDDPFNLVNWSYDETTDHFVCPNGQNVT
FT                   FRYMSKRTDRYGFTRDFKVYESESCDDCPLRSLCTKAEKGRHRQVRVNVSWEEQKEQVK
FT                   DLLSDQKTGKIYAKRKIDVEPVFGNLKANLRFTRFSVRGKAKVKRELGFILMAVNLRKW
FT                   LTQSIARGAF"
FT   gene            complement(265282..266178)
FT                   /locus_tag="Exig_0247"
FT   CDS_pept        complement(265282..266178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0247"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   bwe:BcerKBAB4_2349 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59733"
FT                   /db_xref="GOA:B1YHU9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHU9"
FT                   /protein_id="ACB59733.1"
FT                   /translation="MRKSGSFWYAEYKKRGEDLRVKKKWFIPIGILALSSWFLYRENNQ
FT                   IDTTAVTVQSDKLPAAFNDYKILQIADLHGKSFGSRQKVLLKKVNKLQPDVILMTGDLI
FT                   DSRRNGEEEALLLMKQLTPDYPVYFVTGNHEVRLNLTILPKLEQLGVTVLRNTSVSLEQ
FT                   NGQFIELLGIDDPTTTRWSEGLQEPDGIRQSLDQAQSTAETRSFQLLMAHRPEYLPLYA
FT                   ERKVDLVLSGHAHGGQIRLPFTDGMYAPGQGFFPDLTAGQHTMENTRLIISRGLGNSLF
FT                   PFRIFNHPELIVVTLRT"
FT   gene            complement(266204..267760)
FT                   /locus_tag="Exig_0248"
FT   CDS_pept        complement(266204..267760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0248"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: bcy:Bcer98_3772
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59734"
FT                   /db_xref="GOA:B1YHV0"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV0"
FT                   /protein_id="ACB59734.1"
FT                   /translation="MENKRKSKITNVFIISVIFCVLFTIWGILPESLIGAANLGNVTGI
FT                   AQSFVSNGFGWLYLFGMSAFLLIAIFLIFSRFGSIRLGKDSDRPEYGLISWFAMLFSAG
FT                   MGIGLVFWGVSEPLTHFHTPPVATNDLTDAAPLAMRYSFFHWGLHPWALYAVVALAIAY
FT                   STFRKGRPATIGDTVASLMKPKYEAAGKGTVEVLAIVATAFGVATSLGLGAQQISGGLH
FT                   FLVDGIPNSFMTQLIIILVVSVLYMMSAASGLDKGIVRLSNANIVLAILLMVGVLFLGP
FT                   FSFIMDLFVQTTGAYLQNLPTMSFRASAFNPDERGWINDWTIFYWAWWISWSPFVGTFI
FT                   ARVSKGRTIREFVLGIMLVPTIFGLLWFSVFGGSAIWNELFNNVDLISTVNEKGVETGM
FT                   FALFETFGGLGTFLSIIAVFLITTFFITSADSATYVLGMLSSGGSLLPSLRIKLTWGII
FT                   QSSIAAVLLYSGGLSALQAAAVLAAFPFIFVVGMMVIALFMDLSNEPDAAKSADQLKKE
FT                   A"
FT   gene            268149..268823
FT                   /locus_tag="Exig_0249"
FT   CDS_pept        268149..268823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0249"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bwe:BcerKBAB4_3058
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59735"
FT                   /db_xref="GOA:B1YHV1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV1"
FT                   /protein_id="ACB59735.1"
FT                   /translation="MNHDQTKQQIIDAFQFRHATKSFDPTKKIPADDFQFILETARLSP
FT                   SSFGYEPWNLLVIQNEAVRNDIRDVSWGAQGQLPTASHYVIFLARTGGQMQPDGAHVKH
FT                   MMDVLGLSDEAKAGRTKRYGLFLEEDFKIGDNEKAMTDWSAKQAYIALGNMMSTAAQIG
FT                   IDSCPIEGFDQQAVEQILERHGVLDRSVFTVPVMVAFGYRADEPKRSKQRRCLDEIVTF
FT                   VD"
FT   gene            268967..269806
FT                   /locus_tag="Exig_0250"
FT   CDS_pept        268967..269806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0250"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: bwe:BcerKBAB4_5164 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59736"
FT                   /db_xref="GOA:B1YHV2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV2"
FT                   /protein_id="ACB59736.1"
FT                   /translation="MEQKLKLWFTEHQTEDYGITFRVNHVYESEQTEFQRLEMVETDEF
FT                   GTMLLLDGMVMTTDRDEFVYHEMVAHVPLFTHPNPKSVLVVGGGDGGVIREVLKHPSVE
FT                   KAVLVEIDGKVIEYSKKYLPNIAGGLDDARVEVIVGDGFMHIAEAVNEYDVIMVDSTEP
FT                   VGPAVNLFTKGFYSGISKALKEDGIFVAQSDNPWFTPELIRDVQRDVKEIFPITKLYIA
FT                   NVPTYPSGLWTFTIGSKKHDPLAVAPERFHEIETKYYTPELHTAAFALPKFVKDLTI"
FT   gene            269867..270739
FT                   /locus_tag="Exig_0251"
FT   CDS_pept        269867..270739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0251"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: bsu:BSU37490
FT                   agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59737"
FT                   /db_xref="GOA:B1YHV3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV3"
FT                   /protein_id="ACB59737.1"
FT                   /translation="MRFDEAYSGKVFIASQPTHEDAKGVLYGMPMDWTVSFRPGSRFGP
FT                   ARIREVSLGLEEYSPYLDGDIADAKLFDAGDIPLPFGNAQKSLDMIEEYVDSLLTAGKF
FT                   PLGMGGEHLVTWPVVKAFDKHYEDFVVLHFDAHTDLRDSYEGEPLSHSTPLKKIANLIG
FT                   PENCYSFGIRSGMKEEFEWAKTSGYNLFKYEIVEPLKAVLPKLAGKKVYVTIDIDVLDP
FT                   SAAPGTGTQEIGGVTTKELLEVVHMIARADVDVIGADLVEVCPAYDQSDMTAIAAAKVL
FT                   REMMIGFIK"
FT   gene            271006..271800
FT                   /locus_tag="Exig_0252"
FT   CDS_pept        271006..271800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0252"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="KEGG: rrs:RoseRS_2469 LPXTG-motif cell wall anchor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59738"
FT                   /db_xref="GOA:B1YHV4"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV4"
FT                   /protein_id="ACB59738.1"
FT                   /translation="MKKLLSFVTAALLFALFVLPVGAADDAMVRVIHASPDAPAVDIAV
FT                   DGKKAVSGAEFKAVTDYLTLPAGEHKVEVFAAGTTKDPVLSQTLNIEAGKFYSVAAIGK
FT                   LADIKLAVMEDNGKGEDGKSMVRVAHFAPDAPAVDVAPKGGDPLFSDLEFSKVSDYGTL
FT                   DAGTYDLEVRPAGATDVVKALDGIKLDSGKNYTALAIGLLEGEPAFDVLLIPDGGEMAA
FT                   MPDTGLGGTTGTSSMATTWALVALAGAALVGTVYVVRRKQNA"
FT   sig_peptide     271006..271077
FT                   /locus_tag="Exig_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            271772..272380
FT                   /locus_tag="Exig_0253"
FT   CDS_pept        271772..272380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0253"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   bpu:BPUM_3508 possible C60 family sortase A"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59739"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV5"
FT                   /protein_id="ACB59739.1"
FT                   /translation="MSSVVNKTRNLLLLLTVLLAGCGGAEETSPPRSVEPATPVVESPA
FT                   PKSDAKTEAVETFIPNRLKIPAIDVNAKIEVVGKDAKGRMNVPEQTDQVGWYRYGAKAN
FT                   QTGNVILAGHLDDTNGPAVFYDLAKVKRGHRIEVSAKTGEQVSYVVTNVMSYPVDQAPV
FT                   GSIFGATLAQRLTLITCVGTFTQSKGYDQRLVVTAEQEK"
FT   sig_peptide     271772..271849
FT                   /locus_tag="Exig_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.857 at
FT                   residue 26"
FT   gene            complement(272434..273741)
FT                   /locus_tag="Exig_0254"
FT   CDS_pept        complement(272434..273741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0254"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   hmo:HM1_1276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59740"
FT                   /db_xref="GOA:B1YHV6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV6"
FT                   /protein_id="ACB59740.1"
FT                   /translation="MRNPFKAKSSMSAYQATIGFPDKRLITKTSDPSLTGRLEYMGYTE
FT                   EHLQTLKAMAPVVNSILDEVLEQVLDHLLLHPEMVQIAQTSSTRERLKKVFADYFGSLL
FT                   TGNMDDKFLAMRTRMGKTHNRNFVPVTWFIASYAAFNTLLIPKIVEHFQHEPAQLTNAI
FT                   LALNHAMNLDAQIVTSQYVDARLHEVSAANESRSRLLQDVVRVSQEVASTVEQTEGAIS
FT                   ETSRRATQILSETDQTEKTSRNLVGLTSENETQMEKMEHQFAQATSQVSTSLTSIQQLK
FT                   TTSDEIVKMTQGIEDIANQTNLLALNASIEAARAGEHGKGFSVVAIEVRNLAENAKLLS
FT                   SSINSLIQKNNGNINELVSQMEDITRSNSASRNELQQVKSGIHTVKQEMENYLEMFGRN
FT                   KNDLSQIVQTIQGISQTTQGLSALTTDLVAASEVNA"
FT   gene            complement(273949..274173)
FT                   /locus_tag="Exig_0255"
FT   CDS_pept        complement(273949..274173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59741"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV7"
FT                   /protein_id="ACB59741.1"
FT                   /translation="MVPKIEFVEHFDDNKGKRFKIELWNLGTFTFSAESAKGPVTRFTS
FT                   IDIQFVQTCVSRMRSIVDAQKAFQEDQPV"
FT   gene            complement(274223..275161)
FT                   /locus_tag="Exig_0256"
FT   CDS_pept        complement(274223..275161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0256"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3950
FT                   transposase (10)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59742"
FT                   /db_xref="GOA:B1YE98"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1YE98"
FT                   /protein_id="ACB59742.1"
FT                   /translation="MSYIHLTISERVKIETYLELGFSVRKIAGRLGRQPSTISRELKRN
FT                   PHYDSSHADQRYVERKKKCGARTKFTLEKGICILEKLRETWSPEQIAGRLFQEEGLSFK
FT                   TIYRWIYSGLVEADSGLLRQKGKRQKPRETRGRFNVGLPISKRPSDVKGRQTFGHWELD
FT                   TVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTD
FT                   RGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIA
FT                   QALAWINGRPRKCLNWKTAYEVFTEEVLHLI"
FT   gene            complement(275317..275523)
FT                   /locus_tag="Exig_0257"
FT   CDS_pept        complement(275317..275523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0257"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: sae:NWMN_2458 heavy metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59743"
FT                   /db_xref="GOA:B1YHV9"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHV9"
FT                   /protein_id="ACB59743.1"
FT                   /translation="MKETTLTIVGMTCNHCKASVESALNELDGVTNATVSLADNNVTVT
FT                   HEDVATERLVEAIEEIGYDVPTA"
FT   gene            complement(275520..277652)
FT                   /locus_tag="Exig_0258"
FT   CDS_pept        complement(275520..277652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0258"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: sae:NWMN_2457 cation-transporting
FT                   ATPase E1-E2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59744"
FT                   /db_xref="GOA:B1YHW0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW0"
FT                   /protein_id="ACB59744.1"
FT                   /translation="MSKTMELNIEGMTCAACSARIEKVLNRMDGVEATVNLPLETARIA
FT                   VPEEMDEQLILDKIKKIGYGATIKTTPHEQVQNRRMLYRFWIAAFLSLPLLLSMVSHIP
FT                   NSPVHLPWLMNPWFQFALATPVQFVIGAPFYVGAYKSLRSGSANMDVLVVLGTSAAYFY
FT                   SVAEMMIHPLMPNLYFETSAVLITLVLLGKVLEDRAKQQTTGAIKSLLSLQATDAVVLE
FT                   QGVERTVSLDQVQPGMQLIVKPGQKIPVDGIITTGDAYLDESMLTGEPLPAHKGTGDVV
FT                   IGGTLNTNGYLTIEATKVGQETMLAGIIRVVEQAQTEKAPIQRQADRISGIFVPIVVAI
FT                   ALVTLAVWWWTTGSFAEAIRPAIAVLVIACPCALGLATPTSIMVGTGKGAEHGVLFKGG
FT                   AQLESLQHVDAVVFDKTGTLTIGRPVVIETFGQEQALDFAAALEKKSEHPLAHAITEER
FT                   DVVFDIEHFTVDPGRGVRGSIMGHDVMVGSVRMMQEHGLSLPDWTSSGATVVYVTVNGI
FT                   IEAGYAIRDELKPTTKQVIQEIQQTKAVYLLTGDRREVALQLATELQIPHSHVFSDVLP
FT                   IEKADHIKTLQANGQRVAMVGDGINDAPALATANVGIALGSGTDVALEAADVTLLGHDL
FT                   QQVITAIRLSEQTMKNIRQNLFFALGYNAVGIPVACLGLLAPWVAGAAMAFSSVSVVTN
FT                   ALRLKRIPLSKGGNQS"
FT   gene            complement(277665..277961)
FT                   /locus_tag="Exig_0259"
FT   CDS_pept        complement(277665..277961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0259"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   lin:lin1968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59745"
FT                   /db_xref="GOA:B1YHW1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW1"
FT                   /protein_id="ACB59745.1"
FT                   /translation="MTHDHPLVPRSPEEQDALMKRLKRIEGQVRGIANMVAEDRYCIDI
FT                   LTQTASIQAALRQVELQVIERHVKMCMHDAATGKQDTDVYVDELMAVIARLKK"
FT   gene            complement(278123..279655)
FT                   /locus_tag="Exig_0260"
FT   CDS_pept        complement(278123..279655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0260"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcl:ABC1479 drug/metabolite transporter, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59746"
FT                   /db_xref="GOA:B1YHW2"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW2"
FT                   /protein_id="ACB59746.1"
FT                   /translation="MSHEKSATARPPYGILAVLMIGAFIAFLNNTLLNIALPSIMKDLE
FT                   IETSTVQWLSTGFMLVNGILIPTSAFLIQKFSVRRLFLLAMTLFSAGTILAGFADAFPV
FT                   LLAGRMIQASGSAIMMPLLMNVMLVSFPIEKRGTAMGFFGLIMMGAPAIGPTLSGWIIE
FT                   HYDWRMLFHFITPIALIVLVAGFVLLRDVKERSGAKLDFMSVVLSSFGFGGLLYGFSSA
FT                   GSKGWDSLQVILALVIGVVALVTFIMRQLRMERPMLNFKIYRYPMFALSSAISIVVTIA
FT                   MFSGMLLLPIYVQTIRGISPLDAGLMLLPGAILMAVMSPINGKLFDKIGGRPLAITGLF
FT                   ITVVTTYLFSQLKMDTTYTHLIVLYSLRMFGMSMVMMPVSTNGLNQLPTRYYPHGTAMN
FT                   NTLQQVSGAIGTALLVTIMSTHAKTRGTELAQEAAKNMTSQPTAEAAAAMKQQIVMQAT
FT                   LDGINYAFFISTFIAGLAFVLSFFIKRSTQAEDIISNRSLNEQIIKPQVSNQ"
FT   gene            complement(279887..280213)
FT                   /locus_tag="Exig_0261"
FT   CDS_pept        complement(279887..280213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK4430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59747"
FT                   /db_xref="InterPro:IPR022551"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW3"
FT                   /protein_id="ACB59747.1"
FT                   /translation="MTQLRKLQSISDFDQFVSEHPTFVICKHSTTCPISSAGFSAYTKY
FT                   ADETAVPTAYLLIQEARTLSNHIAEHYNVRHESPQVLYIQDGRAVWTTSHYDITSDALH
FT                   THVG"
FT   gene            complement(280219..281844)
FT                   /locus_tag="Exig_0262"
FT   CDS_pept        complement(280219..281844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0262"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: amr:AM1_1865 acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59748"
FT                   /db_xref="GOA:B1YHW4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW4"
FT                   /protein_id="ACB59748.1"
FT                   /translation="MNAAERFVQCLEAEGVTHIFGVPGEENITLLEAISKSDITFITTR
FT                   HETNAAFMASMFGRLSGRPGVCLSTLGPGATNMMTGIASATMDHSPVVAITGQGATWRQ
FT                   HKASHQMFDLVEMYRPITKSSTSIVSGEVISEVVRQAFAKAVSEKPGSTHLSFPEDIAK
FT                   ADVDAKMSFLQDSPPTFLHPTSVADSDVLLRIEQAERPVVIAGFGINRSGATEAFRAFA
FT                   ERLGAPVVETMMGKGALSSLHELAAHTIGLPNADYNQRILDQSDLIIAVGYDITELPPS
FT                   KWNPERTPVLHIDTNPHEIDQFYPVVANLIGSIPDILHLLSESIPNRAWTGWQQDRDRL
FT                   RQEIQATYSLALPLHPQSIVRELEQATGEDGMIFSDVGAHKIWLGRHFQTTRPNQLFIS
FT                   NGFSSMGYGLSSAIAAKLLHPEQRVLCASGDGAFLMNGQDLETAVRLKLPIVVIIWRDG
FT                   TYGLIEWKQQQAYGRAPYIEFDNPDLVQLATAFGALGLRVGEHGTLSSCLEQAFLSDGP
FT                   VLIDCPVDYRENLKLSDRLRTYGG"
FT   gene            complement(281841..283280)
FT                   /locus_tag="Exig_0263"
FT   CDS_pept        complement(281841..283280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0263"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: bha:BH3316
FT                   succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59749"
FT                   /db_xref="GOA:B1YHW5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW5"
FT                   /protein_id="ACB59749.1"
FT                   /translation="MNGKFLINGQWLDQGRERTDVKNPATGEVVGSVPNGTKSDVNDAV
FT                   EAAHNAFPDWSKRTVYERAALLEKLYAKMLEKKDELARLMTLEMGKPLAESEGEVEYAA
FT                   NFVKWFAEEGKRAYGRIIPSHDATKRLHVIKQPVGVVAAITPWNFPAAMITRKLAPALV
FT                   AGCTFVLKPPTATPLTALRLLELCQEVGIPDGVVNAVTGSGKDLGESLATHPHVAKITF
FT                   TGSTEVGRTLMAQGAETIKAMSLELGGHAPILVFDDCDLDLAVRETIKSKFRNGGQTCV
FT                   CGNRIYVSDSIYDEFVEKLGQETAKLKTGNGLDQETKIGPMINKAGYDKVKKHVDDATS
FT                   AGARIVTGGSGQTDDDNDVYYYEATVLADVTPQMLIMNEETFGPVAPVQRVSSDEEAVH
FT                   YANQTPFGLASYVFTNNYARAFKAIEHLDYGIVGWNDGVPSAAQAPFGGMKQSGVGREG
FT                   GSEGLEAYLETKYVSIGGLDQ"
FT   gene            complement(283312..283497)
FT                   /locus_tag="Exig_0264"
FT   CDS_pept        complement(283312..283497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW6"
FT                   /protein_id="ACB59750.1"
FT                   /translation="MIQDILHHFTYMQKFHFFTNYYRENTLHLLNYPTLFIDQFLAFCT
FT                   TFFGKENLFFNLRVYP"
FT   gene            283650..285350
FT                   /locus_tag="Exig_0265"
FT   CDS_pept        283650..285350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0265"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: bcy:Bcer98_0354 alpha
FT                   amylase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59751"
FT                   /db_xref="GOA:B1YHW7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW7"
FT                   /protein_id="ACB59751.1"
FT                   /translation="MTQMIPRPETAQKTLTRAWWKEAVAYQIYPRSFYDANNDGIGDIP
FT                   GIIAKLDYLKDLGVDVLWICPMFKSPNDDNGYDISDYEDIMDEFGTMADFDLLMEEAHK
FT                   RDIKVLLDLVVNHTSDEHPWFLESRSSKDNDKRDWYIWKDAVNGGEPNNWESIFGGSAW
FT                   EYDEKTEQYFLHVFSRRQPDLNWRNKDMRQAVYTMINWWLDKGVDGFRIDAISHINKDQ
FT                   SYADLPNPLGMPHVPSFEMHMNVEGIHEYLEELKNETFSKYDIMTVGEANGVTPEEADL
FT                   WVGEENGKMNMVFQFEHMDLWRADAEKGVDVVKLKQVLTKWQKGLEETGWNALYLENHD
FT                   KVRSVSLWGDEGQYWKQSAKSLAMMYFFMQGTPFIYQGQEIGMTNVQFPDISDYDDVAT
FT                   KNMYNMQLASGKTHEEIMEVIWNSSRDNSRTPMQWTNEQNGGFSEQSPWFGVNPNFADI
FT                   NVAAQQADEDSILNFYKRMIQIRKMEETLIYGEYDLILPEDTKVYGYTRTLGNEQFLIV
FT                   TNLKDEVAEVDTDIILHSDNIMLANYETTYHEGTELTLQPFEARLYRVR"
FT   gene            285371..285886
FT                   /locus_tag="Exig_0266"
FT   CDS_pept        285371..285886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0266"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   gtn:GTNG_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59752"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW8"
FT                   /protein_id="ACB59752.1"
FT                   /translation="MPNPAFAVAKKEIKKMQDRRKSCTLDDEVIEVKPVRYPVRLRQVT
FT                   SIQDDAMRESVELEADGTLFETKDGFALKFMQEDEQPIDTTIKWSHDQVALNRKGPVSM
FT                   HHVFILGQKTKSGYESQFGQMVMETETATIEMTEQRMQFQYDLMMNHQPVGLYTIELTW
FT                   ERSETHGV"
FT   gene            285876..286295
FT                   /locus_tag="Exig_0267"
FT   CDS_pept        285876..286295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59753"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHW9"
FT                   /protein_id="ACB59753.1"
FT                   /translation="MAFEQTVKEMEQMLEEDWFEWLENDEPKYNEWRDQLEALAEQVMT
FT                   EYNSKVDSDAIDSLLLINEDLPVLYGEDTVMLYTALLHARKEDDSVYERYLTILGAFSE
FT                   ENHPALREVEQAVSKKDYKTAYARAVKLPQSLGLE"
FT   gene            286376..286816
FT                   /locus_tag="Exig_0268"
FT   CDS_pept        286376..286816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0268"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: dra:DR_0550 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59754"
FT                   /db_xref="GOA:B1YHX0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX0"
FT                   /protein_id="ACB59754.1"
FT                   /translation="MRTLYRIVVGIVRQGDQLLLVKNQADGERAVWSLPGGVIEAGETL
FT                   ADALKREMAEETGLSVETFELAYVTENFIEQFDAHSLVTYFECTIRGELLPNDPDREVV
FT                   DSQWVPIEQLGDYLLNRDVLEPLQDYLNKASKSYYLYEQMVW"
FT   gene            286860..287903
FT                   /locus_tag="Exig_0269"
FT   CDS_pept        286860..287903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0269"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_1562 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59755"
FT                   /db_xref="GOA:B1YHX1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX1"
FT                   /protein_id="ACB59755.1"
FT                   /translation="MKAVQVNGYGGVEQLEVVERPVPTPRAGEVLVEVKACGINNTEIW
FT                   MREGAYGTDDKSGWKPEGVQFPRVPGSDISGRIIEVGSGVDPSRVGQDVVLFPFTSSGA
FT                   DGTEHISEDMSFIGSEYDGGYAEYVVWPATLCYDMPLDDYVKSAVFSVSGLTAWHMNEQ
FT                   LQLQPGQTVLVTGASGGVGSLNVQIASRVFGATVIAVVGDMKIEQELKRLGAKYVVSYR
FT                   SDQLTEDILAVNSGPVDAVLDVVGDALFKTALVVLKNGGKFCISGSAGGQQTNLDFRML
FT                   YLKHLTFYGSVLGTRDEFGRMLEAIADGKLEPVIDRTFPLEEAAAAQSYFKETGKLGKI
FT                   VLILKAD"
FT   gene            complement(288058..288402)
FT                   /locus_tag="Exig_0270"
FT   CDS_pept        complement(288058..288402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbh:CLC_2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59756"
FT                   /db_xref="GOA:B1YHX2"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX2"
FT                   /protein_id="ACB59756.1"
FT                   /translation="MNGILQHSSGLIKEVKAGFSWTTFFFGFFPAFFRGDIKWGLIQLI
FT                   VGIVTTLLTAGFGGWIVNIVFSFLYNKIYINDLIEKGYRPIDHSFQQALKQRGIHAKLL
FT                   SETPTSQSAV"
FT   gene            288605..290737
FT                   /locus_tag="Exig_0271"
FT   CDS_pept        288605..290737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0271"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bce:BC5345
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59757"
FT                   /db_xref="GOA:B1YHX3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX3"
FT                   /protein_id="ACB59757.1"
FT                   /translation="MGTFLLINWIAFLLVAGYAGYLFVTLVKSRYEAIRRGKKAEWTLT
FT                   NKERLNAVLVNVFGQKKLLKDKKSGTIHVMMFYGFLLVQFGAIDFIWKGLAVGQRFPHI
FT                   PLGPLYPIFTFFQEIVMLVILVAVVWGFYRRYVEKLVRLKRNFMAGLALIFIGGLMIAV
FT                   LFGNGFFLVYENHSTFGEPVASAIAFLFSWVPQQVAFGLFVFFWWAHLLFLLSFMVYIP
FT                   QGKHAHLIAGTANVWLGRTSKVGRLAPIDLSVMEEAEDDEAEFSFGVNRIEDFNQKQLV
FT                   DLYACVECGRCTNMCPASGTGKMLSPMDLIVKLRDHLNMKTAAITQKSPWAPAFAFEGS
FT                   QGNQIASLAAAGQMDVVPDSLIGNVITEEEIWACTTCRNCEDQCPVMNEHVDKIIDLRR
FT                   HLVMMEGKMDPEMQRTMANIERQGNPWGMNRKERENWRKTREELVVPTAKEKKKAGEEF
FT                   EYLFWVGAMGSYDSRSQKIAMAFARILNEADISFAILGNDEKNSGDTPRRIGNEVLFQE
FT                   LAEANIKSFEKYDVKKIVTIDPHAYNTFKNEYPDFGLSPDVEVYHHTELLARLIDDQRI
FT                   KPVHEVSERVVYHDSCYLGRYNDIYDAPRYILEKIPGITLVETERNREKGMCCGAGGGM
FT                   MWQEEKVGARVNVARTEQLLTVQPSVIGSACPYCLTMLSDGTKAKEVDEQVATYDVVEL
FT                   LERSIVGTPMKEAVTN"
FT   gene            290875..291273
FT                   /locus_tag="Exig_0272"
FT   CDS_pept        290875..291273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0272"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: bca:BCE_3393
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59758"
FT                   /db_xref="GOA:B1YHX4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX4"
FT                   /protein_id="ACB59758.1"
FT                   /translation="MRIFGKALLKIGQVAEATGLSKRTIDYYTSLGLLTTERTPAGYRL
FT                   YTEDVVQHIQKIEYLKTQRLSLQEILAFFTEREVKTGDAIYQEVQQLQESVNGLEQRLL
FT                   QSTDYEKQEIRLELSQRLTLIASLIAQL"
FT   gene            291308..292621
FT                   /locus_tag="Exig_0273"
FT   CDS_pept        291308..292621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0273"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: sha:SH2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59759"
FT                   /db_xref="GOA:B1YHX5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX5"
FT                   /protein_id="ACB59759.1"
FT                   /translation="MDTILFINLFLVVLLIVLTAFFVGSEFAVVKVRMSRLDQMIQEGN
FT                   KSAVLAKKIAGDLDYYLSACQLGITVTALGLGALGEPTVEKILHPVFDEFGVSAAVSTL
FT                   LSFGIAFVSVTFLHVVIGELAPKTLAIQYAEKMTLLFARPLYIFGKILYPFIWLLNGSA
FT                   RFFLGLFGVKPAGHEQAHSEDELKIIMAQSFQSGEINQTELALMQNVFAFDEHIVKDLM
FT                   VPRMRMATISERLSKDELMEIFMDNPFTRYPVTEENDKDRILGYVNVKEMLTDFANGNH
FT                   HPVTHYVKDLPVVSEVTSLQDTLRKMKKTRSHIVLVVDEYGGTAGIVAMEDLLEEIVGE
FT                   IRDEFDTDEVEEIQELPNNEYLVAGTVLLEDLEARFGMTFTNDEDVDTIGGWIQMHNID
FT                   LQPGEHIDTEAFSVEVIEMENYQINQIKLWLHPLEQAE"
FT   sig_peptide     291308..291394
FT                   /locus_tag="Exig_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.785 at
FT                   residue 29"
FT   gene            292801..294483
FT                   /locus_tag="Exig_0274"
FT   CDS_pept        292801..294483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0274"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; 5TM
FT                   Receptors of the LytS-YhcK type transmembrane region; KEGG:
FT                   bsu:BSU28930 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59760"
FT                   /db_xref="GOA:B1YHX6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX6"
FT                   /protein_id="ACB59760.1"
FT                   /translation="MLEQIPFLLSRLGMLALLAFLLSQWRISRHLFQTSSRRSHRFILL
FT                   GVFVVSGILMNYAGIGLSTDETIDPLIGLAVSPEQWVIDTRLTIIVTSGLLGGPLIGGL
FT                   TGVLVGFHRYYLGAFGAESAWIIAVGTGLLSGLYSRQWRRKDGYSLLQPIGIVLTAVIL
FT                   DIGVALMLAPDQALVLELTRQAVFPMLFTNAVGISVFIAILRTQLKIENELFVRESARS
FT                   YRLLDAIRPLRKSGMTVDVARKIGSTILEETKINRVVLLGPDGILADVRTGHDTADLFQ
FT                   HQTILEWVETAAVYRSEDELTRQIISFHPLQVEGKKAGIVCWFPVHLFDDTMERTMEQL
FT                   VDLLARELVVHQEEQLNQFPNTSIKPILSPNYLLGIVDEIHQTADPDTPVKQQLGALRQ
FT                   LLTTARRLDMYPLREELLTLKSYLSLEGIRRHHPLTPAAVTIDLDIETAVEEHFVFPLL
FT                   VTQLVDNALRHAFPQSGPYHRIDVRAFQEETHWVLEVSDNGVGIPAEFLKRWEQDKKTQ
FT                   TSNLFLLRRALHRRYGEQAGCTIYSRPGGTRLKLTLPLTTDQM"
FT   gene            294586..295614
FT                   /locus_tag="Exig_0275"
FT   CDS_pept        294586..295614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0275"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: lwe:lwe2424 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59761"
FT                   /db_xref="GOA:B1YHX7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX7"
FT                   /protein_id="ACB59761.1"
FT                   /translation="MITTKEVGFSGEQPIIAFTLMNRNGHSVELLNLGGKITAIRVPDQ
FT                   HGTIENVVLAFDDMEEYLEDPHHLGATIGRVGGRIANGAFALEGMNYILEQNEGEHHLH
FT                   GGSVNWSNRFFDYEIDGELLHLLLTSPDGENGYPGQLDVRLTIDWTDEDVLILTYHATT
FT                   TASTPFSPTNHTYFNLTGNAKTTIEQHRLRMDAPFYVPLNEESVPTGEILSVNETVFDF
FT                   RKARSLYEVTHASDEALRQAGSGVDHPFLLKEGGEIVLEEPVSGRILRVETDQPGVVVY
FT                   TGNHLAGDFTIAGRRATPYLGICLETQGLPDAINQPDFPSVVLRAGEVYEKRTTFQFSR
FT                   VQ"
FT   gene            295686..296540
FT                   /locus_tag="Exig_0276"
FT   CDS_pept        295686..296540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0276"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: lsl:LSL_0875 DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59762"
FT                   /db_xref="GOA:B1YHX8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX8"
FT                   /protein_id="ACB59762.1"
FT                   /translation="MTKIAWVTDSMAYFKKEEAEAIGVNVVPIQILLGETAYNEDTITV
FT                   ERLFRALEADKKLVAKTSQPIFGEFVGTYERLKEEGYDCAIAVHCTNGLSSTVQSSASA
FT                   AEAASFPVHIIDSHTAFENQQEFIRIGMALEAEGKSVEEITAALHALAKKTHFYMIVGN
FT                   METMRRGGRVSSGDLFLANLLSIKPIITTDEAGKIVPFKKARSLKKAYIEIIKQVEEAM
FT                   RQHTFYKNRIYVATTMAPEMAADLRTQVAAKFPELTVLDGTFGPAIGTHAGAETVGLFW
FT                   LND"
FT   gene            complement(296607..296954)
FT                   /locus_tag="Exig_0277"
FT   CDS_pept        complement(296607..296954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0277"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: btk:BT9727_4785 camphor resistance protein
FT                   CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59763"
FT                   /db_xref="GOA:B1YHX9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHX9"
FT                   /protein_id="ACB59763.1"
FT                   /translation="MNFLALATGAFFGAISRFALSQWTKTVWKKDFPLATFIINVLGSF
FT                   LLGLVIGSHLDSTWTLLLGTGFLGSFTTFSTFKLETLQLIQNQNRKTLVLYLGLSYLCG
FT                   IGAAFLGIILA"
FT   sig_peptide     complement(296889..296954)
FT                   /locus_tag="Exig_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.944 at
FT                   residue 22"
FT   gene            complement(296951..297352)
FT                   /locus_tag="Exig_0278"
FT   CDS_pept        complement(296951..297352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0278"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: btk:BT9727_4784 camphor resistance protein
FT                   CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59764"
FT                   /db_xref="GOA:B1YHY0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY0"
FT                   /protein_id="ACB59764.1"
FT                   /translation="MLYLLVGLAGILGASARYGLGLLIGNVVVGAFPWTTLTINLIGCF
FT                   VLGYATHFLFKTTLLHQYAMTALGTGFVGSFTTFSTFSVESVELLRAGVYSYAFAYISL
FT                   SLFGGLLLSYVGYLLGTRRLRRFQKEEVS"
FT   gene            297501..298973
FT                   /locus_tag="Exig_0279"
FT   CDS_pept        297501..298973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0279"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bha:BH1509 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59765"
FT                   /db_xref="GOA:B1YHY1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY1"
FT                   /protein_id="ACB59765.1"
FT                   /translation="MVSPLERLSTKILSRLIPVLITVAHPLIFIFAQIGYVPMSVFYQF
FT                   LAGGLLLTIALLAGNQFFGEKPSGKYIQIVLTYLVLALVLITLPSQSIWTIAYLYLTIS
FT                   IVYLIPHLVVLAGVLGLFELVLFTLLGTIVFTNTFDMIVAFVIYLMIFSAATFVAVFGR
FT                   NVMREVKRQQEKAEHYAETSQLTLRQSAATATDVTTFTEEMSETVDTAKVSFEKIDQAM
FT                   QMLADNSSKNAQSVRQIKRMNTDNVELMTDVATAVDRALVLSSSSKVTAEQSQATISEA
FT                   GESLQQLTESMDESVTAFGQLAGRFKEIVSITSSINAIATQTNLLSLNASIEAARAGEF
FT                   GKGFTVVAQEIRNLSAQTAAASTEINQIIERVDRDVMQTGNSIDASTNLLREQEARMQR
FT                   SQIALQTIAADSNDSVQAISGAQQQFATITNSLSNIAQATGQLDAFMDLLLTSSDQLSG
FT                   LTRSQVEQIGDLQQAIHTLNETALTLQQTAHA"
FT   gene            299075..300004
FT                   /locus_tag="Exig_0280"
FT   CDS_pept        299075..300004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0280"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bat:BAS3184 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59766"
FT                   /db_xref="GOA:B1YHY2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY2"
FT                   /protein_id="ACB59766.1"
FT                   /translation="MKAAYIEQYGGSEQFKVGELDRPIVGADDVLIAVHAASVNPVDWK
FT                   LREGYLKEMLSYDMPLVIGWDVSGVIEEVGENVTDLKVGDEVFSRPDIARQGTYAEYVA
FT                   VDAHLVVKKPEALTFEEAASLPLVAHTAWQVMFEVMDAKAGDKIFIGAGSGGVGTVAIQ
FT                   LAKAHGLHVITSTSTKNVDWVKALGADEVIDYKQEDPADRVRDLDFVFDTMGGDGQAKL
FT                   YQMLKPNGMLVSISTPPDEDQAKEAQARVAYVFMQPTGERLQHIAQAVERGELKPVVDR
FT                   IFDLDQIKEAHDYGEEGHAKGKIVIKVK"
FT   gene            complement(300278..301048)
FT                   /locus_tag="Exig_0281"
FT   CDS_pept        complement(300278..301048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0281"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: jan:Jann_1547 DNA polymerase, beta-like"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59767"
FT                   /db_xref="GOA:B1YHY3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY3"
FT                   /protein_id="ACB59767.1"
FT                   /translation="MHQLHAIEQLVARLRQDPAVEAIFLKGSFGRGEEDVYSDIDLYCL
FT                   VSEERMAKFLTRRLTHLSVYRPIIWKDDIFIVAPQLIVVYDDLLHVDLFTVTRESLNHS
FT                   DTIRVLYDPKRQLDAYVETSSLALGTQEAADEAIDSVWFLFQYQKAAGRGNGLWAVEML
FT                   RSALIKFAKVLLHRYVPDRAQLGLKTVPDYLPESPRLRLEAIYNVLVPATHIEAARLYR
FT                   EFLQEERSHLQQMLINQPDTLQLLDRLLASEQVY"
FT   gene            complement(301129..301509)
FT                   /locus_tag="Exig_0282"
FT   CDS_pept        complement(301129..301509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0282"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bcl:ABC0784
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59768"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY4"
FT                   /protein_id="ACB59768.1"
FT                   /translation="MEETPSCRVETALEILTGKWKPSILLELITHDTLRFSELKRNLPN
FT                   ITQKMLTAQLRELELNDIVHREIYQVVPPRVEYSLTDYGKTLIPVLNAINAWGEKHVEH
FT                   LAQKDMLQDTTPTLASSTSDSF"
FT   gene            301630..302484
FT                   /locus_tag="Exig_0283"
FT   CDS_pept        301630..302484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0283"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bld:BLi00862 YfiE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59769"
FT                   /db_xref="GOA:B1YHY5"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY5"
FT                   /protein_id="ACB59769.1"
FT                   /translation="MNINPNITLGPVSLRITNLEQSIAFYRDALGLTVLRQDEQTATLG
FT                   AKTTPLVILEQHSTAKQLPKNSVAGLYHFAILLPNRKELGFVIRNLIAQGIELGQGDHL
FT                   VSEAFYLSDPDGNGIEIYADRPRDTWTYEANGDVKMTTDPVDWQSMLVEAGEEDWYGMP
FT                   AETVMGHVHFHVKSLEAARKFYVETLGFDVAADASRMRALFLAAGGYHHHIGTNVWSGV
FT                   DAPKTPADAVGLKYWTLIYPDAASRETAVAALEQSPYEVNRQEDAVYVTDDAGITARLL
FT                   SKG"
FT   gene            complement(302536..303330)
FT                   /locus_tag="Exig_0284"
FT   CDS_pept        complement(302536..303330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0284"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sth:STH1381
FT                   hypothetical protein containing MutT-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59770"
FT                   /db_xref="GOA:B1YHY6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY6"
FT                   /protein_id="ACB59770.1"
FT                   /translation="MLHRRKTYTIRPERLQEFTEFFHTYLYPLQISHGARLVGRWVNEA
FT                   EDEVIAIWEYRDREHYEQVDRDVRGSTLRREAMKKRARLGKNLYIKSTEDFLTATGVYA
FT                   PPRAIVSVTAYITNEAGEVLLVRNLHRGDTYEMPGGQVENHESILDAVKREVKEETGAD
FT                   VTIEGITGIYQNVSSHVLCVAFRGTYTGGELRPQEGETAEVGFFDLNRENIDTYIKREH
FT                   FQLRTLDAMDPHYFPHALYKVRPYELISRYDGNAPSALSGQN"
FT   gene            303524..304114
FT                   /locus_tag="Exig_0285"
FT   CDS_pept        303524..304114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0285"
FT                   /product="membrane-associated protein-like protein"
FT                   /note="KEGG: lwe:lwe1889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59771"
FT                   /db_xref="GOA:B1YHY7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY7"
FT                   /protein_id="ACB59771.1"
FT                   /translation="MVDVMALVRLAGGIMFTPLSDDVLMMGYAALRIREGMHPVLIWLA
FT                   AWPVFFIAFAWFYLLARFFREIPLVKRLMKSKFLEQAESILERRGLWAIGLSFFLPGVR
FT                   HPIHYVAGLLGYPLSRYLAMTFVAAGLYTGLWTFLIVRIGQTVTWSELGMWLSEHPSMV
FT                   LLIIAALLTIIISGVVHAKRRNRLKKEEEFVTE"
FT   gene            complement(304226..305596)
FT                   /locus_tag="Exig_0286"
FT   CDS_pept        complement(304226..305596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59772"
FT                   /db_xref="GOA:B1YHY8"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY8"
FT                   /protein_id="ACB59772.1"
FT                   /translation="MKNTKKFAATAMAAALVLPGTAAFASGGGDDMKHEESAKNVTVKT
FT                   KAADLRATLDQLLSEHFVLAVMDMKKQYDGSKDAQYYEAALKQNALDMTPAIASVYGDE
FT                   GAKQFEKIFVDHNKYTTDLVKAVKADDQDGINASKAETEGFVQDLSSFLDTATEGKLPK
FT                   AAAEEVLRAHEADVYKTFQQYAAGDYEGSYNTFREGYSRMYDISKALSVAITTQMPEKF
FT                   DNTKADTKAADLRSTLNSLAAEHVALANISMTAGVDQAKDYDAANWAEDMHTADFKAAM
FT                   KSVYGQAGADQFEQVWTKNHIEAQANLVTAAINDDKKLMGDAQDMLKMFSNDFGAFLGA
FT                   ATEENLPTKAAQEAVSGHETYVQDTFMQYVEGDYKGSADTFRESYAYMYGVGENLGEAI
FT                   VKQSPEKFMDGTPGSMPNTGNGGMSDNNTAGTTGAIALFGLALGAAGIVLARKRQNA"
FT   sig_peptide     complement(305519..305596)
FT                   /locus_tag="Exig_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            306086..307465
FT                   /locus_tag="Exig_0287"
FT   CDS_pept        306086..307465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0287"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG: bha:BH1854
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59773"
FT                   /db_xref="GOA:B1YHY9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHY9"
FT                   /protein_id="ACB59773.1"
FT                   /translation="MNQLETRGTEQKTENRSASSFYRTVWRWHFYAGLIFAPFLVMLAV
FT                   TGSIYLFKPQIENVLYQKYYEVTPQENRISATAQINAVKANYPDASITKYRPGETDARS
FT                   SEVKIATAEASSTVFINPYTGKIIGELADDDRIMNKVEEIHGELMAGTIGDRIVELVAC
FT                   WAIVLIVTGLFLWFPRKKAAGWSGVLIPRLRQGKKIFRRDLHAVPAFWITAGMLFLILT
FT                   GLPWSGFWGANFQSVATNQGLGYPPSIWGGDAPVSAVQTKDVAEVPWAAETLDVPKSNV
FT                   EGLVPASIDDIVSIAKQQGMDPSFAISIPSDPAGVYTLSAYPAKAENEATIHLDQYSGA
FT                   VLADYRFANYGLVGKIVALGITLHKGTEFGLINQLISLAICLGIILVAVSGFYLWLKRK
FT                   PGKGMGAPKGPPAKSIKWFILVLIILGVLFPLVGLSLIVVWLVDFIIIRRIAVLRRFLN
FT                   A"
FT   gene            307458..307943
FT                   /locus_tag="Exig_0288"
FT   CDS_pept        307458..307943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59774"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ0"
FT                   /protein_id="ACB59774.1"
FT                   /translation="MRKSIQGLLVSGLIVTSTGLAGCSVTSDAAEHYAVSAPLSVKFEI
FT                   PKVLKADQEKQYRFGATLWQDQKAVKEAEYVHFEIWKADGTLRYSMEPADETKPGVYSI
FT                   EKKLPKEGLYYIKVHASSNGAMIMPTRQFIVGELSANDLKILQGGAKPAGGSSGHHH"
FT   sig_peptide     307458..307547
FT                   /locus_tag="Exig_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.657 at
FT                   residue 30"
FT   gene            308136..308333
FT                   /locus_tag="Exig_0289"
FT   CDS_pept        308136..308333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59775"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ1"
FT                   /protein_id="ACB59775.1"
FT                   /translation="MKMKKSYLAVPLSAALLIPAAGVSAHGHEDHSKMSHSSGKVSLDF
FT                   SSPASDLRATLDQLLSEHAY"
FT   sig_peptide     308136..308219
FT                   /locus_tag="Exig_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.876 at
FT                   residue 28"
FT   gene            complement(308572..310362)
FT                   /locus_tag="Exig_0290"
FT   CDS_pept        complement(308572..310362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0290"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: lwe:lwe1306
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59776"
FT                   /db_xref="GOA:B1YHZ2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ2"
FT                   /protein_id="ACB59776.1"
FT                   /translation="MKSFNRSTTYMPGLDGLRAFAVIAVILYHLSVPMLTGGFLGVDVF
FT                   FVLSGYLITGLLLSEWQQTGRIDLKRFWVHRFRRLFPPLFVLLVLVLSYVTVFERDLLH
FT                   MLRQDIMAALVYMTNWWYIVHDVSYFESFGKPSPIQNLWSLAIEEQFYLIFPIVLSFGL
FT                   ASKRLLLRGIALLALLSALLMAILFTPGMDPSRVYYGTDTRLFALLIGSLLAFAWRPER
FT                   FKKEIPSRGVRLLNVTGAVIVPVLVVLMLVTSEYGRFLYYGGFVFVAVLAALLIAVVAH
FT                   PASFWSRLFAAQWLIAIGKRSYGLYLWHFPLITLMTPIEQTGTFSWLRNLGILVILVIV
FT                   TELSYQFVERPVRRLGLLGYIRQFQIHPRTFRQFSRTKWVSVSLASLLLLSFIGNLSIL
FT                   AVSDEPAQQSIPTVAAPHSKPVLVKKPTNPVPEKRTRSMCRPTLAIGDSVLLGVEDYLG
FT                   SKLQQVTIDAKLGRQLREAIPLSTKYAAYNHTDHQVILHLGTNGSFRPEQLEELLDRFA
FT                   NADQVYLVTTRVPRPWEREVNTMLKQAAERKRVTLIDWHAVAVKHPSYFEQDGVHLNIK
FT                   GARAYSKLLAKATGCAPTTK"
FT   gene            complement(310499..311065)
FT                   /locus_tag="Exig_0291"
FT   CDS_pept        complement(310499..311065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0291"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ent:Ent638_3817 osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59777"
FT                   /db_xref="GOA:B1YHZ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ3"
FT                   /protein_id="ACB59777.1"
FT                   /translation="MFDFLKEAIQSPKTIGAIAPSSPRLAQMMAQRAVADHPDVIIEVG
FT                   AGDGAITQALLRARHPETTYRYAGPAHLSVQAAPNLLRRLIENLVRNATLHGTGDLSFE
FT                   VLQESGHLTFRCSNAIPETLTPHQLTELATPFVTSDMSRSNGGSGIGLSIIEQIVARHN
FT                   GTMQLTSEQNRFIVSVVLPDAYKEG"
FT   gene            311231..312286
FT                   /locus_tag="Exig_0292"
FT   CDS_pept        311231..312286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0292"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: cbd:COXBU7E912_0849 metal binding domain of
FT                   Ada/methylated-DNA-[protein]-cysteine S-methyltransferase;
FT                   TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   methylguanine DNA methyltransferase ribonuclease domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; SMART: helix-turn-helix-
FT                   domain containing protein AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59778"
FT                   /db_xref="GOA:B1YHZ4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ4"
FT                   /protein_id="ACB59778.1"
FT                   /translation="MMNTLPETDYYEALVRRDGSYEGTFFVGVKTTGIFCRPTCPARKP
FT                   KQENCEFFETAKEALLASYRPCLRCKPLAYPGDSEVITRLIAAVEANPEKRFKDADFRE
FT                   LGLDASTARRQFKKRFGMTFVEYARSRRMGLAMKEIRKGQPVIEVQLASGYESSSGFRD
FT                   AFARILGETPKRWSGAYLQAKWLDTPLGPMLAIADEGGLHLLEFVDRRGLEREVERLRL
FT                   TARAVIIPGDAPVFEQVTVQLEEYFAGTRDRFDLPLVLYGTPFQRQVWEQLCLIPAGET
FT                   ISYQELAVRVGNPAAVRAVARANGANQLAILIPCHRVIRLAGDLGGYAGGLARKAALLK
FT                   LERTKRGLNHR"
FT   gene            312283..313338
FT                   /locus_tag="Exig_0293"
FT   CDS_pept        312283..313338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU09810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59779"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ5"
FT                   /protein_id="ACB59779.1"
FT                   /translation="MSLIKDVFTDEWLDRLGKALNATDFRKTVQQEDWEELAFKQRVRR
FT                   IATRLEHHLPAEFEQAATRLETIAPDFPGLPGIVFPDYIEIQAEEGDWDRAMLALERLT
FT                   PHSTSEFAVRRFLLDDQDRFLEGATRWSQSSDEHVRRLASEGTRPRLPWGQMIPSLIAD
FT                   PRPVLPILDSLLEDDALYVRKSVANHLNDIAKTHPELVIERLERLGTHSHTDWILRHAS
FT                   RTLLKQGHRDVLKAFGLVTRGTVTVDELTVTPTLAIGGELAFSFHVTTTEPQVLRIEYA
FT                   IDYVKKRGTSQKVFRISERQVTGRETFAKRQSFRNLTTRVHYPGTHQVTILINGEAYAT
FT                   TEFDVTKEETT"
FT   gene            313335..313661
FT                   /locus_tag="Exig_0294"
FT   CDS_pept        313335..313661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59780"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ6"
FT                   /protein_id="ACB59780.1"
FT                   /translation="MKGRHPDFTTSRLSITATDTANGCIWVLKKRENEQVALIQLTGQQ
FT                   LSSDAIDPSDRDGYIQEALTVILSYLARTLLLPFVTGEGGEAEIWLENGFYKDGPVFRR
FT                   DLTH"
FT   gene            complement(313900..314196)
FT                   /locus_tag="Exig_0295"
FT   CDS_pept        complement(313900..314196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59781"
FT                   /db_xref="GOA:B1YHZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ7"
FT                   /protein_id="ACB59781.1"
FT                   /translation="MNQSKQTYLPVFLTLGLLLFNMLTSYLLSGQFFPNLSLWVPIGLN
FT                   VLVGLGYIVSLVMGLRSTNNYVKWFSMLANTAFLLSLSVITFMLLLANGISEP"
FT   sig_peptide     complement(314107..314196)
FT                   /locus_tag="Exig_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.553 at
FT                   residue 30"
FT   gene            complement(314193..314777)
FT                   /locus_tag="Exig_0296"
FT   CDS_pept        complement(314193..314777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC2859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59782"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ8"
FT                   /protein_id="ACB59782.1"
FT                   /translation="MKFVMLLGPQAVGKMTIGQELEQKTGMKLFHNHQTIDLLHPYFDF
FT                   TKPAHHKLKDLIRREMFKEMAVSDLEGVIFTFLCLFGVEGGGIEFIEETVQLFEEAGAE
FT                   VFIVELEAALSTRLARNQTENRLLHKFTKRDIAASEANLLETAEHYRTHSLPGELPYPN
FT                   YLRLDTEGRSAGESAETICRHFNWSTNLVER"
FT   gene            314918..315442
FT                   /locus_tag="Exig_0297"
FT   CDS_pept        314918..315442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0297"
FT                   /product="NUMOD4 domain protein"
FT                   /note="PFAM: NUMOD4 domain protein; KEGG: gfo:GFO_2427 HNH
FT                   endonuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59783"
FT                   /db_xref="GOA:B1YHZ9"
FT                   /db_xref="InterPro:IPR010902"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:B1YHZ9"
FT                   /protein_id="ACB59783.1"
FT                   /translation="MEHWKMIEGYEGMYQVSTAGNVRSLDRIIETSRGVKQRRKGVVLR
FT                   PRINQEGYRKVTLYQQGRGERYYVGELVVKTFIDGEAVQERIIRADGNRLNDQVDNLTV
FT                   KPTVSQAYASLLDEFESLLSQHIELSPRQIRAIRYRYQTGQSIRRLALTYQVTENRIRN
FT                   IIDKKEAQYVI"
FT   gene            complement(315509..315694)
FT                   /locus_tag="Exig_0298"
FT   CDS_pept        complement(315509..315694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59784"
FT                   /db_xref="GOA:B1YI00"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI00"
FT                   /protein_id="ACB59784.1"
FT                   /translation="MDMKEEKKKSKMPFFVILVIIIFVAVAAALIIYVTSEPKEETLQF
FT                   MQMTTSFVSAYLPVAS"
FT   sig_peptide     complement(315611..315694)
FT                   /locus_tag="Exig_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.832 at
FT                   residue 28"
FT   gene            315853..316938
FT                   /locus_tag="Exig_0299"
FT   CDS_pept        315853..316938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0299"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bsu:BSU09120 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59785"
FT                   /db_xref="GOA:B1YI01"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI01"
FT                   /protein_id="ACB59785.1"
FT                   /translation="MLSQFNQFLLNFSLLITSLLFAFLPLRHVKLISPASPVKLRILIG
FT                   FIAGFISVLLVLNSITYDGAKIDLRLVALVTAYYYGGWVSGGITTLSILGARFAVTPPG
FT                   AYEGLILTGLICIALLITASIYRRFASHTLKDYLVLIGIGIGYSLPALYLLTETFNRFL
FT                   EIALVYIIFILLGGYVTYSFLQELRKHFQFVQTQQELALTDGLTNLANRRKLDETLASY
FT                   DKYGFAFSVLIVDIDFFKSVNDTYGHDGGDVVLRQLSHLLEHCCPDQALVGRYGGEEFV
FT                   VLLPDTPLKDAVRLGETIRLACADQHFVFSTYPAFHVTLSIGAASSDQGETSFEVIQKA
FT                   DQSLYQAKQTGRNKVVAYSEE"
FT   sig_peptide     315853..315921
FT                   /locus_tag="Exig_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            complement(316996..317982)
FT                   /locus_tag="Exig_0300"
FT   CDS_pept        complement(316996..317982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59786"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI02"
FT                   /protein_id="ACB59786.1"
FT                   /translation="MKHTLTYLSLPLAALLLTGCAAEEPVSQELKVEQQSEQKKIPEQT
FT                   KPVQEKPKTTDADSEQTTGAASLKPASPAAKPSAKEALFSGYKQIQVDGGDLSGDREPN
FT                   VVVNIGFGDREYWAFTNEHAQLVKVVAKKITLQNDAEETTSSGRYYSDEAKVPGVESPQ
FT                   LDEGHVIADSLGGVSNAYNITPQDSTLNRHGDQAYMENTIRKAGAVTDFEATITYPDTT
FT                   TQIPSHYHYTYTLRGNKIVDDFDNVNPDEVNAELGLTENKEEPAPAPADPELTSDTTGD
FT                   VSTVDTNGNGQVTIQEAKDAGFSMPITDDHWLYPYMRDNDHDGMVGE"
FT   sig_peptide     complement(317914..317982)
FT                   /locus_tag="Exig_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.714 at
FT                   residue 23"
FT   gene            complement(318218..318628)
FT                   /locus_tag="Exig_0301"
FT   CDS_pept        complement(318218..318628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0301"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cmi:CMM_1935 conserved
FT                   hypothetical protein, putative MutT-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59787"
FT                   /db_xref="GOA:B1YI03"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI03"
FT                   /protein_id="ACB59787.1"
FT                   /translation="MTTIVTAVKGIVQYDNRILIVQRAAADSGGGTWECPGGKIDFGEQ
FT                   PEDSLKREIEEETGLAVTVDRIAYASSLMTHPDRQVILLVYFCTATNDAVQLSDEHDDY
FT                   LWADDAMFRQNIAPNILTDFEQHHIFRKLLLS"
FT   gene            complement(318625..319284)
FT                   /locus_tag="Exig_0302"
FT   CDS_pept        complement(318625..319284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0302"
FT                   /product="peptidase S51 dipeptidase E"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   ava:Ava_0337 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59788"
FT                   /db_xref="GOA:B1YI04"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI04"
FT                   /protein_id="ACB59788.1"
FT                   /translation="MRDQQLFLFGGGPPFTPMLCRQFVSCLKQSGPVALLYVPRPGSNW
FT                   DDYAPIYTDALTANGVTDFFHFPLSARPTSEQLEQLAGSAGIIISGGETERYQQFIVGT
FT                   PIGTIIQERFQHGVPVAGFSAGALLTPDECRIPVIDQRNGQALVLKGLGLLTDAVISVH
FT                   YDTWQEETNLSDAFMKTASNFGYGLPERSGIHLKNGQLMQQEGPEVVLLRQKGEYI"
FT   gene            complement(319302..319811)
FT                   /locus_tag="Exig_0303"
FT   CDS_pept        complement(319302..319811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_0852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59789"
FT                   /db_xref="GOA:B1YI05"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI05"
FT                   /protein_id="ACB59789.1"
FT                   /translation="MKRLKPYRFFLTMAVLLLGLLLIDPVRGQHAARLSLKSLLDMLLL
FT                   LPPILVLVGLLDQWIKKDTLLKYMGPDAGAQGYLYILLLAAIAAGPLYVAFPVAVLLLE
FT                   KGASVRYVVFFLGAFTTVKLPVLLYEISSFGLIYTALHIGFGLLFFFMTAQLFERYQTA
FT                   LQMKSF"
FT   sig_peptide     complement(319716..319811)
FT                   /locus_tag="Exig_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.640 at
FT                   residue 32"
FT   gene            complement(319808..320290)
FT                   /locus_tag="Exig_0304"
FT   CDS_pept        complement(319808..320290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59790"
FT                   /db_xref="GOA:B1YI06"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI06"
FT                   /protein_id="ACB59790.1"
FT                   /translation="MGNSIVLYGLVLLLSSFSFYKDKQKTQAAFAKAWKIFTNLLPDLL
FT                   AILLFVGLSLSILSPAQISALLGQDAGFLGIILSLVIGVIALIPSFVVFPLGATLLENG
FT                   AGLAQVSALMASLMAVGIMTIPLESRLFGKRFAYARNLSALMMCLFFSLLVMEVLG"
FT   gene            complement(320283..320621)
FT                   /locus_tag="Exig_0305"
FT   CDS_pept        complement(320283..320621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0305"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: btl:BALH_0853 transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59791"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI07"
FT                   /protein_id="ACB59791.1"
FT                   /translation="MKHTGRHTGAFLLLFLAKGPTYGGDLLQRCEQELPFNPIDSAILY
FT                   RTLKKLEEEGFVTSILTTSPRNKMVKMYQITSSGRAQLDRFHEDIEQKLQNLLYFQTHY
FT                   AKQVKSDG"
FT   sig_peptide     complement(320550..320621)
FT                   /locus_tag="Exig_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.672 at
FT                   residue 24"
FT   gene            320820..321191
FT                   /locus_tag="Exig_0306"
FT   CDS_pept        320820..321191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59792"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI08"
FT                   /protein_id="ACB59792.1"
FT                   /translation="MTMSDNHIHQFRYRESGMGEEQLFTWTVATRELQLEEGTGEETIV
FT                   LLSGRQQQELTRRLEKAGVIDWQPEYTTEWLILDGTYWEISWSGSEGNGASQGNNAYPE
FT                   HWELLRDWLYRQFEKEEFR"
FT   gene            321188..321568
FT                   /locus_tag="Exig_0307"
FT   CDS_pept        321188..321568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59793"
FT                   /db_xref="GOA:B1YI09"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI09"
FT                   /protein_id="ACB59793.1"
FT                   /translation="MKKWWIGLAVLGGYCIPFVYLALLEDFRTGTLLGYLLLLVGFTVL
FT                   AFIGQRWGHLLFVVAGNIVSYFISIYFAGRMDTFGWDGYFKPLTAEQLILLVSLLMLIP
FT                   QLIAIVVAMSLEAKKRIKKITK"
FT   sig_peptide     321188..321256
FT                   /locus_tag="Exig_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.503 at
FT                   residue 23"
FT   gene            complement(321607..321996)
FT                   /locus_tag="Exig_0308"
FT   CDS_pept        complement(321607..321996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0308"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: cpy:Cphy_1493
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59794"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI10"
FT                   /protein_id="ACB59794.1"
FT                   /translation="MSSFQKIETTNAPAAIGPYSQGFIANGTLYASGQIPINPATGEMV
FT                   AGGITEQTEQVMKNVDAILKEAGLTPNRVVKTTCYLTSMDHFAAFNDIYSDYFAPHNHF
FT                   PARSCIAVKELPKGALVEVEILGLV"
FT   gene            322107..322430
FT                   /locus_tag="Exig_0309"
FT   CDS_pept        322107..322430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59795"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR038735"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI11"
FT                   /protein_id="ACB59795.1"
FT                   /translation="MPLYHKLVRDQIPTIIARNGKKATFRTLNEEEFLVEAKRKLHEEV
FT                   AEYEEATTTEEAVEELADLLELIHVLARTHGTTPEQLEAIRLKKNDKRGGFDDKLYLIE
FT                   VED"
FT   gene            322427..324751
FT                   /locus_tag="Exig_0310"
FT   CDS_pept        322427..324751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0310"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bcy:Bcer98_0759 type III
FT                   restriction protein res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59796"
FT                   /db_xref="GOA:B1YI12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YI12"
FT                   /protein_id="ACB59796.1"
FT                   /translation="MIPAAKLTTHDLYASLVDAIDQADEVYIVAAFAQRSGVELLLPAL
FT                   RHAVERGADVHFLIGDYLHITDPEALAELLKLDGLSIRFYRSGGRAFHPKAYLFRNAET
FT                   GLSIVGSSNISKSAFRTGVEWNLHLPQAVAPHILDEAIEAFMDLYLSEAAQDLNPIVLE
FT                   AYRQEHDARQYVAEPEVDYAEQQLVMSEEILPHRVQEEALRALRETMEEGRTRALTVLA
FT                   TGLGKTYLSAFFARDFKRILFLAHQRELLEQAERSFKKVESNWQTAFYIGSDRTNDEQT
FT                   DVLFGSVQTLSQNRHLERFAQDYFDLIIIDEFHHAAAKSYQKVLAHFEPRFLLGLTATP
FT                   DRMDGADVYALCDNNVAFQMHFTSAINEGFLTPFHYYGIHDVIDYSQLRRMGRKYDAME
FT                   LEQAQIDRTVSENIYAAWSKHRQTKTIGFCSSIRQAEYLAQTFREMGHQVIALTGQTIN
FT                   RRERIQEFEQGTVEIVFTVDLFNEGVDIPKVDTLLFCRPTESIAIYTQQIGRGLRLANE
FT                   KSHCVIIDLIGNYKNVETKLMLLGTVKDKLKRGDKEPITPPKGCIIEFDTQALNIIHRM
FT                   RQPNQRKLRLIESYEQLKLDLGRRPTYIEIGQLTAVPTGYKQEWSSYVGFLKEQGELTD
FT                   EEIETYDANRELIEQVEKTVMNRSYKMVVLLAMLERGEGRWMEPITAEEVAPFFYEYLH
FT                   AEKYREVKDAQGKVFENGYNESKIVTLLKQQPFPKMVYPFETTEDQKTLYIQKDLKTTN
FT                   RILMKWITDIVHFRIESYFSS"
FT   gene            324841..325269
FT                   /locus_tag="Exig_0311"
FT   CDS_pept        324841..325269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59797"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB4"
FT                   /protein_id="ACB59797.1"
FT                   /translation="MLIPEKETVVKMISERYNCALTIMKQKKIMYEGTTRNDKSVVLCT
FT                   PETKLHNQEHGWFDLSTKQVEILDGADMAIMAVRIEGNKVYFVEFKNLRRLMTADMILD
FT                   YSKDEKWRFYIWEDHIKVRGNDEKFYVSGEVVKTVEHV"
FT   gene            325862..326458
FT                   /locus_tag="Exig_0312"
FT   CDS_pept        325862..326458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0312"
FT                   /product="Protein of unkown function DUF1819 putative inner
FT                   membrane"
FT                   /note="PFAM: Protein of unkown function DUF1819 putative
FT                   inner membrane; KEGG: chy:CHY_2656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59798"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB5"
FT                   /protein_id="ACB59798.1"
FT                   /translation="MTIELEYSSSMNGASYLLFELKQVVKLKQEGFSIEEIRSKVVDEN
FT                   LFQFENKGRIKRTLPSVMKRAHVIDSALAILMLEGSIEMSKVINLYAIMKTDLLFFEFM
FT                   DEVISEKLRNGDYLIEKKDINLFFEAKLEQSEKISSWSDINIEKLKRAFMQVLFESGFL
FT                   KSRQSKELGHIIIDEQIKEYLNRIGDVRYVRAMGE"
FT   gene            326468..327034
FT                   /locus_tag="Exig_0313"
FT   CDS_pept        326468..327034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0313"
FT                   /product="Domain of unknown function DUF1788"
FT                   /note="PFAM: Domain of unknown function DUF1788; KEGG:
FT                   swo:Swol_2495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59799"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB6"
FT                   /protein_id="ACB59799.1"
FT                   /translation="MANLNARLDSIIPKIKEEKFIDGRGLGNEISFYVFDYEAKDELIV
FT                   RDYVKHIKKEFNYEGTDRSIIEFDLYKMLIEITKEKRIFDRVFDMEEHQGKDALFRAMT
FT                   AFAKPEVFVQKIKEQLDDHNVVFLTGIGKVYPFVRSHNILNNLQEVLDKTPVVMFFPGT
FT                   YDGQSLQLFSKFKDDNYYRAFRLVD"
FT   gene            327084..330662
FT                   /locus_tag="Exig_0314"
FT   CDS_pept        327084..330662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59800"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB7"
FT                   /protein_id="ACB59800.1"
FT                   /translation="MLLKEMFLKDIERDIRGVIKVAQTNEKDIYQELDEYVVTQELHKH
FT                   FSKFYDNYQKGINGKTDKMGVWISGFFGSGKSHFLKILAYLLENQSVKGKHPIDFFENK
FT                   VQDTLVYSNMKRTADVDTEVILFNIDSKSSLGSKSKEDAILRVFMKVFYDHRGYYGDIP
FT                   GVAEMEKYLDKRGFYETFKQEFYTLAGEMWDERRNSFYFDADYIIGALTKATDMSEETA
FT                   RDWFNEGVNNFEISIEKFSRDVKEYIDEKGPKFHLVFLVDEIGQYIGDSRDLMLNLQTL
FT                   TEDLGTHAQGKVWIMVTSQESIDSIVKVKGDDFSRIQGRFDTRLSLSSISVDEVIKKRI
FT                   LEKHKHVNDKLKVLYPEKSAILKNLISFTGSTADLRGYNNEQEFAEVYPFVPYQFKLLQ
FT                   NVFEQVRKHGSSGKHLSEGERSMLSAFKEAGLRYKDEEEGSLIPFYAFYDTIKEFLNPS
FT                   ISRVIEGATENSVLKDDRFNQDLLKVLFMIKYIKELPASIDNIATLMVAHIDEDKLQLK
FT                   EKIKASLRKLIGQTLIQKNGDHYLFLTDDEQDINREIKQMNIDEDIIKRELANYIFQDL
FT                   YEDKRFTYNKFHSFSFNQKMDEKNYGAQTSSIGLHILSPLSDNYQKSDQEMMMITSDSS
FT                   EMIIKLGGSEAYIEEIEEALKIEEFRKKKNITQLPENIQNILNNKQAEVRERRRRVREL
FT                   LDDAIKNGSFFVNGDKMDSKGSSVKEKINFAFKQLIDNVYFKLGYIKEHIENEQQLIVI
FT                   LASINDQLSLDDSIVTKPNELAKREVYEFIDMQNQAQKQNYVKAIYERFQDKPFGWKQL
FT                   DIAGLLVELLKEQRIRIRYHSEYLEPEVDTDKLIKVLGKASELGKGLIFKRVKVDGALI
FT                   QTAKRVCREVFNTTDLADDEDGLVKDIRVLIGKQIDEINLYKVRYEGRKYPGMSLLDKG
FT                   LEYFTQFEQKIDNATFFTKLTELEEELIDWEEDIFYVKSFFDTNQKEIFDQGLAGLNKY
FT                   EENKAYLTDSIVTVAMTSLESIIQNPIPYRKIKEIPELIYKLEKQMTSLLSEKKNNVQE
FT                   KLKADNDELSLHARQYGVSNETTQQIEERYTSFQTNLDAFTDIYKVDATIAQSTSFKER
FT                   SILSIKREIAEWQRKKEEEHQGGHGDEVVDPPISPLEIRTESVKVKNLVDINTLKTEQD
FT                   VDKYINALSHKLKQIIKSNKEIKFID"
FT   gene            330742..334266
FT                   /locus_tag="Exig_0315"
FT   CDS_pept        330742..334266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0315"
FT                   /product="putative restriction enzyme"
FT                   /note="KEGG: chy:CHY_2653 putative restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59801"
FT                   /db_xref="GOA:B1YIB8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB8"
FT                   /protein_id="ACB59801.1"
FT                   /translation="MNKSALKKFAIEARRELLEKVELQARKLGITAESIQKVSVESSDA
FT                   VFIEGRQLSDTERKQRNKLIARINDIGFDRVMGETAYTWFNRFVALRYMEVNEYLPTKV
FT                   RVLSSNSDSAEPDMMKEALSLNLNLDKDYVYDLKLNNKTDELFKYLIKMHCNDLNRYMP
FT                   FMFETIEDYSEILFPEGLLGTDSFISQMINLEFIPEENWKQTEVIGWLYQYYIAEEKDR
FT                   VFKAKNKYKAEEIPFATQLFTPDWIVQYMVQNSLGRYWTEAHPEHNYLIANWEFFLKHE
FT                   QEDFQEKIAPYVNKELNVEEIKCFDPAMGSGHILLYMFDVLYEIYSKCGYTEREIPRLI
FT                   LENNLYGLDIDDRAYQLASFSMVMKALQYNRRFLRSIEKEGLILNLAAIQETNSWSDDV
FT                   ISYVAGDDKETRISSTKAFFEEYKNAKTFGSLIQAKETDLTYLEKRLQEIKENPIADIF
FT                   ETKKRDQVITALPLLIKQTKIMSKQYDIVVMNPPYMGSGSMNKELSDFLIKNYPDSKAD
FT                   LFAAFMEVDHYLKQNAFYAAINQQSWMFLSSYEKLREKVIKRKSIDTMLHLGPRAFEEI
FT                   GGEVVQSTAFVLRNTEIRDYKGTYLRLIGNRAADEKRDKVIGAVQNSSIAYRYSFSQEN
FT                   FRKIPGSPIAYWVGNKIAESFVQNTLLGEIANPRIGLVTGDTGRFLRMWFEVADEKINF
FT                   GASSSLDAKKSKRKWFPYQKGGTYRKWYGNNEYIVNWENDGHEIIHDNSVNGRVKSHNY
FT                   NGMYAFNEAITWTKITSGAPAFRFVPFGYLFDDAGPLCSVNNKLNFFPILALLNSVVGE
FT                   FYLSLTNQTMNILPGSIIKTPFYKEVMEKHNIIEKLVTNSIAISKRNWDCYETSWDYKK
FT                   HPLIEYDTKSFRLSFEQWERIAETEFNQLKLNEEEIDYIFIEIYGLEDELTSKIEDNDI
FT                   TIHKADLGRDTKSFISYAIGCSFGRYSLDKDSLIYAGGEFNMSQYKIFPADEDNIIPIL
FT                   SGTYFEDDIVTKFVDFVRITFSEETLEENLDFIAVAIGRKKNETAREALRRYFLNDFYK
FT                   DHVQVYKKRPIYWLFTSGKEKAFNCLIYMHRYDKTTLSRMRTDYLHEVQIRLDAEKKDL
FT                   LNVIEGDLTTKEISSAKKALKSLDKKIDELKAYDELLHHMADMQIEIDLDDGVKVNYEK
FT                   FKGLVAKI"
FT   gene            334297..336855
FT                   /locus_tag="Exig_0316"
FT   CDS_pept        334297..336855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0316"
FT                   /product="PglZ domain protein"
FT                   /note="PFAM: PglZ domain protein; KEGG: swo:Swol_2489
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59802"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR014060"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIB9"
FT                   /protein_id="ACB59802.1"
FT                   /translation="MNMAQIESTLQDIFNEPLKDGEQRKLVFWVDKDEEFTEEIGQLAL
FT                   PNVKVQALSDRNSFYIKHLLEEEDSTSFYLIYTTLELSVEDNWLVDTVLYSKTFFADRI
FT                   SLILNELQIDSSLRAIIKKHERFFNNKERFRKFQSFAIESYSEETIELAIMSVLCNVKT
FT                   PDFEAVLKEVLIDTLDEGENKLLSQLERFFDMDIFWRYVANYYGYVRETKTLKTLFIHL
FT                   TVTAFTHSISDEYLTSVKDFIAVRNKANALVFIDHWMHHKTDSIVFDQYAEMVEQEIKL
FT                   PSILQDIPVDEFKQADTFPYIDKVIIIYIANNLMERLEDYEEYTKLIKLRRVKHYYEKY
FT                   ASIYEALYYTVKMQEFYKAHQQGISQGSVIDLYKAYRDEYFVMDTYYRKFYVAYDEESN
FT                   HELVKKLKELVEHLYTNWFIGELSSHWSQSVKSEMVEEWSLPGITSQQSFYSSAVAPHV
FT                   RKGERVFVIVSDAMRYEVGLELIDLLNFETTGICEMQSMLGVVPSVTKLGMAALLPHRK
FT                   LDFDENGRVLVDGKDSAGLENRKKIIESYVEDSLAIHFQDMLAMNKAARRETFKGKRVV
FT                   YIYHDTIDAMGDKASTEIYTFNAVETSLNQLKALVKMIRDDLGGTNIYVTADHGFLYQR
FT                   DALEDSDKISNEVLNAVEVKRRYVLSKEKRKISGQLGINLSSIVDNEEQLTAYVPNGTI
FT                   RNRMQGTGVNFVHGGASLQEVVVPLVVYKNKRAGQKGSYALQKVDIKLTSSTRKITNSI
FT                   FNLNFFQTEKVEDKMIPRTVVICIEDIDGTVLSNEETIIGDRTFDNPGDRIFKLQFVLK
FT                   SISYDRNKMYYLLVKDLETGVVTEKIPFSISLGIVSDFDF"
FT   gene            336872..338929
FT                   /locus_tag="Exig_0317"
FT   CDS_pept        336872..338929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0317"
FT                   /product="ATP-dependent Lon protease"
FT                   /note="KEGG: swo:Swol_2488 ATP-dependent Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59803"
FT                   /db_xref="GOA:B1YIC0"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR013473"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC0"
FT                   /protein_id="ACB59803.1"
FT                   /translation="MAEETDGTSTLDLDKKLNDIFAGRVVRKDLTKLIKEGANVPVYVL
FT                   EYLLGMYAATDDEQSIQEGVDRVKKILTDNFVRPDESEKIKSRIRELGQYSIIDKVTVA
FT                   LNPKIDTYEAEFSNLGLKGVPIPSNFVKEFDKLLVGGIWCMVKIDYYYDEEGRASNPFS
FT                   VSSLQPIQMPNMDMNEVFEGRKQFTKNEWIDALIRSTGMEPTQLEERVKWHLLLRLVPL
FT                   VENNYNMCELGPRGTGKSHVYKEISPNSILVSGGQSTVANLFYNMSTRKVGLVGMWDCV
FT                   AFDEVAGIRFKDKDGIQIMKDYMASGSFARGKEEKNASASMVFVGNINQSLDVLLKTSH
FT                   LFAPFPEEMANDTAFFDRMHYYMPGWEIPKMRPDFFTDKYGFIVDYIAEFFREMRKRSF
FT                   ADSTDRYFKLGNNLNQRDTIAVRKTVSGMVKLIYPNGIYTKEDIEEILRYALEGRRRVK
FT                   EQLKKIGGMEFYDVMFSYIDKETLEEEHVSVPEQGGGKLIPEGMGKSGHIYVVGHGNSG
FT                   MIGVYKLENQVVSGTGKFDKSGVGSSRETKESLDTAFRFFTANSKSISNTISTKTKDYL
FT                   MHISDLQGIGLTNELAIAELIGLCSAALDKSVQESTVVIGNMTVGGTIAKVEEFASVLQ
FT                   VCVDAGAKKVLIPASSVMDLQTVPPDLLVKVQPVFYADPTDAVFKALGVN"
FT   gene            339207..340520
FT                   /locus_tag="Exig_0318"
FT   CDS_pept        339207..340520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0318"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cch:Cag_1600 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59804"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC1"
FT                   /protein_id="ACB59804.1"
FT                   /translation="MIIKEITMKNFHGFKERHITFSDQFTVLVGNNGTGKTAVLDGLAV
FT                   ALGSYLSGLNGVHSRHIKRDEIYREIYIHGGLSDIQMQFPVTVSCRGYVEGEYLEWSRS
FT                   VNSEKGSNTSKEAKPIMEYASKIQSMVSKGQSAILPVISYYGTGRLWVQKKDQNEKQKK
FT                   SNRLEGYSYCLDPASHEKHFLKWIEKMTYIELQRKEAPTVLSAVKKAISTCMKDWETLE
FT                   FDVDSEELRVIGKDNNAIPFRLLSDGIRNTIGLVADLAHRMAQLNPALKESVVELTPGV
FT                   VLIDELDLHLHPSWQRRIISDLKRTFPKVQFITTTHSPFIIQSLEEGELRRLHEEDDDE
FT                   VVSREEFVNRSIEDITENVMEIPYVQRSQKQIEMYNVAQQYYKLLKEGKNISSDEVENI
FT                   KNKLDDLESLYSEDIAYYAFLQMERKAAGLEREEDETN"
FT   gene            340507..341214
FT                   /locus_tag="Exig_0319"
FT   CDS_pept        340507..341214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59805"
FT                   /db_xref="GOA:B1YIC2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC2"
FT                   /protein_id="ACB59805.1"
FT                   /translation="MRPIERGSIPLDRDQNEIEFNFYQQSRGHLLTRLGSYCSYCERYL
FT                   GGNIAVEHVRPKSKESNLELEWDNFLIACNNCNSIKGDRSIELDKYLWPDKDNTTLAFI
FT                   YITGGLINVSPNLNPEVIEIAENTIKLTGLDRVPSDDPFLNPEMKDRRWSERRTAFEKA
FT                   ERAKRNLFVNNTESMREQIVDTALSTGFFSTWMTVFLHDIDMLKRFIDAFPGTSKACYN
FT                   SSYTPITRVGGTL"
FT   gene            complement(341418..341846)
FT                   /locus_tag="Exig_0320"
FT   CDS_pept        complement(341418..341846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0320"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: cac:CAC3689 uncharacterized
FT                   conserved protein, phnB family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59806"
FT                   /db_xref="GOA:B1YIC3"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC3"
FT                   /protein_id="ACB59806.1"
FT                   /translation="MPITPYLVFNGNTREAIHYYAKVFGQDVPDIMEFGPGNGPDGQPF
FT                   EKDVQSLVLHSQLIVHGTRVMFSDAMPHDPVAIGQNVTLALHLPDIQVIHETFDKLAQD
FT                   GNIIMPIQKTFWSEAYGIVKDPFGVQWQLNHEVSEIAE"
FT   gene            342059..343072
FT                   /locus_tag="Exig_0321"
FT   CDS_pept        342059..343072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0321"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: bha:BH1928 transcriptional regulator (LacI family)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59807"
FT                   /db_xref="GOA:B1YIC4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC4"
FT                   /protein_id="ACB59807.1"
FT                   /translation="MGTIYDLAKITGFSITTVSKALNNYSDVSEKTKAKIVQAAADMGY
FT                   LPNAHAQSLSTKRSWTIGVMFSEANEVGMMHPFFNAIIESFRKATEQQGYDLIFASRNL
FT                   RNRDMSYLEHFQHRAVDGIVVICSDQMDKHVQELIQSSIPIVVVDMDSTDCSVVFSDNL
FT                   SGGTLAVNHLYELGHRLIAHIAGDMTIDAGLARIEGYKQAMDRLALPIPDGYLINGGFF
FT                   SVEEGKQAMQTLLALPKRPTAVFVAGDQMAIGAMEAIHEAGLQVPHDISVVGYDDIEMS
FT                   KYVTPKLTTVRQDTERIGQHAAELLIEQIVNKKRVMTTDIIPVDLIVRQSTGPVKA"
FT   gene            343374..343629
FT                   /pseudo
FT                   /locus_tag="Exig_0322"
FT   gene            complement(343701..344873)
FT                   /locus_tag="Exig_0323"
FT   CDS_pept        complement(343701..344873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0323"
FT                   /product="transposase, IS605 OrfB family"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: bcy:Bcer98_3357 transposase, IS605 OrfB
FT                   family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59808"
FT                   /db_xref="GOA:B1YIC5"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC5"
FT                   /protein_id="ACB59808.1"
FT                   /translation="MLKYKAYKFRIYPTKEQKILITKTIGCSRFVFNHFLAKWEETYKA
FT                   TGKGLSYGSCSKEIPMLKEAFDWLKEVDSTSVQTSVKHLADAYDRFFKKQNERPRFKSK
FT                   RKPVQSYKTNIQGKSQLPEISIHASRLKLPKLKWVRFAHSKQVEGRILNATIRRNASGK
FT                   YFVSLLVEQEINEMPKTGSSVGVDVGLKNFAILSDGTVYKNDRYFRTLEKRLVREQRKL
FT                   SRRQLIALNKKVKLSEANNYQKQKRKVARIHEKIVNKRTDFLHKVSTEIVKNHDIIGIE
FT                   TLQVKNMQQNRKLSKSISEVSWSEFFRMIEYKADWYGKTVVKVGKTFASSQLCSSCGHQ
FT                   HKDVKHLGLREWTCPSCGIHHDRDVNAGLNLKQEAERILASSTVGTTGLA"
FT   gene            344965..345912
FT                   /locus_tag="Exig_0324"
FT   CDS_pept        344965..345912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0324"
FT                   /product="Carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding CenC domain protein;
FT                   KEGG: cth:Cthe_2809 glycoside hydrolase, family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59809"
FT                   /db_xref="GOA:B1YIC6"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC6"
FT                   /protein_id="ACB59809.1"
FT                   /translation="MRVSSPDFNKYTGKDYHFPDSGQLEQWHTYAVDYVRVYDLTNRDY
FT                   REPVDPVTRDFTFKAKAQMKKGQTATLTQRGVQLQEDHQYVLRFKADSKRSKQIQVKAK
FT                   NADGTTAYLPTHDVPLTKQTTTVDIPFTMTQATDLNSQLQFNFGTAKGEVTLDDVELMD
FT                   VTPIEVDRSPLKNGSFTDGLNFWSSYVHYDAQAVVSTVNDAAKLAIASEGQEPWSVLLE
FT                   QGNLQLVKGQTYQLTFKASSTVARPLEVTVENAAYTRYFSQIVELGTEAKTYQFDFTLG
FT                   QDDTAGLKFLLGKAAGSPFAAHDVTIDDVKLEVK"
FT   gene            346070..346543
FT                   /locus_tag="Exig_0325"
FT   CDS_pept        346070..346543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59810"
FT                   /db_xref="GOA:B1YIC7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC7"
FT                   /protein_id="ACB59810.1"
FT                   /translation="MVRSTKQYVALFVVLLIAIISINAWPASLYPDGSIGLLQIAASFV
FT                   WLIFLTASVVLIREEKTLLFVFYYLSFGFVAGTVVYLITFFERYWLGDFWFDIVSAIQY
FT                   PFYYLFAVPLFGFNAWFDVLYGQFALFAGFAYIVLAIGVSVQSKKIEAKRLRY"
FT   sig_peptide     346070..346144
FT                   /locus_tag="Exig_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.803 at
FT                   residue 25"
FT   gene            complement(346604..347875)
FT                   /locus_tag="Exig_0326"
FT   CDS_pept        complement(346604..347875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0326"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M20; peptidase M42 family protein;
FT                   KEGG: pth:PTH_1208 di- and tripeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59811"
FT                   /db_xref="GOA:B1YIC8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC8"
FT                   /protein_id="ACB59811.1"
FT                   /translation="MTNATILLARHGLSRDDQFNKTHVACLTDSILQYPVVDWNDRQLI
FT                   EWIQQVPFENLPGREAMIDPSTNDLPYQSFDPYIRGIVRWLNALDIPTLSCCDGHGRGR
FT                   ASVVLKQAPSLKQWQLLQLALPYQMTMGLTQLTLHLDYRKSGFPSLLLLAERLYRLTED
FT                   RTYLETLRLEQFKHRLLTWLDIPGVSKRERLVAMHLRNHLRSSTDFLYTDKRGNVLATI
FT                   QCGVGPTVLLSAHMDTVELIEEDRTILEDGTTLRSSSGILGADDRAGITAILEVLDRVQ
FT                   NTNFSGTLKLAFTVQEEIGCRGAEGIDPEFLHDVDGAIVVDRRGTRDIVTACRNQIPFC
FT                   IQEFGQLFEEAGCLAGMTDWQTTTNGGSSDAKVFAGFGIPSVNLSVGYTHEHTEHETVD
FT                   YAATFETVTLIESVLHHQLIPLRT"
FT   gene            347965..348909
FT                   /locus_tag="Exig_0327"
FT   CDS_pept        347965..348909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gtn:GTNG_1992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59812"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIC9"
FT                   /protein_id="ACB59812.1"
FT                   /translation="MEQSEHLKEKRPGHRFPRRTVEEMELRRKMRLNHFVRQAEFFKLS
FT                   ETPDFVQAKKWLLQALRIEKNHPIANYRLGYLLYREHQYELAVYHFKTALDGTETDVLS
FT                   ETQLMLANTFLVNCGMAITREALRELEDLEFRIEGEIDQERIERYRAEMLVQEENMLDR
FT                   LYYRKITAAHETIINEEQFYDIRPDKGELLLRSSDDGKTLQVFGKPAESLNLHMFLTLV
FT                   LLNQKSFQPYPVLQDALSELGGQRISYNYMRQLIRRIRDQFVTLNLIESTSISSPDSSR
FT                   PVQGFRIHPNWSVTILCRADDFIHPIQKERSDV"
FT   gene            complement(349149..350087)
FT                   /locus_tag="Exig_0328"
FT   CDS_pept        complement(349149..350087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0328"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3950
FT                   transposase (10)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59813"
FT                   /db_xref="GOA:B1YE98"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1YE98"
FT                   /protein_id="ACB59813.1"
FT                   /translation="MSYIHLTISERVKIETYLELGFSVRKIAGRLGRQPSTISRELKRN
FT                   PHYDSSHADQRYVERKKKCGARTKFTLEKGICILEKLRETWSPEQIAGRLFQEEGLSFK
FT                   TIYRWIYSGLVEADSGLLRQKGKRQKPRETRGRFNVGLPISKRPSDVKGRQTFGHWELD
FT                   TVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTD
FT                   RGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIA
FT                   QALAWINGRPRKCLNWKTAYEVFTEEVLHLI"
FT   gene            350320..350619
FT                   /locus_tag="Exig_0329"
FT   CDS_pept        350320..350619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59814"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID1"
FT                   /protein_id="ACB59814.1"
FT                   /translation="MNKAVKLIITGVLSLSLISVTSAESHAATKAKAFQNCTEMHKKYK
FT                   GGVSKKAGLKNRTGYDKKGKAIYKDTKYKAYVSLAIYKLNTKSDRDKDGIACER"
FT   sig_peptide     350320..350403
FT                   /locus_tag="Exig_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 28"
FT   gene            complement(350663..350986)
FT                   /locus_tag="Exig_0330"
FT   CDS_pept        complement(350663..350986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0330"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: bwe:BcerKBAB4_2128
FT                   thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59815"
FT                   /db_xref="GOA:B1YID2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID2"
FT                   /protein_id="ACB59815.1"
FT                   /translation="MSNYIKSEDTFKELIASETPVIIKFEADWCPDCKRMDYFMPDVES
FT                   QFSELPIYTIDKDEFPEIASDNVVMGIPSLLVFQNNEKLGHLHSANAKTPEEVTDFLKK
FT                   NFN"
FT   gene            351288..352157
FT                   /locus_tag="Exig_0331"
FT   CDS_pept        351288..352157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0331"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   cbh:CLC_1570 cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59816"
FT                   /db_xref="GOA:B1YID3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID3"
FT                   /protein_id="ACB59816.1"
FT                   /translation="MDQQKYDNLKLGERGAIISIIAYIVLSIIKLVVGYTADSAALRAD
FT                   GLNNTTDIIASIAVLIGLRISRRPADDNHKYGHWKSETIASMVASFIMMAVGLQVLIDT
FT                   VSTLFEGKQESPDIVAAYVGIGSAVVMYFVYRYNRNLSRKINSKAVMAAAKDNLSDAWV
FT                   SIGTTIGIIGSQFGMPWLDIVTAIVVGFLICKTAWDIFSEASHELSDGFDEQKLKMYED
FT                   VIFDLEGVKGIKSIKGRNYGNNEVVDVVILVNSQLNVHQAHDIATKVEDTLTNEYGVYD
FT                   IHVHVEPE"
FT   gene            complement(352199..352540)
FT                   /locus_tag="Exig_0332"
FT   CDS_pept        complement(352199..352540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0332"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   bwe:BcerKBAB4_3247 protein of unknown function DUF437"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59817"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016645"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID4"
FT                   /protein_id="ACB59817.1"
FT                   /translation="MLHNMGLYEEPFHSIQTGKKVIEIRLNDQKRQAIKVDDLIEFKNL
FT                   SNGEQLTVRVTKRETFKDFQSLYEKISLEAIDCIGWSMPELLKSTYAIYLKEAEQQFGA
FT                   LALTIEIIE"
FT   gene            352739..353227
FT                   /locus_tag="Exig_0333"
FT   CDS_pept        352739..353227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0333"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: mex:Mext_2899
FT                   regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59818"
FT                   /db_xref="GOA:B1YID5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID5"
FT                   /protein_id="ACB59818.1"
FT                   /translation="METEQKEPVRSTAMMQSFWNVQRHLVRAAHQTAQENGLSLPQFHS
FT                   LMTIAPRSPITQKELTAHTHLPKSTLSQSIEGLVQAEWVIRETNPDNRREVVLRLSDHG
FT                   RQFVETIKQQEAGMQQRLEQVLDQIDPAVFEQMLQTHAQIAEGLKEILSPGNGGCTDD"
FT   gene            353220..354944
FT                   /locus_tag="Exig_0334"
FT   CDS_pept        353220..354944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: amt:Amet_2176
FT                   ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59819"
FT                   /db_xref="GOA:B1YID6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID6"
FT                   /protein_id="ACB59819.1"
FT                   /translation="MIKLLKNLTTYKWAVFAVLILVFAQSMSDLYLPTLMADIIDKGVV
FT                   TGDTAYIWKIGAVMLGITGLGALAAIAASYYSSKAAMGLGRDIRRKVFNHVERFTLQEF
FT                   DQLGTASLITRTTNDITQVQQVVIMMLRMVVSAPIMFVGGLIMAVSKDAKLSLVIVAAM
FT                   PVLVISILLILWKGVPLFGQVQKRLDRLNLVLRENLTGIRVIRAFNRESQEKVRLTKAN
FT                   ADLTDVSIKVNKIMAFLMPVMMLVMNLTVVGVIWFGGIRINNGGMQIGDLMAFIQYVMQ
FT                   IMFALVMASVMFVMIPRAAVSAKRINEVLEMEPTMVDAGTASADQERGTLVFDGVTFSY
FT                   PGAEAPVLSDISFTARPGEITAVIGGTGSGKSTLVNLIPHFYDVTEGSIQVNGVDSQAV
FT                   PQEELRSKIGFVPQKALLFTGTIAENIRFGKEDATDEEIRHAAQVAQATDFIERMPDRY
FT                   ESMIEQGGSNVSGGQKQRLSIARALVRKPDIYVFDDSFSALDFKTDATLRKALKQETQD
FT                   ATVLIVAQRVSTVMDADQIIVLEEGRVAGIGTHDELYETNEVYQEIVKSQLSEEEIA"
FT   sig_peptide     353220..353306
FT                   /locus_tag="Exig_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.850 at
FT                   residue 29"
FT   gene            354941..356803
FT                   /locus_tag="Exig_0335"
FT   CDS_pept        354941..356803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0335"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: sth:STH2015
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59820"
FT                   /db_xref="GOA:B1YID7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID7"
FT                   /protein_id="ACB59820.1"
FT                   /translation="MSTSNTKRPAGGPPGGGPGGGNMMMMGEKPKNFKATFRRLLGYLK
FT                   PRRNALIAVFVAAILSTIFMIAGPKIMGTAITELFEGAYAKFQGVPGAAIDFTKIGQIL
FT                   LLLAGLYVVSSLFSYLQQYLMSGIAQKTVYDLREDVNQKLERLPLKYYDGRPNGETLSR
FT                   VTNDIDTIGSTLQQSVTSFITSIVTIVGILIMMLTISPLLTLISLVSLPISIFAIRPIL
FT                   KRSQKYFADQQRTLGQLNGHVEEMYTGHPVVKAFGHERRAVEQFDAVNEELYEAGRKAQ
FT                   FISGIIMPMMMFIGNISYVLISVVGGILVTQRSISIGDIQAFITYTRQFTQPITQTANI
FT                   ANIVQSTVAAAERVFELLDEEEEVKEVTTHHLTKADGAVAFEHVDFGYGEQLLIEDMNI
FT                   DVKPGQTVAIVGPTGAGKTTLINLLMRFYELNSGVIRIDGIDTRKMSREDLRTTFGMVL
FT                   QDTWLFNGTIRDNLAYGKTGATEDDIVEAAKTAHADHFIRTLPDGYDTVLNEEASNISQ
FT                   GQKQLLTIARAVLADPPIMILDEATSSVDTRTEIFIQQAMKRLMEGRTSFVIAHRLSTI
FT                   KDADLILVMDQGRVIEQGTHEALLEANGFYADLYNSQFSEKEVV"
FT   gene            356946..357245
FT                   /locus_tag="Exig_0336"
FT   CDS_pept        356946..357245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0336"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sgo:SGO_0842
FT                   rhodanese family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59821"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID8"
FT                   /protein_id="ACB59821.1"
FT                   /translation="MKNMSTNELEEILQQEKTIQLIDVRETDEYAVGHIKQAKNLPLSE
FT                   LSERTDELDAGRPLHVICLSGGRSMNASTYLEQAGFDVTNVDGGMMSWEGDVTK"
FT   gene            357276..358682
FT                   /locus_tag="Exig_0337"
FT   CDS_pept        357276..358682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0337"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: gka:GK2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59822"
FT                   /db_xref="GOA:B1YID9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YID9"
FT                   /protein_id="ACB59822.1"
FT                   /translation="MLLRYFYDEKLAQASYMVGCQMTGEAIVIDPSRDIEGYLKEAAKE
FT                   GLHIVATAETHIHADFVSGTREFAERFDTTAYLSDEGDADWKYEFAADIDAKLVTDGNR
FT                   FKVGNVTFEVMHTPGHTPEHVSFLLYDRDQTVPMGIFTGDFVFVGDIGRPDLLEEAAGI
FT                   QGTTAVGAKQMFESLKRFKALPDFVQVWPGHGAGSACGKALGAVPTTTVGYEKQTNWAL
FT                   QVEDETAFVKELTTDQPEPPNYFAMMKRVNKKGIVATPTLSKPRVAEATELETLVNTMQ
FT                   VVDTRSGKSFASGHVPGALNIPYNSKFVTWAGWLLDFDHDIAVIAEFRLLEEIQTDLQS
FT                   IGLDRFVTLVDIADLSPEQLTEQYPDWSAEQAIEAAEAGEVVVLDVRNKTEWDAGHYEQ
FT                   AKRILLGKLSSRYKEIPVDRPIAVHCASGVRSRMAVSVLQSLGMKNVINIDGGYAALQP
FT                   VLDRQALTEK"
FT   gene            358866..360671
FT                   /locus_tag="Exig_0338"
FT   CDS_pept        358866..360671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0338"
FT                   /product="Conserved TM helix repeat-containing protein"
FT                   /note="PFAM: Conserved TM helix repeat-containing protein;
FT                   KEGG: bsu:BSU09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59823"
FT                   /db_xref="GOA:B1YIE0"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE0"
FT                   /protein_id="ACB59823.1"
FT                   /translation="MKNFWNTTSFDVNGILGTLGNILGALIVFLIGWLIAKLIANGIQK
FT                   ALEKSGVVNKLSPQKEGTPPQKKKWTPEKIIGTVIFWVLMVFVLILVFNILNLNIIAGP
FT                   LADTMSTLLAAIPNILKAALILLFAYVIAVVLRMIIVKGGTKLMSNEKVRSNKMLQGQT
FT                   DLSNYPKIAGEIVFYLVLLLFLPGVLGALNIESVSEPFSQLLSSFLGFIPRLIAAAAIF
FT                   FVGFLVAKIVRDIVTNFLHAVGTDKFASRFNIGTNEQKDTKSLSSILGTVVFILILIPI
FT                   TISALDQLNIKGITGPAINMLNDVLGMIPNIIIGVVLILVGLYVGRFVKKFVADLLSRL
FT                   GFNNLTRHLKIGNWDANNASTSPSSIVGSLVEIVIVVLFVVEAFNLIGLDFMVDLGRAV
FT                   LAFLPSVLTAIIILAIGIIISNLVKRTMDSLFANSDLKVLSSVAKYAILALAVFMALDQ
FT                   LGVAATIVNSAFILILGAVALAFGLAFGLGGRDNASRYLDRLQKKAENADIDTSNLPSN
FT                   NTSSASTKPSLKEAAKGAASKAADDVTPDQAPKASKPSSSLNVNPTHGTPKGALPKNDL
FT                   AQQDDYPIGPDTNRGPNLDHPNDRP"
FT   gene            360907..362295
FT                   /locus_tag="Exig_0339"
FT   CDS_pept        360907..362295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0339"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   rme:Rmet_0207 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59824"
FT                   /db_xref="GOA:B1YIE1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE1"
FT                   /protein_id="ACB59824.1"
FT                   /translation="MSLLRKKDVSVMMDQKSHSKLARHLSGFDLVLLGIGAIIGTGIFV
FT                   LTGTGALYAGPALPVAFIISAIVCALAALCYAEFSSMIPVSGSVYTYTYATIGELVAWI
FT                   IGWCLILEYGLASSAVATGWSGYFQSLLSGFGISLPTALTAAPGAVPGSETFFNLPAFL
FT                   ILMVITLLLSMGIKETKRVNNIMVLVKVAVVVLFIVVGIWYVEPGNYTPFAPFGISGVL
FT                   QASAIAFFAYLGFDAVTSAAEEVKDPGRNLPIGILGSLAIVTVLYVVVSAIMVGIVPFK
FT                   QFEGVDSPVSLALKVAGQDWVAGFVDLGAIVGMTTVILVMTFGLVRLLFAMSRDGLLPK
FT                   IFSDVNEKSHTPVKATWILGTTAGLIAGFVPLGTLAELINIGTLAAFALISIAVVILRK
FT                   TRPDLKRAFKVPWVPFLPILSVLACIMLMLNLQTFTWIAFFIWTAIGLLVYFGYGRSRS
FT                   KLQQ"
FT   gene            362401..363186
FT                   /locus_tag="Exig_0340"
FT   CDS_pept        362401..363186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0340"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   btk:BT9727_2346 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59825"
FT                   /db_xref="GOA:B1YIE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE2"
FT                   /protein_id="ACB59825.1"
FT                   /translation="MIHIKRAPDTETAYLVMKEGFSDYMIPLGLSPEVFQERILERDGN
FT                   QLEHSFIAYHGERPVAIWLNGLKTIKKKTVMRCGGLAVDPQYRRLGIAKALYDAQLSYA
FT                   KSLNVDCLMLEVIQGNEPAITLYKSFGYQTVSELGYFHKEESGQVEPLVEIDQVAFERR
FT                   YIQQDEYIWQQDPGVMKLAKARYYELDGAFIAAVNESIFAILTDEEEVARVATEATRRL
FT                   AGELYHLQSTNQQVWEELLKAGWQQRDLKQFIMQKPISV"
FT   gene            complement(363251..363322)
FT                   /pseudo
FT                   /locus_tag="Exig_0341"
FT   gene            complement(363364..364050)
FT                   /locus_tag="Exig_0342"
FT   CDS_pept        complement(363364..364050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59826"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE3"
FT                   /protein_id="ACB59826.1"
FT                   /translation="MKKLLVSACLFSVLSIQPLHSEAASYSKKIKQDFTIYDQAKKKYT
FT                   VSMRSSKASCHKATSNDIWWIKGKDELCSGKFVLYLNGKSTNYKYTYTKSNPYVFSTTD
FT                   AKTSAVLKNKTGYPTVFSLTNKETYSFLNLKTYTVLNKKLTKQSNTLTSYAIKPKMNGN
FT                   LVQAPIYDNGGYGFGYVFNDLTVSGTKWIDERSHDYISQDPNSKRYKNGVSEMKKYQNS
FT                   LSYFVK"
FT   sig_peptide     complement(363985..364050)
FT                   /locus_tag="Exig_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.550 at
FT                   residue 22"
FT   gene            complement(364173..364643)
FT                   /locus_tag="Exig_0343"
FT   CDS_pept        complement(364173..364643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0343"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcy:Bcer98_2852 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59827"
FT                   /db_xref="GOA:B1YIE4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE4"
FT                   /protein_id="ACB59827.1"
FT                   /translation="MNYVETLRKQVGHTPLILVGAVVLVVKDGHILLEQRNETQARFGL
FT                   PGGLMEWAESTDETARRELLEETGLIAEKLTLLGVYSGKNYVTTLANGDVFQSVSLAYV
FT                   ASETTGTLRISAESVALTYFSLKDLPEQIVGSHRVMIEDYLNQNRPKFSLSK"
FT   gene            complement(364640..365740)
FT                   /locus_tag="Exig_0344"
FT   CDS_pept        complement(364640..365740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0344"
FT                   /product="Nitric-oxide synthase"
FT                   /EC_number="1.14.13.39"
FT                   /note="PFAM: Nitric oxide synthase NOS; KEGG: gka:GK1676
FT                   nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59828"
FT                   /db_xref="GOA:B1YIE5"
FT                   /db_xref="InterPro:IPR004030"
FT                   /db_xref="InterPro:IPR017142"
FT                   /db_xref="InterPro:IPR036119"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE5"
FT                   /protein_id="ACB59828.1"
FT                   /translation="MSTLLTEAERFFHDYIEQYPQEAHRLHEVREEILRTGTYTQTLQE
FT                   LTYGAKLAWRNSNRCIGRLFWEQLHVIDARDALTVESIRDTLFHHMEYATNDGRIRSTI
FT                   TIFDPDRVRILNHQLIRYAGYDTPDGIIGDSASIAFTQLCESFGWSGSKTDFDILPLLI
FT                   ELDGQVSLHPIPDELVLEVTIQHPEQNLFGDRTIKWYAVPMISDMRLEVGGISYPCAPF
FT                   NGWYMGTEIGARNLADTDRYDLLPLVAKQLGLNTSRERSLWKDRALVELNYAVLDSFER
FT                   SGVTIVDHHTATKQFARFEKNEAACERDVTGEWSWLVPPMSGAATHVFHKDFDPTVKRP
FT                   NFFARSAPAEEPSVPSGCPFHQEVSR"
FT   gene            365924..366781
FT                   /locus_tag="Exig_0345"
FT   CDS_pept        365924..366781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0345"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bsu:BSU07900
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59829"
FT                   /db_xref="GOA:B1YIE6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE6"
FT                   /protein_id="ACB59829.1"
FT                   /translation="MSLLKPVFARFFGEAFFDKSAQLAYYLMLSLFPFLLFVVGLVSFL
FT                   PFTSGDVLDLIRPFAPAETYDLIRKNVVGIFDNGGLKLASISFLAAFWLASMSVQSLVR
FT                   SLNDALEVTRKVPFWRGLLQDFGFTVGMMIILPMSLLVPVAEKLTRRFITHFAIVNDVV
FT                   TNYSWIWFLFRWGLGSLFLLVFFILLYRVLPSVRLTVRQVLPGALFATIAWQAVSEFFS
FT                   YYAEFGSYDRLYGQLAGIIVLMTWFYLSSVVLMLGGLMNAERMRQKKEAKVLKPEKIKQ
FT                   ETVR"
FT   gene            complement(366778..367644)
FT                   /locus_tag="Exig_0346"
FT   CDS_pept        complement(366778..367644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0346"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bha:BH1459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59830"
FT                   /db_xref="GOA:B1YIE7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE7"
FT                   /protein_id="ACB59830.1"
FT                   /translation="MDLLLFLVLGAAIGILSGFFGIGGGIILTPLLLILGYTPSTAIVL
FT                   SLLLTLGSTVTGTFAHLRQNNFHLRDAVTIGVSGIIGSAAITPVVFWMERHSGADTVIS
FT                   TLYIVLLLLFAIQFLKPAKKVVQETPVPHASFYKLVAIGAAAGILSSLMGVSGGFLLTP
FT                   LLMGWVRFPLKQAIGTSIAAATLIVLGGVTSYFMSGTQAPLALGIALIIGALIGSPLGA
FT                   SFLNLFSSQFVKKSLGSFYAAVAASVFLKTTHYEQLSLLLLALFTTGLIGVFFYQKVIQ
FT                   RQTKDCP"
FT   gene            367756..368604
FT                   /locus_tag="Exig_0347"
FT   CDS_pept        367756..368604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0347"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cno:NT01CX_2344 transcription
FT                   regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59831"
FT                   /db_xref="GOA:B1YIE8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE8"
FT                   /protein_id="ACB59831.1"
FT                   /translation="MNFNELKTFVALVETKHFTKTADRLYISQPTVSLHLKHLEEHFGQ
FT                   SLIHRHTFNKTIEISEAGWIVYRHAKEILHQAIRLEQEIDELEGITRGTLRIAATHTIY
FT                   EAMLEEMIHDFLLVYPDVSVDARVMNQEQVEQALLHYEIDLGMVEGLHRSHQIEAIPFA
FT                   TDRLRIIGHHHLVPEQATWIYREEGSAARLALETWLQTQAIVPKRIITVYSNRLIKQLI
FT                   KNGTGISILSERLAGSLLESERFQTYDDSQIDPRMFQFITLKGETTRLSQKWINQHGGS
FT                   D"
FT   gene            368704..368967
FT                   /locus_tag="Exig_0348"
FT   CDS_pept        368704..368967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0348"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   sar:SAR0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59832"
FT                   /db_xref="GOA:B1YIE9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIE9"
FT                   /protein_id="ACB59832.1"
FT                   /translation="MEKVYEDKIIHRMNRIEGQLHGIIRMMKEEASCKDVVTQLSATRS
FT                   AIDRVIGLVVSENLIECVTNDETDDNHEQAVAEAVQLLLKSR"
FT   gene            369024..369503
FT                   /locus_tag="Exig_0349"
FT   CDS_pept        369024..369503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_0691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59833"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF0"
FT                   /protein_id="ACB59833.1"
FT                   /translation="MSEIKKTMIVLFSGDYDKVMAAYIIANGAAAYDHEVTIFHTFWGL
FT                   NAMRKDEPIQPDKTLLEKMFGKFMPRGADKMPLSKMNFGGAGQKMIKNVMKKHNAMPLP
FT                   DLIELAKEQDVKLVACTMTMDLLGLKQEELHDGIEYAGVAAYLADAEDGNVNLFI"
FT   gene            369519..369884
FT                   /locus_tag="Exig_0350"
FT   CDS_pept        369519..369884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0350"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   btk:BT9727_0689 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59834"
FT                   /db_xref="GOA:B1YIF1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF1"
FT                   /protein_id="ACB59834.1"
FT                   /translation="MQVDILNIVFLVIVAFLAYRMFAPTKGVNKLSASDLKQRLGDRTR
FT                   FYLDVRTPGEFKGNHIKGFKNIPLQVLPTQLDKIPKDKEVIVICQSGMRSKQAVKQLKK
FT                   AGYTQVTEVSGGMNAWR"
FT   gene            369907..370203
FT                   /locus_tag="Exig_0351"
FT   CDS_pept        369907..370203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0351"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: gtn:GTNG_1980
FT                   molybdopterin biosynthesis MoeB protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59835"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF2"
FT                   /protein_id="ACB59835.1"
FT                   /translation="MKRFTAKEVQEKLENGEQLNIIDVREVDEVKEGKIPNAIHIPLGL
FT                   VEFKMNELDKKKQYVMVCRSGARSGRAATYLEGQGYDVINMDGGMMAYEGKTN"
FT   gene            370252..370818
FT                   /locus_tag="Exig_0352"
FT   CDS_pept        370252..370818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0352"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; Rhodanese domain protein;
FT                   KEGG: gka:GK2066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59836"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF3"
FT                   /protein_id="ACB59836.1"
FT                   /translation="MQTIKTDIVLDARGLACPMPIVRTKKTMKTLEPGQVVEVQATDKG
FT                   STADLRAWANSTGNQYLGTIEDGDVLRHYVRKASGNDQEAPAFQKVVNNETVEAVCGNA
FT                   DIMILDVRETAEYAFSHIPSAVNIPLGELEERIEELDSSKTIYVVCRTGNRSDLACQQL
FT                   DAKGFNVQNVVPGMSDWKYDTNQTV"
FT   gene            370851..371987
FT                   /locus_tag="Exig_0353"
FT   CDS_pept        370851..371987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0353"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; SMART:
FT                   Rhodanese domain protein; KEGG: bpu:BPUM_0193 possible zinc
FT                   (Zn) dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59837"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF4"
FT                   /protein_id="ACB59837.1"
FT                   /translation="MAQAMTTKEVTQKIIRREKMFILDVRNEDAFQDWKIEGEQFSYLN
FT                   VPYFDLLDGVEDILDQLPTDQNVLVVCAKEGSSIFVADLLEEAGRTVSYLAGGMKAWSE
FT                   HLEPISLGSLNETGADRGEVVQFVRIGKGCLSYMIISEGEAVLVDATRMTDVYLDYAKE
FT                   RQLEITHVFDTHLHADHISGGREIAEKTGATYWLPPKDAPDVTFDYAALEDGSHVQVGD
FT                   TQIDVRALYSPGHTIGSTSFVVDNRYLLTGDILFIDSIGRPDLAGLAEDWVGDLRDSLY
FT                   NTYRELSKDLIVLPAHFMLIEELNEDGSVAEKLDVLLANNHGLNIEDEETFRKMVTENL
FT                   PPQPNAYQEIRETNMGKQTPDREAQREMEVGPNRCAVR"
FT   gene            372021..372248
FT                   /locus_tag="Exig_0354"
FT   CDS_pept        372021..372248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0354"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: bsu:BSU26500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59838"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF5"
FT                   /protein_id="ACB59838.1"
FT                   /translation="MKSELVLDAKGLACPMPIVKTKKAIAGLESGQILEIHATDKGAKN
FT                   DLQAWAKSGGHELVKHEEDASVLKFWIQKG"
FT   gene            372303..373079
FT                   /locus_tag="Exig_0355"
FT   CDS_pept        372303..373079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0355"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   gka:GK2064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59839"
FT                   /db_xref="GOA:B1YIF6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF6"
FT                   /protein_id="ACB59839.1"
FT                   /translation="MEIGFIVTIFLIGFVGSYISGMLGIGGSIIKYPMLLYIPPLLGFA
FT                   AFSAHEVAGISAIQVFFATIGGVWAYRKGGYLNKSLIVSMGGAILIGSFIGAYGSNVLA
FT                   EDTINIVYGILALTAAVMMFVPKKGLDDIPLDQVRFNKTIAASSAFIVGVGAGIVGAAG
FT                   AFLLVPIMLVVLKIPTRMTIASSLAITFISSIGATVGKITTGQVDWGPAAVMVVASLIA
FT                   APLGAIAGKKMNTKILQIILAVLILATAVKIWLDIL"
FT   gene            complement(373142..373528)
FT                   /locus_tag="Exig_0356"
FT   CDS_pept        complement(373142..373528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0356"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   gka:GK2063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59840"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF7"
FT                   /protein_id="ACB59840.1"
FT                   /translation="MFDYTVSSNHSTEETIERLKTALAEISFGVLWEFDLAKKFAEKEL
FT                   PFDDQYHILEVCNPIEAHRVLSAERRAGYFLPCKLAVYTEDGQTKIGMPRPTSLIGLVE
FT                   EDELKQVALDVERQLVDVIEKSRL"
FT   gene            373716..374816
FT                   /locus_tag="Exig_0357"
FT   CDS_pept        373716..374816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0357"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A; Methionine sulfoxide reductase B;
FT                   KEGG: vco:VC0395_0557 peptide methionine sulfoxide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59841"
FT                   /db_xref="GOA:B1YIF8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF8"
FT                   /protein_id="ACB59841.1"
FT                   /translation="MKKRMLTIVSVVALIAIMIGGYFVFQQQQAKSSGSKELTYAKEET
FT                   AILAGGCFWCMEPPFEELKGVKSVISGYTGGDVKNPTYNQVSAETTGHREAVLITFDPA
FT                   VISYKQLLDVYWRQIDPTDPNGQFVDQGESYTTAIFYTNAEQKQIAEQSKKNLAESGIF
FT                   DKKIVTPLIEAGPFYEAEAYHQDYYLKSEKKYKFYRSASERDEFINQYWNDQPKLDVPK
FT                   YSKLTDDQIKAKLTDIQYKVTQEDGTEPAFDNPYHDLKADGIYVDLISGEPLFSSNDKY
FT                   DSKTGWPSFSRPLEKGNIIEKSDFALGMKRMEVRSRHGNAHLGHVFNDGPEPTGLRYCM
FT                   NSAALRFVPKADLEKEGYGQYASEFK"
FT   sig_peptide     373716..373808
FT                   /locus_tag="Exig_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.735 at
FT                   residue 31"
FT   gene            374962..377874
FT                   /locus_tag="Exig_0358"
FT   CDS_pept        374962..377874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0358"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: bha:BH2080 cell wall-associated protease
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59842"
FT                   /db_xref="GOA:B1YIF9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034084"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIF9"
FT                   /protein_id="ACB59842.1"
FT                   /translation="MKKLTIWLMLSCLILTLGIGPSAVKTAAANELSEAVLLKAGQETL
FT                   LETGTNKTNTYWYKVDHQAGIEKTATHFELSIDTDQPIEVTAYPSQEMASKDETFDRYR
FT                   GYAEPNDKDVTKIAVPYAWDGPYYVKVDYYPEIEEDKTVKPANVNLTYNNVKLAVEYEP
FT                   ISDISCMAEEALKQTSDEKPMLALMHAIQKQVLSQSEQGRSLTSLYYKASPYVVKTLLF
FT                   NKDKRTQAYEDLKSLKPAMSALVNGTSYTLTKTDQAAVNRLYALTRDASPEVIATEINQ
FT                   VAKTANIESIGGSDLTEAFKPFGIQVKSEAKTRFIVKLKPGHTQRTMKIAGTQATDVEK
FT                   LSLGKTGQFVIVTEDPTVKNQSAAVLKQSLKKSSAVEYVEEVQTYRATGDINYDYQWSL
FT                   NQKSSVEQFPDAGIGFEKFLKNNAGQKLKPVTIAVIDTGVDYRLKDLQGKVDIAQEKNY
FT                   VDVNGNGNALDDNGHGTHVSGVIAAALENDYGIRGIHQSAKILPVKVLNANGEGETDAI
FT                   ALGIKYAVDHGAKIINMSLGGGESRTMAYMMKYAADHGVTVVAASGNEYDMSIGFPASS
FT                   EYAISVGATNPLGMVADYSNYGIGLDVVAPGSKIASLVPDGNTVYMDGTSMASPHVAAV
FT                   AGILASLNSKLTPKQIESILRTSAEPLAFENPNDWDDDEDDMEDEYPPGYEKEMTPDFP
FT                   AFVSPVSGYGKVNITRAISQLHLNGKVNPVYDNQLVVSGQVKTGTKVEVWSTKKLTDTK
FT                   DTAKMLAKTTATAGKYSVAIPRQEKTSVLTIRYANGLDVTSERTEVLPGKAPAAPKVNR
FT                   VLAGATKVTGTAIANGKITIKDAKNKVVGKGVVDSKGKFTVKVKALQPNTRIAVTVTDI
FT                   ANRSSKATVVTVLAPPAAPKVKPVTAGQTKVTGTGEKKAHVYIQNAKKKVIAKGTITSK
FT                   GTFSVKIAKQKAGAKLYVYLKNDLKQTSPKTAVVVKKAKK"
FT   sig_peptide     374962..375042
FT                   /locus_tag="Exig_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.344 at
FT                   residue 27"
FT   gene            378036..380573
FT                   /locus_tag="Exig_0359"
FT   CDS_pept        378036..380573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0359"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: drm:Dred_1556
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59843"
FT                   /db_xref="GOA:B1YIG0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG0"
FT                   /protein_id="ACB59843.1"
FT                   /translation="MINWIRRRIGRQLLAVFYVLLFLVSMTSFLVYGYMENRIESSRDN
FT                   LEVISEQNRRADHLWDNWQNVQFGLRGFVIFGNQERFDEIQELRTEIKSETDWFTRKAK
FT                   TDEEEEFAAQMTNMYNLYYGALFPLTQSYVNEKKANQINEDFLQGDSLFSLPIAKRLVE
FT                   QGQLKQTADGSIDVEPDIEKASSALNEYRNNLQQQQDTAVANLRSEVAKTKWIWISSIF
FT                   VLIIFILLFVHPFLKRMTKQLLRLIEDNRKLSRNEPIEMDVMERRADEIGMLRSSFNQM
FT                   AVTTGLHKEEMQNKNEELQAQSEELLAQQEELQSQQEELEEAYQATKQNEEKLKMRSEL
FT                   TEALAVRETVESYPAIVQKMLDITSSEYGALLLYDDGVYIGATTNGMKIQQVQSLLDDE
FT                   NSLLNRMRLGTKVVQSEKRVSRTNDTPYSFSTYEVALPIYDPSTHQLMAAVYMVRYQSP
FT                   YQSQQLADMREFSQQMTLSLLRTRSYDEMKQEKQKTEQVLDSIREAIIYLEDGNDELYV
FT                   NRPLFELIPELQSEFTRDRTLSSASYVIEVMRNIVDDVERFNDYLDLIRSGEVSPDKVQ
FT                   FDVRGNSAHLEVYAERIDIEGGWKGVILVIRDITRETEADRLKTELVSTVSHELRTPLS
FT                   SIYGFTELMLNREIDAIKQQKYLSTIHNETERLSNLVTDFLDVQRMQSGGQRYQMAHLD
FT                   LYSIVDQVIGVYKASNGLHDIQLHLLSVERPAIIGDETRIKQLLNNLVNNAIKYSPDGG
FT                   QVDITVSTDQENATIQITDHGIGIPQYAFAHLFDKFYRVDNSDTRRIGGTGLGLSICKE
FT                   IVKEHDGVIHVESTVGKGSTFTVALPLHALENV"
FT   sig_peptide     378036..378137
FT                   /locus_tag="Exig_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.928 at
FT                   residue 34"
FT   gene            380765..382285
FT                   /locus_tag="Exig_0360"
FT   CDS_pept        380765..382285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0360"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: pin:Ping_1306 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59844"
FT                   /db_xref="GOA:B1YIG1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG1"
FT                   /protein_id="ACB59844.1"
FT                   /translation="MHKLIYTIIGGWVMSHLLWLGIIGTSSDLSRTGNSLFMILGAVLS
FT                   TIMLVAAARRHPNRPITQRLFLLLLFGNMSLAMGETAELIVSQQHLERSGMFDGIDLIF
FT                   SLQIGFYLLAFCYFLISRRSEVNLRFFLFDELIILIVTGAISWHYLVTPYLEQAELFSM
FT                   ETLLLLRYPLGDLLLLGGMLILFFGVMKRGNSIPLLMILIGFHLQLIADLLYVILDRTS
FT                   FPISLMWLDPIWIATVLLIGGAGLLFDVDERPIGFNVNRRILDGIRLVTPYVFLLILFV
FT                   TMARQAVSWNGLTIGLMIAIPLLISRQVRIVMDNQRLRENLEAKVEERTAALEQALEEM
FT                   EHMAYHDALTNLPNRYLFARLFKEELRRAEIHQRFVGLFFIDIDHFKQVNDTYGHQIGD
FT                   QLIIDIANRLEKKLPHNTVISRQGGDEFVLLLFDVKDESDIEACGRQLVQLFERPFILK
FT                   DTPVFMTASIGGAVYPTHATSRTALIEQADVAMYEAKRRGKNQFHVEV"
FT   gene            complement(382330..382962)
FT                   /locus_tag="Exig_0361"
FT   CDS_pept        complement(382330..382962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0361"
FT                   /product="Fibronectin-binding family protein"
FT                   /note="PFAM: Fibronectin-binding family protein; KEGG:
FT                   bld:BLi02533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59845"
FT                   /db_xref="InterPro:IPR010841"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="InterPro:IPR038344"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG2"
FT                   /protein_id="ACB59845.1"
FT                   /translation="MEPFIQPFQYNFIRSQIDSMIQQLSAVHDPDVRDAVIYSASKKIF
FT                   DLLPVLTAEQEALLMVVRTVQTEADFARYLEDIQPFVQSFPSITEQQLQQLFRKTKKLR
FT                   HPPLHSIDFLKTTYLSWNDTGNKKKFFVYPLKGEWIGIEGTYLPTIQKGICTICNQYSD
FT                   VTLVSARTNQSADQYRAIGNYICIDSDHCNEQVTDPIALEKLLSKMK"
FT   gene            383077..383805
FT                   /locus_tag="Exig_0362"
FT   CDS_pept        383077..383805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_4209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59846"
FT                   /db_xref="GOA:B1YIG3"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG3"
FT                   /protein_id="ACB59846.1"
FT                   /translation="MQALTGLRLLNLISFLFVLLARVFWYEAPTGEPLAIVPASFTDAV
FT                   FGVVYTTLLIWCIRPVQAYPADRTLIFDISGWFVLTMLGYGAGSIVGPPWELVLTTISF
FT                   ISLCIIYMKVQHHPNRSPWMRSPFSVFLAWSSIQILILPFRILRDFRFEDLFGLMTSEW
FT                   VTIMLILFACGIVFFIFVHTDWVFGLVMIWYYVGLFFNGRLTDFQQGVAVFSLIAVLAA
FT                   VILVFRKRDRLFAEEKRPVS"
FT   gene            383884..384333
FT                   /locus_tag="Exig_0363"
FT   CDS_pept        383884..384333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU07550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59847"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG4"
FT                   /protein_id="ACB59847.1"
FT                   /translation="MGKKQLIGTYENETDLIRQIEDLHFAGYLEEDLYVVLQDKTDMAM
FT                   LRGQSAAQLVSGKRTLFERFTGKPVTEEETREAFESLGLPEGDMEQHVASVKHGAYVLL
FT                   ADEEGARRPKPEPQSILESEPEGIEAERKLDHENRALENENDRML"
FT   gene            384363..384812
FT                   /locus_tag="Exig_0364"
FT   CDS_pept        384363..384812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0364"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: gka:GK2755
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59848"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG5"
FT                   /protein_id="ACB59848.1"
FT                   /translation="MDSHYHTILVAVDGSKTADLAFEKAVQFAKLDQAKLVITHVIDIQ
FT                   TFANVRANQRFIDQNVTEYAQELLDKYQKRAVEEGVAEVELVIESGSPKTLIPKVIAPR
FT                   VGAGLIVCGAVGMNAMERIMIGSVSENIARYAKCDIYIVRPKTLK"
FT   gene            complement(384878..385069)
FT                   /locus_tag="Exig_0365"
FT   CDS_pept        complement(384878..385069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59849"
FT                   /db_xref="GOA:B1YIG6"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG6"
FT                   /protein_id="ACB59849.1"
FT                   /translation="MTVLFWIALVICVLGLIFTVMVGQSRNEETYSNSQTAKNMSWMYL
FT                   VLLPVILIILGIFYYLLT"
FT   sig_peptide     complement(384986..385069)
FT                   /locus_tag="Exig_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.525 at
FT                   residue 28"
FT   gene            385217..385660
FT                   /locus_tag="Exig_0366"
FT   CDS_pept        385217..385660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0366"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bsu:BSU05640
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59850"
FT                   /db_xref="GOA:B1YIG7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG7"
FT                   /protein_id="ACB59850.1"
FT                   /translation="MKENLREAVQLFEEVMIHGTERVLKSVDSPVWRLYSPEQLHLLKL
FT                   VDKYGPIASGRIAVIQGVHKSAISNRLKKLNEHGLVEVERSEDDHRTKRIILTDAGKEV
FT                   VEASDQAIYSYLEQLIDGKVDDDEIKQFIETFRKVKAILKIED"
FT   gene            385696..388365
FT                   /locus_tag="Exig_0367"
FT   CDS_pept        385696..388365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0367"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bsu:BSU05650
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59851"
FT                   /db_xref="GOA:B1YIG8"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG8"
FT                   /protein_id="ACB59851.1"
FT                   /translation="MRQIVKWRWPIVIVLLLATVGLFLAAPNLSKQAEDAGAIQLASDT
FT                   DSQRAADILKAAGASEETISLVIPLKEAVTKQDRTEIGQIVKDLEKLDQPVTGVLDPFE
FT                   SKETEGQLISKDKKTVLVPITVDGSQEEITALAEDIRSDLLPDDRTIYLTGESLINADV
FT                   NKSSQEGLKRTELITVGLIFGLLLIVFRSIVTPFVPLFAVGVTYLMSQSFVAFFVDWFG
FT                   FPVSNFTQIFLVAILFGIGTDYCILLLSRYKEELTAGHDVETAIVNTYKTAGRTLLISG
FT                   LAVLVGFSAIGFADFPIFKSSVAVAVGIAVLLLVLFTLVPFFMATLKEKLFWPSKNAAS
FT                   HQDSRLWARYGGLSIRRPLLAMAIVAVVTIPTLFTYDDDLSFNTVDEIGAKYETVKGLN
FT                   AISDGFGAGESLPVNIILKDDQNIVTEKTVPYAEQLSRELVKLDGVKAVRSISRPTGEV
FT                   IDDLYVDQQLKQVASGLTDAKDGLGEVGQGLQTVEDNLKTISGQLPAGDQASAGAAQLQ
FT                   QAADGLGQINQQLTLVGQGLQSAENIPQTVGTLTALSGQLTQVQTGIAQAATGIETQGA
FT                   QAGQLGNGLTQLADGVGSANNGLGKIEDGLKEAADFLKEMGNSKTIRGTGMFIPKDTLS
FT                   SKDFEPVIDRYTIDDKTGLKFEVILDDDPYSPEAIETVAAIKKTTASTLKDTPLEQAQV
FT                   AYGGISSINSDLNDTSKADFSRTVVIMIISLFIVLAIMFRSLIMPLFMIGSLLLTYYTS
FT                   VSIAELIFVNGLGYDGISWAVPFFGFVMLVALGIDYSIFLLDRFREETINGLETNEAMY
FT                   VSMKKMGSVIITAAIILAGTFGAMMPSGVLSLVQIATIVITGLLLYGLIVLPLLIPAIT
FT                   VSFGPGVWWPFRQKQNKK"
FT   sig_peptide     385696..385788
FT                   /locus_tag="Exig_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.380 at
FT                   residue 31"
FT   gene            388440..389291
FT                   /locus_tag="Exig_0368"
FT   CDS_pept        388440..389291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0368"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcz:BCZK2155 Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59852"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIG9"
FT                   /protein_id="ACB59852.1"
FT                   /translation="MQQFKQLTDRIWYQTPVSETDRPIVAVITGDDRSLVIDAGNSSQH
FT                   ATLFLEEMKNQGLGRPDLVALTHWHWDHIFGIKQMAVPTIATHRTVEEIQKMLDYEWTD
FT                   EALEERIRQGIEIPFCADAIKLEFGKDREIEVILPTIRFTGELAIDLGGVTCLLRQVEN
FT                   DHSPGSALVYIPEERVLFLGDAMYADIFSDKWNYTVNQTTRLLDTIAEYEADYYVWSHG
FT                   EAMAKDAFEQEVHVLRQIIEVTKQAEGHVSEMRRLYRDLVGRDLTTDEEETLVFFANGA
FT                   KK"
FT   gene            389628..390332
FT                   /locus_tag="Exig_0369"
FT   CDS_pept        389628..390332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59853"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH0"
FT                   /protein_id="ACB59853.1"
FT                   /translation="MKRIQIADFDRRMPPLELREMDDYYEAVLVSNYDELYPSTQVRTI
FT                   QLADIYVNLVMTSEGAHLVSALFLKPVEVPDIVAWMQLYTIGFATADATGYYVEQADEI
FT                   LEIVLYQGNPIVIATRGTDRLYYETEGAIEMRRESSEVIGKKPLLYLNGEARFEVPHLE
FT                   FNPNQDEIHINGTFLFADYMDTYQGRVGFFRKTDSNLPIVLLVGKAIIEMELTENPDGS
FT                   RILVIEQPYDEA"
FT   gene            390466..391626
FT                   /locus_tag="Exig_0370"
FT   CDS_pept        390466..391626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0370"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bha:BH1094
FT                   transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59854"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH1"
FT                   /protein_id="ACB59854.1"
FT                   /translation="MVKEMPRNSKWMRSYNRALVLRLIRMHQPISRVELAQQTKLTKPT
FT                   VSNIVGELIADQLVMERELGVSNGGRKPILLELVAKEQYVIGIDATSHRFIGVIADLSG
FT                   NTIHEVETMGKFDTNEELMEAVVQLCQQLIDATDQVGTIHGIGISVHGMVNPETGVILF
FT                   APRFHLHDVALKEHLEQRFAYPVFIENDVRALASFELLFGEGVGVDQFFYLYAGEGIGG
FT                   AYVLDGKLIDGENHITGEVGHMRLDLDGPICSCGNRGCLEALAGEKALLRDFEAVDPQV
FT                   KTLTELRRRLTDQDPHATAAYHRAGEYIGIGVLNTIHLINPKRILLGGPMFELAPSIVD
FT                   QIKERVEHTALTTASRETDVKMVPWSEKQGALSAAALATNSIFQTI"
FT   gene            391862..392323
FT                   /locus_tag="Exig_0371"
FT   CDS_pept        391862..392323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59855"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH2"
FT                   /protein_id="ACB59855.1"
FT                   /translation="METEDLWVSYREAFGRYGAIRGFYVNRLTGDMTEQQPGDKRSADQ
FT                   DGVLVRPRQDGVFQFRMSSVQGVLTIRSSELHLRKNENGYIELRVLMQHMRTAGCLTLG
FT                   GEFYLFVTPEVDTLDYRLRLIARVLIQLQRMPIGMEVIEQWCQHAQLEG"
FT   gene            392374..393684
FT                   /locus_tag="Exig_0372"
FT   CDS_pept        392374..393684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0372"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: csc:Csac_2544 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59856"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH3"
FT                   /protein_id="ACB59856.1"
FT                   /translation="MKFKKTKVLAAASVLTLSALLAACGGEDEKQATTKDGKTIISWWG
FT                   WAPQPEAGKEVVDAFNKSQDKYVVEFKRYSEDYEKQLQVAMLSGKGPDIIGLKEPMIQQ
FT                   YKDRVVPVDSYMDKAAGKGWKDKFVELGIDQTTIDGKQYAVPIGFTGQAYLMYNKTMLD
FT                   KYGVTPPKNYKETVDAVKKIKASGDKVIPLMLGAKDAWIDIDVYNVLSHQVAPGYIQKV
FT                   LSGEAKWTDDEMVKTAQIWQDLFEKKVFQEGALGLATYNDGMNQFFDKKAAMWVIGSWE
FT                   AHSMTTAEKKDKWKIKDELGFTPLPNLAGGTEQPIIASIDMALAVNKESKQQEGAAEFV
FT                   AFMSQGKGQEVYMGEFEMAPGIKDVKIDSDAAFTSEGEKESYKMLNETLSKAVASRGIR
FT                   DTKLNDILGKELQNIATGQNPKEALQRVQDAADQSKK"
FT   sig_peptide     392374..392445
FT                   /locus_tag="Exig_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.527 at
FT                   residue 24"
FT   gene            393760..394725
FT                   /locus_tag="Exig_0373"
FT   CDS_pept        393760..394725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0373"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bsu:BSU32590 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59857"
FT                   /db_xref="GOA:B1YIH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH4"
FT                   /protein_id="ACB59857.1"
FT                   /translation="MQTEQQELPIKPKAETLKAAPRPNVPKQKKKGKMKQNMVGWAFVG
FT                   PIVLFVVAFIYYGIFYNAYNSFFSWDGISFDKVFVGFENYAEMFRDPDFYLSLKNTFIF
FT                   TILTVTIQAFIGLVLAYFLHTQGPLRTAMKSVFFFPVVLSPVVLGAAFSQIYDFQFGYI
FT                   NEFLRAIGLGSLEQNWLGDPDIALYSVIAINIFQWTGSSMVMYYMAMLTIEKEIFEAAK
FT                   IDGAGFFRTLWSIVFPNLKGTTFTLSILGVIGGLKTFDLVWITTAGGPGSSTEFISTYL
FT                   FRKSMLQQEVGFSSAVAIILLTIALLITYFQLRVQKKMDN"
FT   gene            394739..395524
FT                   /locus_tag="Exig_0374"
FT   CDS_pept        394739..395524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0374"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mlr7002 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59858"
FT                   /db_xref="GOA:B1YIH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH5"
FT                   /protein_id="ACB59858.1"
FT                   /translation="MNVESKRSRWVINLVLMLASIVWLFPIFVMFKESLRVNGFENYIA
FT                   TLQNPNFPTFVFNSFFVAFFMIIISITILAFAAFAFSKLEFAGKRLLFNMVLAGLMLPV
FT                   ASMIVPLFFTLRSFDGLNNHWGLIGAEVAFFLPFGLMLIKGYFDELPNELMEAAYIDGA
FT                   TILEVFFKVMLPLAKPALATALIYAFLNSWNEYLMVLTFMTDPAYQTVTMAPSFFKDAL
FT                   GGDPGKIYASLVLISLPTMVFYIFFQRFFQKGMTAGAVK"
FT   gene            395550..397544
FT                   /locus_tag="Exig_0375"
FT   CDS_pept        395550..397544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0375"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: lic:LIC10031
FT                   beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59859"
FT                   /db_xref="GOA:B1YIH6"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH6"
FT                   /protein_id="ACB59859.1"
FT                   /translation="MYLGVDYYPEQTPRALWEEDFRLMKELGVNVVRLAEFAWTMMEPE
FT                   EGVYDFRFWDDIIERLSAAGFDIVLGTPTATPPAWMCHKYPEILPADEHGVTISFGARR
FT                   HYTVHSETYQRFSVAITTEMAKRYGKHSRVIGWQTDNEYGHEKSDRSYSDVDRAAFQVW
FT                   LKNRYGTLDALNETWGTVFWSQIYTAWEQIPVPRKVYQEHNPSLLVDFDRFCADGYNHY
FT                   NKLQVDALREHIHPEAFITHNLVYSDMAVNQQQMAQDLDYVAFDNYPVWGGLPEPNRFE
FT                   KMASDHDLCRSSKQGKGFWVMEQLSGAQGWSKIGYLPRPGHIRLWTYQAVARGAEAIVY
FT                   FRFRAALFGTEEFCHGIIDHDGKPKRKFNEVKQIMTELNTFGDEINASSYRAEVGVYFD
FT                   QENVWAWTHQPHSDAFDFRTEFVRFYGGAVRRQASTDIVFPGDKLDQYKLIIVPLYFLT
FT                   NPTFDQALIDYMEQGGHVIFTYRTGVKDPHNNVLPLTLPGQFATYAGIEIDEYESLQAV
FT                   QENRVEGIGKFAGQGSPARLWCDLITPTTAEPLAVYRDTFYDGVAAVTRNEYKGMITYI
FT                   GASIDDAMIDTIYRQAFLDAGVQTFEAPDQVEIVRRHGETRDFLFLMNHDTKASRDVVL
FT                   DAAYQELNTNETYSGTVTLAPLETLILTT"
FT   gene            397559..399691
FT                   /locus_tag="Exig_0376"
FT   CDS_pept        397559..399691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0376"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   sus:Acid_0933 glycoside hydrolase, clan GH-D"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59860"
FT                   /db_xref="GOA:B1YIH7"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH7"
FT                   /protein_id="ACB59860.1"
FT                   /translation="MAILELPNQRFVLEGQHVAHVVTIGQHGKVLHTYFGARLPYPSDY
FT                   EALPNPVLAHSSFESPDGVAVYDFIPFGEMVYTEPTLKSEREDGQRISQFVFERAEQSG
FT                   NGLILWLFDSLQELRVGIKYDLYETYDMIGRSLVIENTGTQSVRLTTAQSFAMGILQRP
FT                   DLNLHHFAGTWTGEFQKQVTPLTSGRKTIDSRRGVTSHQANPWFALEHGATESAGEVIY
FT                   GHFAYSGNWSMHFEQDAFGFVQLSGGMNEFDFSWRLEAGQHLTTPEFYIGYAPDGFAGM
FT                   SARAHDFQRDVIMPESDRNKVRPVLYNSWEATYFDVTEHGQRTLVDQAAAIGCELFVVD
FT                   DGWFGERNSDQAGLGDWVVNPEKFPNGLTPLIDYVKQQNMSFGLWVEPEMVNPDSNLYR
FT                   THPDWIYHSPGARRTTSRNQFVLNIGLPEVEQFVFRMMDELLATHAIDYIKWDMNRAFS
FT                   EPALPGATPAEQQELWKRHVDALYRIFDRLRVCHPEVDFEACAGGGGRIDLGILKRTEQ
FT                   VWTSDNTDPLDRLTIQHDFSFAYNAKMMSCWVTDGPNWLNGRNLPLATRFVSSMQGTLG
FT                   IGGNLSEWTTEELAEAAEWIATYKTIRETVQFGRQYRLKADRVAASLMQYTSNDQTVIL
FT                   AVAPMRKHGIGHYHFRLAGLEETTLYQVEDRQLSGAYLMQQGLTWNYTNDYEARCLRIQ
FT                   PVHRSIPTSESKEPIV"
FT   gene            399688..400860
FT                   /locus_tag="Exig_0377"
FT   CDS_pept        399688..400860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0377"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: lsl:LSL_0381 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59861"
FT                   /db_xref="GOA:B1YIH8"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIH8"
FT                   /protein_id="ACB59861.1"
FT                   /translation="MTDQTLEQIFEQQFGQSSTHRFFAPGRINLIGEHTDYNGGHVFPC
FT                   ALTLGTHAVARKRDDVVFRFYSLNFEDDGIIEVAGDDLTPQSAHGWANYAKGMIHVLRE
FT                   AGYRIDTGCDILIKGDIPNGAGLSSSASLELVIGVLLDKLYNLDIDRIDLVKYGQQVEN
FT                   QYIGVNSGIMDQFAIGMGKAGSGLLLDCETLDYTYAPLDLSGYTIIIMNTNKRRELADS
FT                   KYNERRSECEAALAYLQQYRPYASLGQWSMNEFETVSFEDERLERRARHAISENERTLQ
FT                   ALDALKEDRLEAFGQLMNASHRSLRVDYEVTGKELDTLVEAAWAQPGVLGARMTGAGFG
FT                   GCAIAIVEDDTVETFMTAVGHAYETEIGYPASFYTATVGDGAREVEQEVI"
FT   gene            400861..401859
FT                   /locus_tag="Exig_0378"
FT   CDS_pept        400861..401859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0378"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: bld:BLi04283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59862"
FT                   /db_xref="GOA:B1YIH9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIH9"
FT                   /protein_id="ACB59862.1"
FT                   /translation="MAVLVVGGAGYIGSHAVYQLVDAGQDVVVIDHLKSGHREAVHPKA
FT                   RFYEGDIRDRAFLDTVFEKETIDQVVHFAAFSLVGESMEHPLAYFDNNVYGTQVLLEAM
FT                   MAHDVKQIVFSSTAATYGEQEQMPILETATTNPTNAYGETKLMMEKMMRWCETAYGLNY
FT                   VALRYFNVAGARATGEIGEDHTPETHLVPLVLEVANGQRPVISIYGDDYATEDSTCIRD
FT                   YIHVEDLIDAHLLALEYLKQGNTSDVFNLGSSRGFSVREIIEAARRVTGHAIPEQVVAR
FT                   RAGDPSTLIAGSDKAKKVLGWTPRRTEIDTIIQDAWRWHEQRPQGYKTPVR"
FT   gene            401880..403379
FT                   /locus_tag="Exig_0379"
FT   CDS_pept        401880..403379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0379"
FT                   /product="UDP-glucose--hexose-1-phosphate
FT                   uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="PFAM: galactose-1-phosphate uridyl transferase
FT                   domain protein; KEGG: bld:BLi04284 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59863"
FT                   /db_xref="GOA:B1YII0"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII0"
FT                   /protein_id="ACB59863.1"
FT                   /translation="MAMNELIKQLTEQAVRQRLIEPEDTVYARNRLLSLLGEAAYVDPG
FT                   TVGTRPIPDLLEEMIEQQITAGKLAPRLDEKERLAAELMDVFVDRPSQITSTFHQLYAE
FT                   HPQQATDYFYQLSQANNYIQTKRIAKNIQYQADTVYGEIDITINLSKPEKDPREIAAAQ
FT                   TEIVESTYPTCLLCVENVGYAGRSNHPARANHRIVPLTLSGESWALQYSPYVYYNEHSI
FT                   ILSQEHRDMVINRQAFARLLEFVAQFPHYFAGSNADLPIVGGSILTHDHYQGGRYEFAM
FT                   DRAKTLQEFVLPDHPDVAGETLHWPLTVVRLSSTDADALLDAADEVYQTWLTYEDTDHQ
FT                   ILAATDGVRHNTVTPIARMRGERFELDLVLRNNRTSEKHPDGIFHTHADIHHIKRENIG
FT                   LIEVMGLAVLPARLLSELEQVEQFIVGTADSTAPSHQEWATELKAAYTGQDVTDYVRQA
FT                   VAAKFVRGLEDCGVFKQTPDGQAGLDRFLEKVSRQVAGDRR"
FT   gene            403376..404395
FT                   /locus_tag="Exig_0380"
FT   CDS_pept        403376..404395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0380"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: bha:BH2755 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59864"
FT                   /db_xref="GOA:B1YII1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII1"
FT                   /protein_id="ACB59864.1"
FT                   /translation="MTKQTALIRETDLIRHTLTQPGIEVEIWNYGGIINDIRVADRDGR
FT                   IESVVLGFDTLKEYRDHSPYFGAIVGRVAGRIGQAQMEVEGTVYPLAANDGRHHLHGGI
FT                   KGFDQTLFDIVEAATDRLHLRLVSPDGTEGYPGNVTLDAIYQLDGLELTLTMHATTDQT
FT                   TPLNLTNHTYWNLSGNLQRDILDHQLTIPSEMYLPVGADLLPTGELRDVTGTPLDFRSG
FT                   RSIRNGAESDHPETVAAGHGYDHPFLLSGQPIRLEDPASGRSLEVTTNQPVVILYTGTQ
FT                   LETDYEIRGVRSRPSLGLCLETQVHPNAVNEPSFPDILVKPNQIYHWEMTYRFGVNND"
FT   gene            complement(404824..405345)
FT                   /locus_tag="Exig_0381"
FT   CDS_pept        complement(404824..405345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0381"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bsu:BSU01820 O6-methylguanine-DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59865"
FT                   /db_xref="GOA:B1YII2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII2"
FT                   /protein_id="ACB59865.1"
FT                   /translation="MEVYFTRLNWNDTSFPIAASETGLCYVGALNEPSDLFDDWIRKHL
FT                   PRAELIEHPRIMQPYQEQLLEYLNGVRTRFSLPLHLIGTPFQLEVWQALCQVPYGVTVT
FT                   YSDIAKQIYRPGATRAVGTAISKNRVLIVVPCHRIVGKKGDLTGYWGGLNMKRQLLEIE
FT                   QVSSSKLPFL"
FT   gene            complement(405423..406823)
FT                   /locus_tag="Exig_0382"
FT   CDS_pept        complement(405423..406823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0382"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   KEGG: bha:BH0216 pyruvate dehydrogenase E3
FT                   (dihydrolipoamide dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59866"
FT                   /db_xref="GOA:B1YII3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII3"
FT                   /protein_id="ACB59866.1"
FT                   /translation="MVVGELTQERDLVILGGGPAGYTAAIRASQLGRTVTLIEQAQIGG
FT                   LCLNKGCIPSKVVAHAAEVKLQTKHMTALGFSFHPTHDFSQLVEYRERTIRQLRTGVEA
FT                   LCQANAIEVVHGTASFLADDRIGVELGHQFDTYRFNDVVIATGSHSIKQDAPSVLNAEQ
FT                   LYQLTELPERLVIIGQDYIAIEAAMSFQALGTSVTLIADAFDFDPSLDKELRRLFKKQK
FT                   IQLVTGTVTAIEAQEDVTVTVVKQGQETTWSAPFLFHSLPRVPHTLELGLERIGVTLAE
FT                   DGTIPVDPFGQTNRPHIYAIGDVTPGPAIATRAIHEAKRTAEHLSGQSADTTVPYYPTI
FT                   IRSLPPIVSIGLTEQTATDAGHSFRTAQFALNANGATTIEGGSGFIKVISDATTSLILG
FT                   IHMIGEGAIELAGVFAQTLELHAKEEDVRFPVMPHPSRNEAFTEAIEALLGQAIHLPPR
FT                   QQDVLAKS"
FT   gene            complement(406824..408038)
FT                   /locus_tag="Exig_0383"
FT   CDS_pept        complement(406824..408038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0383"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   oih:OB2875 pyruvate dehydrogenase E2"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59867"
FT                   /db_xref="GOA:B1YII4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII4"
FT                   /protein_id="ACB59867.1"
FT                   /translation="MIEVKLHDVGEGMTEGEIANYLVRVGDRVTIDQPVVEVSTDKMVA
FT                   ELPAPVSGVVTDLIIPVGQTVSVGTVLLLIEALETETAVTAEQPIQQTTEQIKVRPPVV
FT                   TPAVPSNNRRVLATPYTRKIAREHGIDLEQVPPSDPSGRVTEEDVRRFLDADTSVEKTD
FT                   VVEQTSTLSANPVETIPFRGIRKQIAKKMTQSLFTIPHVTHFEEVDMTRLLALREELKT
FT                   AGKPISVNAFFIKALIFALQDFPVFNAKLDEANEQIILEQQFHIGVATETADGLIVPVV
FT                   RDADKLTMQQLHTRVAELSARAKTGDLRAADLKPSTFTMSNVGPLGSTGATPIINYPET
FT                   ALIAFHKTKKRVCVDDHDQIVIRSMMNLSMSFDHRVADGATAVAFTNRFAGLIEHPTTL
FT                   LMELI"
FT   gene            complement(408051..409049)
FT                   /locus_tag="Exig_0384"
FT   CDS_pept        complement(408051..409049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0384"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: gtn:GTNG_1911 pyruvate decarboxylase
FT                   beta subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59868"
FT                   /db_xref="GOA:B1YII5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII5"
FT                   /protein_id="ACB59868.1"
FT                   /translation="MATPINRQTEMTLVQAVTDALRTKLTDDETTLVLGEDVGKNGGVF
FT                   RATDGLQEEFGEDRIIDTPLSEAGIVGTSIGLAVNGFKPIVEIQFLGFIYPAYEQIMTH
FT                   VSRIRMRTMGRYGVPMVIRAPYGAGIRAPEIHSDSTEALFTSMPGLKVVCPSTPYDAKG
FT                   LLIAAIEDPDPVLFLESMRSYRAFKEPVPSEAYTIEIGKANCITEGQDVTLIAWGAMVQ
FT                   VAQKAATEAATRGISCEVIDLRTLYPLDRETISASVQKTGRAVIIHEAQATGGLGNDLL
FT                   ALINDTSFLYLRAPVARVTGFDVPVPLFALEDHYIPTPTRVLEAIQRTVDF"
FT   gene            complement(409051..410103)
FT                   /locus_tag="Exig_0385"
FT   CDS_pept        complement(409051..410103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0385"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gtn:GTNG_1912 pyruvate decarboxylase alpha
FT                   subunit-like protein; TIGRFAM: pyruvate dehydrogenase
FT                   (acetyl-transferring) E1 component, alpha subunit; PFAM:
FT                   dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59869"
FT                   /db_xref="GOA:B1YII6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII6"
FT                   /protein_id="ACB59869.1"
FT                   /translation="METEFPIYRILDDAGQVTDTSKTDLLTKDLSLALFTHMNRIRTFD
FT                   RKAINLQRQGRLGTYAPFEGQEAAQVGSAYALQDKDWVFPTYRDHGATLTFGADMVRTF
FT                   LYWNGRVEGCVATDELHIFPPAVPIATQIPHAVGAAWAEKRKGSTQVAVAYFGDGATSE
FT                   GDFHEGMNFASVFQAPVILFNQNNGYAISVPIQKQMHSETIAQKALAYGMPSVRIDGND
FT                   VFAVYFTMQKALERARSGGGPTLIEAVTWRFGAHTTADDPSKYRDQERSRDRVDPLERL
FT                   EAFMKEQGFYDEQEIETIRSRHQEEVEAAVKTMESFPPPDVNDLFDHTFATLPDDLVRQ
FT                   KTDYLTARGN"
FT   gene            complement(410118..411260)
FT                   /locus_tag="Exig_0386"
FT   CDS_pept        complement(410118..411260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0386"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   gka:GK2031 phenylalanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59870"
FT                   /db_xref="GOA:B1YII7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII7"
FT                   /protein_id="ACB59870.1"
FT                   /translation="MNMLNPSTNPSLSIMEKISGHEQVVFCNDPVSGLQAIIAIHDTTL
FT                   GPALGGCRMAPYSTVDEALDDVLRLSRGMTYKCAAADVDFGGGKAVIIGNPATDKTPEL
FT                   FRAFGRFVDSLGGRFYTGTDMGTTMDDFVHASRETSRIVGIPEAFGGSGDSSIPTAEGV
FT                   IYGLRATVETLYGSDDLSRASYAVQGLGKVGYKVAEQLLSAGANLYVSDLSEAVLAALV
FT                   EQAEKTPGTVRVIAAHEIHLTDADIFVPCAYGGVIQAANIGQLQCKAICGSANNQLADD
FT                   ALALELQQRGILYAPDYIVNGGGLIQVADELYGANHERVLLKTKHIYDAVLEVFNESHA
FT                   ESITTLEAANRMCNKRIQIRSRHNNIFTNTIKPKWNIRND"
FT   gene            complement(411304..411699)
FT                   /locus_tag="Exig_0387"
FT   CDS_pept        complement(411304..411699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59871"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII8"
FT                   /protein_id="ACB59871.1"
FT                   /translation="MKNGLSLGDSAVIETTVTEEMFAQFEGVVVHPAYSTVSMVYHMEW
FT                   AARKLILPYLEEQEEGVGGAVSLKHVGMATLGSNIRIEAVVSELTPGRVLAKVEVRHGN
FT                   RVIGLGEVKQIILNKQLIQEKLTPHVF"
FT   gene            412025..413320
FT                   /locus_tag="Exig_0388"
FT   CDS_pept        412025..413320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0388"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: gka:GK2045 phenylacetyl-CoA ligase
FT                   (phenylacetic acid catabolism)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59872"
FT                   /db_xref="GOA:B1YII9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B1YII9"
FT                   /protein_id="ACB59872.1"
FT                   /translation="MYNEILETMEAEERTRLQLTSLRETVRHVMEHVPFYQTRFKERGL
FT                   DAEALQTMADIQKLPFTYKSDLREQYPFGLFAVPPHEAVRIHASSGTSGKPTVVGYTQS
FT                   DLDDWSTAVARGLVAIGAEKTDLLHNAYGYGLFTGGLGLHSGAEQLGMTIVPVSGGNTD
FT                   RQITLIEDFQPRGICGTPSYMLHLAERMEEKGLDPKMSSLRYGIFGAEPWSEELRQTLE
FT                   DKWGIRAFDIYGLSEIMGPGVAMECQEQNGLHLMDDLFITEVIDPVTGEPLPEGMVGEL
FT                   VFTSLKKKALPIIRYRTGDLASVTTEVCACGRTTTRMSRVKGRTDDMMIIRGVNVFPSE
FT                   IERVLLQQPGVTPHYQIHRIQRAGLEALELHIELEAGTVAEELKRVICHAMKTECLISV
FT                   DLICHPPYGLPRSEGKAVRIIDRRTESEKKFV"
FT   gene            413338..414309
FT                   /locus_tag="Exig_0389"
FT   CDS_pept        413338..414309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0389"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaG subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   gka:GK2044 ring-oxidation complex protein 1 (phenylacetic
FT                   acid catabolism)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59873"
FT                   /db_xref="GOA:B1YIJ0"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ0"
FT                   /protein_id="ACB59873.1"
FT                   /translation="MYDATHLFEPPVMTEEEKMERFKERIENGEKIEADDWMPDFYRDT
FT                   LIKLISMHGISEIMGALPEKEWVPKAPSLRRKLGIMAKVQDEMGHGQLLLRVVEDLMKP
FT                   YGKTRADLMDDLFTGRLKFHNVFHMPTRSWADAGTIGWLVDGAAIITQTNMLGASYGPY
FT                   ARALQRICAEEVFHAQHGESIIMALAEGTPEQKAMIQESLDEWWESLLMFFGPASKETT
FT                   GTSKQDVTIAYKIRTKTNEELRQNFFTKYVPRIRSLGLIIPDPTLRFDEETGQWIYAQP
FT                   DWTEFKKIIQGGCPRSKERLALRQTSYQNNAWVREALAETIG"
FT   gene            414323..414667
FT                   /locus_tag="Exig_0390"
FT   CDS_pept        414323..414667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0390"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaH subunit;
FT                   PFAM: phenylacetic acid degradation B; KEGG: gtn:GTNG_1928
FT                   phenylacetic acid oxygenase complex B"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59874"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ1"
FT                   /protein_id="ACB59874.1"
FT                   /translation="MTETFYQEFEVFSKRTPNAAFTHQFSLLAPNKEMALLMAQENFMR
FT                   REPVVDIWVVKRADIRGMTPDEKLMLQRLDNKDYRTTKGYGYLKKKWRHYEQQMLDEKE
FT                   IMSWQGGDSK"
FT   gene            414664..415449
FT                   /locus_tag="Exig_0391"
FT   CDS_pept        414664..415449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0391"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaI subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   gtn:GTNG_1927 phenylacetic acid oxygenase complex C"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59875"
FT                   /db_xref="GOA:B1YIJ2"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ2"
FT                   /protein_id="ACB59875.1"
FT                   /translation="MTETERLALASLLYQLADDDFLYAYRGSEWLGLAPHIEEDVASSS
FT                   IAQDSMGHAAMYYQLLEEIGEGKADALAHVRLAHERKNSVLVERVNGPGYYMENPEYDW
FT                   AYAVVRNYCYTLAKKVRIDSLKKSSYTPLAALAVKVNMELYYHLLHWQTWFTQLYQSTE
FT                   TARQKMDAALERVLADFGDLFDYGEASELIDEMRLIEGQGILLDRWYQALTPVLVDLNV
FT                   TLPEMKMTYNGRNGEHSPDLNDALSTLGEVYLLDQSAVW"
FT   gene            415446..415958
FT                   /locus_tag="Exig_0392"
FT   CDS_pept        415446..415958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0392"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaJ subunit;
FT                   PFAM: protein of unknown function DUF59; KEGG:
FT                   gtn:GTNG_1926 phenylacetic acid oxygenase complex D"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59876"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ3"
FT                   /protein_id="ACB59876.1"
FT                   /translation="MKGERQMTTRLEQEIRQALDTVKDPEIDAVSILDLGMVEATEWTE
FT                   TPFGYDVRVTLLPTFLGCPALDIIQKNTESALLQVPRVNTVNVVFLFDPPWTSDRITEQ
FT                   GIAGLKSFGIAPPRVVDGKWEIDCPYCGSTFVSIENLFGPTACRSILYCKSCKNPFEAM
FT                   KPVSTLM"
FT   gene            415974..416297
FT                   /locus_tag="Exig_0393"
FT   CDS_pept        415974..416297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0393"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD; KEGG:
FT                   bha:BH0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59877"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ4"
FT                   /protein_id="ACB59877.1"
FT                   /translation="MVKLIALYTHPENKEQFDEHYFNVHGPLTAKIPGLQQMTVTKIVG
FT                   SPMGGDGKYYLMCEMVYESHETMKAGMRSLEGKASGKDLMGFAGDLVTLMIGEEVHADA
FT                   TVR"
FT   gene            416275..417051
FT                   /locus_tag="Exig_0394"
FT   CDS_pept        416275..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0394"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bha:BH0201 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59878"
FT                   /db_xref="GOA:B1YIJ5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ5"
FT                   /protein_id="ACB59878.1"
FT                   /translation="MLTPQYVKASIDGRIGRIRLNRPERYNALNRAMIREIVEAMERFD
FT                   QDETVAVIVLNGEGKSFSAGADIEEMVDATPVSMELLDPFADWDRISRLHKPLIAAVHG
FT                   FVLGGGFELALACDLIYATPETQFAFPEVGLGVMPGAGGTQRLTKRIGRTRALEWLWTG
FT                   DRMPASEAQQLGIINRIVEADQLEAHVLTVAERIAAQPVMSVRLIKDAVDKAGNLSLQD
FT                   GMDHERRNFYLLFGTNDQTEGMQAFVEKRQPTFKGN"
FT   gene            417066..418574
FT                   /locus_tag="Exig_0395"
FT   CDS_pept        417066..418574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0395"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: gtn:GTNG_1922
FT                   putative betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59879"
FT                   /db_xref="GOA:B1YIJ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ6"
FT                   /protein_id="ACB59879.1"
FT                   /translation="MSTVHEKTIEMKRSVYHLVINGEQVEGTSGETFKTYNPATGEVIA
FT                   EVAKASKADADRAVQAARDAFDHGKWKMWPVGRRSQVLNKIAGIMRSRFNELVELEILD
FT                   TGKSLAAAQGQITQAIEDFEFYAGAIVGHRGSVNNVPGQFHNYTEKEPVGVCAQIIPWN
FT                   YPLMMAAWKVAPAIAVGCSVVVKPATLTPLTAIILGEICLEAGVPAGVVNVIPGSGREI
FT                   GNHLVEHPNVNKVAFTGSTPVGKDIMGRASESLKRVTLELGGKSPNLVFEDADITAAVD
FT                   GSLFGIFYNSGQSCEARSRLYIHEDIYDTFMEQFVAKTKQLVLGNPFDKGTHVGAIIDQ
FT                   QQLDVIDGYVQSAKADGATILTGGQVEKVAGFEEGFWYAPTIIADVTHDMKAVQEEIFG
FT                   PVVVVMKFKDEKEAVRLANDTEFGLGSAIWTKDGARATRIANQIKAGIVMINCPFSAFP
FT                   GTPFGGYKQSGFGRELCIETLDLYTETKSILSYYGSRPLNPFGL"
FT   gene            418627..419499
FT                   /locus_tag="Exig_0396"
FT   CDS_pept        418627..419499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0396"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   gka:GK2036 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59880"
FT                   /db_xref="GOA:B1YIJ7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ7"
FT                   /protein_id="ACB59880.1"
FT                   /translation="MMVQQMVVVGSGVMGRGIAYVAAASGFDVTLVDVEQQLLASAQQE
FT                   LETIADKGVSRGKMTTEEVGQLFDRLRYATDLEEAVKEADLVIEAVPERLEIKRMVFET
FT                   LDRHAPAECVFATNTSTMSPTEIASFTKRPERVMAMHFFNPVHRMPLVELARGLETSDE
FT                   TVMICETVAQQMGKETVVIQEFPGFVTSRISALVGNEAFYMLQEGLGTPEEIDKAIKLG
FT                   LNYPMGPFELGDLVGLDTRLNNLKYLHEKLGEKYRPAPLLEQYVKAGRLGRKTGRGVYE
FT                   YSDSGVKTR"
FT   gene            419496..420704
FT                   /locus_tag="Exig_0397"
FT   CDS_pept        419496..420704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0397"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: gtn:GTNG_1920 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59881"
FT                   /db_xref="GOA:B1YIJ8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ8"
FT                   /protein_id="ACB59881.1"
FT                   /translation="MRRVAIIDAVRTPIGRYNGALKDVRPDDLGACVIQALVDRNPNVD
FT                   PKQIEEVIFGNANQAGEDNRNVARMSGLLAGLPVEVAGTTVNRLCGSGLDAVIAAARAI
FT                   AMNEGDIYIAGGTESMTRAPFVMGKPETGFARGNPTLYDTTIGWRFVNEKLQGMYGTDS
FT                   MPETAEHVATRYGISRETQDDFAFSSQQRAKQAMETHRFQTELVPVRYTTRKGQVIEVD
FT                   TDEHPRPDTSREKLGTLKSLFPNGTVTAGNASGVNDGAAALLLMSEETAEHLGLTPLAY
FT                   YRASAVAGVEPAVMGIGPVDATRKVLKRAGLTVEQLDLIELNEAFAAQSVACMNELGLP
FT                   PEKVNVNGGAIAFGHPLGASGARILTTLIHEMCRTNQTYGLATMCVGVGQGIALIVERE
FT                   ELT"
FT   gene            420701..421471
FT                   /locus_tag="Exig_0398"
FT   CDS_pept        420701..421471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0398"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bha:BH0207 RNA-binding protein/enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59882"
FT                   /db_xref="GOA:B1YIJ9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIJ9"
FT                   /protein_id="ACB59882.1"
FT                   /translation="MIHLERLDHVAVIRVDRPERLNCFDYPTLVELKELVATVRREPDI
FT                   RVVLFTGTGKAFSAGADLKERVTLNETEVRRNVEMIRDVFADIARLPQPTIAAVNGHAL
FT                   GGGFEWMLACDFRIIVNGALVGLTETSFGIIPGAGGTQRLPRLIGETRAKEMIFTAKKI
FT                   DAETAERYGIVSRVVPTVEELMEVCLAFADEMLRNGPIAIRQAKQAIDQGLDHTLSEGL
FT                   KLETAAYETVIPTEDRLEALRAFAEKRTPQFQGK"
FT   gene            421548..422432
FT                   /locus_tag="Exig_0399"
FT   CDS_pept        421548..422432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0399"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="TIGRFAM: phenylacetic acid degradation operon
FT                   negative regulatory protein PaaX; PFAM: PaaX domain
FT                   protein; PaaX domain protein domain; KEGG: gka:GK2034
FT                   repressor in the phenylacetic acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59883"
FT                   /db_xref="GOA:B1YIK0"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK0"
FT                   /protein_id="ACB59883.1"
FT                   /translation="MSANTQSMIFTVYGDYIRHYGNQIWVGSLIRLLKEFGHNEQAVRV
FT                   AVSRMVKQGWLTSQKQGTKSFYSLTPRGVERMEEAARRIYKSTPHVWDGKWRTLMYTIP
FT                   EDKRQIRDELRKELSWSGFGNLSNGVWISPNPLEKEAERLIEAYDIKAYIDFFVGEYHG
FT                   PQQDQSLVERAFPLDELQERYEQFIAEYSRRYIVHQSRIQLGEMDEEQCFVERTTLVHE
FT                   YRKFLFTDPGLPQELLPDEWSGHHAALLFEQYYRLLAEPASRFFESIFRETHDVTQKSA
FT                   DYDASEHPLFAER"
FT   gene            complement(422484..423002)
FT                   /locus_tag="Exig_0400"
FT   CDS_pept        complement(422484..423002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59884"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK1"
FT                   /protein_id="ACB59884.1"
FT                   /translation="MKIPYRDSSPQLATNVFVAPGAFLIGDVTVGEESTIWFNAVLRGD
FT                   EGPITIGKRCSIQDNATIHLYEGAPVIVEDEVTVGHNAILHGCKIGRRSIVGMGATVLD
FT                   HADIGEECIIGANTLIPSGKKFPPRSLIIGSPGKVVRELTAADLEMIQESIDSYVDKGY
FT                   AFRKQLADN"
FT   gene            423086..424021
FT                   /locus_tag="Exig_0401"
FT   CDS_pept        423086..424021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0401"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   gka:GK2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59885"
FT                   /db_xref="GOA:B1YIK2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK2"
FT                   /protein_id="ACB59885.1"
FT                   /translation="MSRLCSKLKIDVPIIQGGMGNISHAELTAAVSNAGGLGTIGCGTM
FT                   TLAEVRQLIEATRRLTSRPFALNIAIRVSPHAEQLVELAIEERIPVISLSAGNPAPFLS
FT                   KLKQAGIQTIGVIASVKQAIKAEQAGIDVLVAEGVEAAGINSPLELTTMTLIPQIADHV
FT                   TIPVLAAGGIGDGRGLAAAWMLGAEGVQLGTRLIATQESRVHEQYKQHLVQADDLETRI
FT                   IGREVGQVRRVLNGPYVEALQPTSLTAFQEQTNESFHIKGALEGDETAGYVNAGLISGL
FT                   IDDVPTVAELFNRMMDDAFGRIERMYRTLQ"
FT   gene            424144..424572
FT                   /locus_tag="Exig_0402"
FT   CDS_pept        424144..424572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0402"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1775 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59886"
FT                   /db_xref="GOA:B1YIK3"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK3"
FT                   /protein_id="ACB59886.1"
FT                   /translation="MKGIVFALFSGLFIALQGIFNARLGDAVGPWISVTIVHFVGLIGC
FT                   LLIYGFVRDRKIGGFRTLPLIYASGGLLGVLVVVTELTSIQLLGMTWAMSLLLVAQILC
FT                   AFVIDLNGWFGVIKKSSNTGQWVGVGLMLTGVLIFSFA"
FT   gene            424593..425072
FT                   /locus_tag="Exig_0403"
FT   CDS_pept        424593..425072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0403"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   bpu:BPUM_1773 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59887"
FT                   /db_xref="GOA:B1YIK4"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK4"
FT                   /protein_id="ACB59887.1"
FT                   /translation="MGLGMFCAIVAGMMISLQTVLNARMSHAFGAWATTTLVFFVGLLG
FT                   SLLALIFFRGGTLAGLAEVEPLYLFGGFVGVGVVFCVMRGIQLLGPSIAISVVLISQLS
FT                   FALCVDVFGWFGLPKVELSFGQIIGLAVMLSGIFVLKRYQVAEDTEEVEDVKVIS"
FT   gene            complement(425162..425692)
FT                   /locus_tag="Exig_0404"
FT   CDS_pept        complement(425162..425692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0404"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: gka:GK2710
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59888"
FT                   /db_xref="GOA:B1YIK5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK5"
FT                   /protein_id="ACB59888.1"
FT                   /translation="MEKATFAGGCFWCMVTPFEELPGIHSIVSGYTGGHVDNPTYEQVK
FT                   TGTTGHSEVVEITFDPALFSYERLLELYWPQTDPTDAGGQFQDRGTQYAPAIFYHTEEQ
FT                   RLAAIASRDALAATNRFKQPIVTRIEPAHAFYPAEEYHQDFHKKNPAHYKKDRKASGRD
FT                   AFIDVAWKEEVTV"
FT   misc_binding    complement(425797..425900)
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (S box leader) as predicted by Rfam(R
FT                   F00162), score 41.40"
FT   gene            complement(425972..427145)
FT                   /pseudo
FT                   /locus_tag="Exig_0405"
FT                   /note="amidohydrolase"
FT   gene            427223..427516
FT                   /locus_tag="Exig_0407"
FT   CDS_pept        427223..427516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0407"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   son:SO_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59889"
FT                   /db_xref="GOA:B1YIK6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK6"
FT                   /protein_id="ACB59889.1"
FT                   /translation="MGEIIVNAVLTVKAGLADQVFPILSTVYKAAQNEPGCLRYTLHQS
FT                   IENEHQFMLYEVYRDEEALEAHIASDHYKAYREQIELYLEDRQVTKYVEMTF"
FT   gene            complement(427571..430000)
FT                   /locus_tag="Exig_0408"
FT   CDS_pept        complement(427571..430000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0408"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; SMART: SH3 domain protein;
FT                   KEGG: oih:OB2902 peptidoglycan hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59890"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK7"
FT                   /protein_id="ACB59890.1"
FT                   /translation="MATGKQFTQTATPVFETTESTAAVSTLPAATEVETFGVEGLFTRI
FT                   LLDGVYRFVKTDQLADTPTYPKIDSHYTNKVTALYSSADSSAATAQTFAPNSKIDTYGQ
FT                   VGLFTRVKQDADYLFVLTADLSTTPVYSATGERFVQQKTSVYPTADTVGTPLTTLKQND
FT                   SIKTFGTSGNVTRIEWNGTYAFVLTAHLGTKPVVSYEATGKKYSQQTANVYPTAATTGT
FT                   PLGILSQNQLVDIYGVSGAYTRVRLNGVYGFVLTAQLGNLEFFAQTARLYVQSPTPIRQ
FT                   APNASSPVLKEHQTNTLLTVYGTSGTYSRILFNGQYAYVLTSALAPLKVYAKTARLYVQ
FT                   TPTAIRSAPNASSPVLKQHQMNTLLTVYGTSGAYSRILFREQYAYVLTSTLAPTKVYAK
FT                   TGLRYASKSTAIFKDTTAKTIVRTMKRAEQIDIYGTSGSYTRVKLGSVYAYVKTADLVT
FT                   KKPDLYDVTGIRYVLDDKVVVHPKASLTGKIGTLKKNAQLSIYGTSGYYTRVKIGTTFG
FT                   FVDSSRLGLNKPVARPKVGTVFYVHFDQTPLFSADVAYSRPAGYLSKGTKLIGLKAIDD
FT                   DFWQVRLPNGTTGYVINPYIGTTKPDMRYTQQAINRQKIYTVKATSSYFATPVSPKSAG
FT                   LVEQGKRVYPRYRVGNFYVIQSGWSPVYLPVSAVTVKTDTRIAQKNTSRGEKLIQAAAK
FT                   HLGTPYTWGSQTAANGGFDCSGLIHYATNEAGKYGGRTNVSGYWYGAFFTNRRTTISSG
FT                   KRSDIVFFENTYTDGPSHIGIMLDNEYFIHAGGSQLQINSIYEPRWQEHFLGFKSM"
FT   gene            complement(430304..430861)
FT                   /locus_tag="Exig_0409"
FT   CDS_pept        complement(430304..430861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0409"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcl:ABC1441 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59891"
FT                   /db_xref="GOA:B1YIK8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK8"
FT                   /protein_id="ACB59891.1"
FT                   /translation="MRYKINEQLRIRRFTPEDLEAVHAYASKPIVSQYQSWGPNSESDS
FT                   KQFIHDALESELENPRRRYVFAVTFPDDRVIGAGELVITDTEHKIAEIGYILSPDEWGN
FT                   GYATSVAAFLLEFGFEKLELHRITATCDPRNVASERVLQKVGMTKEGQLRETVYLEDHW
FT                   RDSLIYGMLDWEWQVDHEDDPA"
FT   gene            431125..431454
FT                   /locus_tag="Exig_0410"
FT   CDS_pept        431125..431454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0410"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   bha:BH0686 chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59892"
FT                   /db_xref="GOA:B1YIK9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIK9"
FT                   /protein_id="ACB59892.1"
FT                   /translation="MAKYWLSIILASFFEVGWVIGLKHATTPLEWAATVVSIIISFTVL
FT                   IKVCNHLPVGTVYAVFVGLGTAGTVVTDIVLFDQSASVIKLILIAVLLVGVIGLKLVSG
FT                   EGEKQ"
FT   gene            431451..431768
FT                   /locus_tag="Exig_0411"
FT   CDS_pept        431451..431768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0411"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   bpu:BPUM_1203 DMT superfamily drug/metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59893"
FT                   /db_xref="GOA:B1YIL0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL0"
FT                   /protein_id="ACB59893.1"
FT                   /translation="MSWFYLILAGLFEMLGVVLINTYNQQKNVKNLLLMFAGFGFSFLF
FT                   LTLAMNELPMGTAYAVWTGIGAAGGTILSMIFYNEAKDWKRIVCIGLILSATIGLKLAG
FT                   E"
FT   gene            431886..432647
FT                   /locus_tag="Exig_0412"
FT   CDS_pept        431886..432647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:571801 hypothetical LOC571801"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59894"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL1"
FT                   /protein_id="ACB59894.1"
FT                   /translation="MDMKTKQYIGTFYKEEELISKMDELHQQGHREEDFYIIVKEKSNL
FT                   QLVRSQMDAEIATTKPSWIDRIRGNQGRDQEVNDLFGSLDLPADQVEVHKTEVEGGGFV
FT                   LLLEVQDIQFDPHLNTDNTHPDVKVRYGSYEETHTSDDANSNAQLGSGNPLDVDKDSKE
FT                   EHAEIDLHRAGTDKMPQDEEAIHHAKLKEDRKPDIAMRRDDDFKRPEWEEQKVRHEEQQ
FT                   DGKKDDIHRPNRSADHSDDLAKQDHGNDLDR"
FT   gene            complement(432721..433545)
FT                   /locus_tag="Exig_0413"
FT   CDS_pept        complement(432721..433545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0413"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bcl:ABC2110
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59895"
FT                   /db_xref="GOA:B1YIL2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL2"
FT                   /protein_id="ACB59895.1"
FT                   /translation="MEFVTLNNGLVMPQLGYGVFKVPEQEVYEAVREALRVGYRSIDTA
FT                   MIYENEAGVGRALKDSGIPREDIFLTTKVWNKDQGYERTLAAFETSLQKLGVDYVDLYL
FT                   IHWPMPDEDLYMDTWRALEQLYRDGKAKAIGVSNFHIPHLTRVLEEGTVVPAVNQIELH
FT                   PFLSQEAIRAFCQKNGIVVEAWSPLMKGRDALTDPVITDIAARHGKTPAQVVLRWHLQH
FT                   DIIAIPKSVTPSRIQENLDIFDFVLSPDDMRQIDQLNRNERTGSNPDEMHKK"
FT   gene            433684..434709
FT                   /locus_tag="Exig_0414"
FT   CDS_pept        433684..434709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0414"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: bcl:ABC0879 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59896"
FT                   /db_xref="GOA:B1YIL3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL3"
FT                   /protein_id="ACB59896.1"
FT                   /translation="MIRQAVLQYIHEEQAVDRLSELLRGRKAVLIHGEQALKSSEQYLP
FT                   ELPKLLFSGHCTDQQVIELTEQCAAYEMIIALGGGSVIDTAKQVAVKRNYPLIVIPTIV
FT                   SNCAPWTPLSVMYDERGRYLRFDTIPVVIEALLLDYRILAASPYDYFVAGLVDTLAKWY
FT                   EARALSGSTSDHPVVESALRMAEHCKRLILQTPISPKQFQEYSSPIQHLVETVIPLAGS
FT                   VGGFGDEATRGAIGHGVHNALSPFPSTNRILHGSKVGYGLLIQELLLDETVFYNELLQY
FT                   LMENKQPTTSTALGLTEAERADLAQRIGREPLCQLIETDWSKATVLSTLMKNDREAVLI
FT                   P"
FT   gene            complement(434764..435726)
FT                   /locus_tag="Exig_0415"
FT   CDS_pept        complement(434764..435726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0415"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: aeh:Mlg_2042
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59897"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIL4"
FT                   /protein_id="ACB59897.1"
FT                   /translation="MWHPCAECTTTIRFIEAGSLHIQSPTPEVFSYSSFEQLEQILSST
FT                   LQIGDFPVSCRAKGSRLVTPVLAASVLLEQLKSRQAIDFIQNGVMTSHLQPIFNIQDNS
FT                   LFANEALLRAADQTIPMSPGLLFSTASKMGLHSRLDQRAREEAIRATHLVGGTQKTFIN
FT                   FLPSTIYNPEYCLRHTFEIVERYNVDPSRLVFEVVETEKIEDVNHLKHVFEQYKKQGIQ
FT                   VALDDVGAGFSTLDMLSLLQPDYVKIDRAFISNCDTVAENEAFLRKARHLTKEMGIQIL
FT                   AEGIERQEELELCRELGFDFGQGYLLGHPAPYSELAKAQ"
FT   gene            complement(435937..436209)
FT                   /locus_tag="Exig_0416"
FT   CDS_pept        complement(435937..436209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0416"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="PFAM: protein of unknown function DUF1294; KEGG:
FT                   ppu:PP_2863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59898"
FT                   /db_xref="GOA:B1YIW8"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIW8"
FT                   /protein_id="ACB59898.1"
FT                   /translation="MTIFSTIAAFYGIMTVVGFISMWRDKRKAQQHAWRTPEATLLTIA
FT                   FLGGALGTLLAMQLVRHKTRTAKFQLFVPLAILLHATLWIFWIRS"
FT   gene            complement(436219..436959)
FT                   /locus_tag="Exig_0417"
FT   CDS_pept        complement(436219..436959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0417"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   dsy:DSY4449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59899"
FT                   /db_xref="GOA:B1YIW9"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIW9"
FT                   /protein_id="ACB59899.1"
FT                   /translation="MIWRRTRLLFTAFLVFFLLTPTAEAVSERTGAAFFIQDDAQLLTA
FT                   SEEAELARLGQELEQYTTAQVVLKTVPDLKGQDLSTYANETFRAQGIGQAGKDNGILVV
FT                   VAPNEKDRNFRIEVGYKLEGILTDITAGRILDKYAVPYRDQGDYGKAASETYKAVVSVV
FT                   SKEQSLESQDPVKKSTDGGLSTWAKVLIGAGLVLLLFLDMKFTGGMFFFAIINIFSAIM
FT                   RGGGGGGGGSRGGGGSSGGGGAER"
FT   sig_peptide     complement(436882..436959)
FT                   /locus_tag="Exig_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 26"
FT   gene            complement(436956..437549)
FT                   /locus_tag="Exig_0418"
FT   CDS_pept        complement(436956..437549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0418"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: cbe:Cbei_1896 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59900"
FT                   /db_xref="GOA:B1YIX0"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX0"
FT                   /protein_id="ACB59900.1"
FT                   /translation="MARRNRGGSKLPLIIGIAVVVLIAFLAIGQYNSLVNVEEDVSNKW
FT                   SQVDNQIKRRADLIPNLVETVKGVAGQEQKVYGDIAEAQAGLARAASTEQRIEADQQVT
FT                   SSLRGLIALQTTYPELKSSERFQSLMDTLEGTENRLGIARKDYNDAVTVYNKKRRSFPT
FT                   SLYASAFGFEKKPYYEISESDRENPTVDFNSDSK"
FT   sig_peptide     complement(437460..437549)
FT                   /locus_tag="Exig_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.610 at
FT                   residue 30"
FT   gene            complement(437659..438495)
FT                   /locus_tag="Exig_0419"
FT   CDS_pept        complement(437659..438495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0419"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: gka:GK0218 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59901"
FT                   /db_xref="GOA:B1YIX1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIX1"
FT                   /protein_id="ACB59901.1"
FT                   /translation="MTIIELLKALLLGFIEGMTEFAPVSSTGHMIIVDDMWLQTTDFLG
FT                   KYSANTFKIVIQLGSILAVIVVFWKRLFSLIGLYKIEGEHDASGTHKLKLRHVLIGLLP
FT                   AAVLGLLFEDFIDENLFSIDTVIIGLAAGAILMIAADKLGPKEPKTTSLDQISYRQAAL
FT                   VGLFQCISLWPGFSRSGSTISGGVFLGMNHRTAADFTFIMAVPIMFGASALSLVKNWEY
FT                   INVGDLGFYVVGFIASFGFALLSIRFFLKLINKIKLVPFAIYRLVLAAVLAVIVYM"
FT   gene            438667..440790
FT                   /locus_tag="Exig_0420"
FT   CDS_pept        438667..440790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0420"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: bca:BCE_0663 heavy metal-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59902"
FT                   /db_xref="GOA:B1YIX2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX2"
FT                   /protein_id="ACB59902.1"
FT                   /translation="MEAKTERLKITGIDCANCAAKVERGVASVAGIEQADLDFAGQKLY
FT                   LTYEKGAASDDTYQAVVERIQQLEPDVHLVRTASTEAVDPREHAGHDHSHPHDHGPFLN
FT                   RTKKIQYSVGMISFISAFFVPGSIDLLFFAVAYFLIGWDVLQTAVRNIRHGQVFDENFL
FT                   MVIATVGAFLIGEYPEAVAVMLFYQVGEFFQHRAVDQSRKSIAALMDIRPDIATLEDGR
FT                   RVSPEQVNIGQRIVVRAGEKIPLDGTVLTGEAFIDTTALTGESVPRRVRPTEPVLAGTI
FT                   NTDGHLLIQVDRPYNESTVAKILDLVENASRHKAPTEKFITRFARVYTPIVVLVATLLA
FT                   VVPPLVVTGATWSDWIYRALVFLVISCPCALVISIPLGFFSGIGAASKRGILVKGGNHL
FT                   EALQQLDTVVFDKTGTLTEGVFEVVELKAVHGSEDELLRVAATVEQHSNHPIAKSIQRM
FT                   YARHASVSTAVQDYQEVAGSGVTGRFGTDQIQAGNARWFKELGLTPLDQTEDGTYVHVA
FT                   QNDSYLGFIRIADRIKDTTVEALDGLKALGIRQTIMLTGDRRETAEQIGRQIGITQVKA
FT                   ELLPDQKVEQLEAILYQANGRVAFVGDGINDAPVLTRADVGIAMGGLGSDVAIEAADVV
FT                   LMTDEPKQLVEAIRIARATRRIVYQNIAFALGIKGVFLLLGAFGVATMWEAVFADVGVT
FT                   VLAVLNAMRILRK"
FT   gene            complement(440854..441666)
FT                   /locus_tag="Exig_0421"
FT   CDS_pept        complement(440854..441666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0421"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: cbf:CLI_1259 zinc
FT                   transporter, ZIP family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59903"
FT                   /db_xref="GOA:B1YIX3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX3"
FT                   /protein_id="ACB59903.1"
FT                   /translation="MMEWFTGLPVVMQALLAGMMTWGLTALGAALVFVFTTIEKRVMNM
FT                   MLGFAAGVMIAASFWSLLAPAIEFTEKDGGIAWLPAAIGFLAGGFFVRLLDFVTPHLHL
FT                   SAPLETAEGPSTGLKKTTLLFLAITLHNIPEGLAIGVAFGAAALNMDGATVAGALTLAL
FT                   GIGIQNMPEGAALSIPLRGEGMSRRRAFNYGQLSAIVEPIAAMVGAAAVFFIQPLLPYA
FT                   LAFAAGAMIFVVVEELIPESQAENGSDLATLGLMVGFTVMMILDVALG"
FT   sig_peptide     complement(441580..441666)
FT                   /locus_tag="Exig_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.688 at
FT                   residue 29"
FT   gene            complement(441736..442065)
FT                   /locus_tag="Exig_0422"
FT   CDS_pept        complement(441736..442065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0422"
FT                   /product="YolD-like protein"
FT                   /note="PFAM: YolD-like protein; KEGG: oih:OB2266
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59904"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX4"
FT                   /protein_id="ACB59904.1"
FT                   /translation="MTRYRDRGNLKWLPFLMPEHIQLLKAYYLETHQIDFPVIDEQLQY
FT                   PWQFLLEQALIEGIELEITYYSERGYVTTSGFIEQVHRERAYLVLRGSSRIEIPLGRII
FT                   RIENG"
FT   gene            complement(442049..443374)
FT                   /locus_tag="Exig_0423"
FT   CDS_pept        complement(442049..443374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0423"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   gtn:GTNG_2069 DNA-damage repair protein, ImpB/MucB/SamB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59905"
FT                   /db_xref="GOA:B1YIX5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX5"
FT                   /protein_id="ACB59905.1"
FT                   /translation="MNPILPFPDRRIFCVDSVSFYASCECRYRNLPPLTTKLAVVSDLT
FT                   RSGSVILAASPALKQLGIKTASRLYQIEQLPYRERKQIVLVEPRMLAYMKTSIEVLDVL
FT                   HQFAPPDAIRIYSIDENFVDMSGTERLFGSDTETAWKIQTAIWQQTGIPVRIGIGPNNV
FT                   IAKLVLDLRGKREGIAQCGYADVSRLLHDFPVRKMWGVGRMMEQHLSVMGIHTIGDLAA
FT                   APVEDLHERFGVIGAELWHHAWGIDGSPTIIDPMTLFRTAPDTKRTIGHGVTLMRDYYQ
FT                   YEQIRLVLAELASDVAARVRFSNQVGWTVHLGVRYSRHVARDGFSKQLRLPYPTADERL
FT                   LLRHILQLFEPNWLDGEPVRFLSVALGQLTPDQGTLQLSLFEDNTKVWRRKRLLKAIDH
FT                   VNLRYGKGTIRLAVSFLDTSVAKRRLRFVGGHPGGDLHDTLS"
FT   gene            443533..444180
FT                   /locus_tag="Exig_0424"
FT   CDS_pept        443533..444180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0424"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: efa:EF0905
FT                   pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59906"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX6"
FT                   /protein_id="ACB59906.1"
FT                   /translation="MKKQIIQLPELPQQLTSETFADVEIDDPYLYQTLYEKETLPVELT
FT                   ERLDVNQVCFRNVSFAGLVFERASFENVRFEQCDLTGCQFQDSRFHRVVFEDCRLTGIH
FT                   FESNTIDHVTIKDCQANYAQVIRTALRHVTLEQTSMRESHFFEMKPIDFRLHEVDLSES
FT                   QWVETALKGLDLRQADLSGITIDPRFLPGAIVTESQAITFARLLGLVIPSHG"
FT   gene            complement(444242..444997)
FT                   /locus_tag="Exig_0425"
FT   CDS_pept        complement(444242..444997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0425"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bpu:BPUM_0307 possible beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59907"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX7"
FT                   /protein_id="ACB59907.1"
FT                   /translation="MDIQQIRNATLVVNYANQVFLIDPFLGEKGSLPPFGETPNAVPNP
FT                   LVDLPVDVSTLLDPDAIFVTHLHADHFDETAKEILPKQIPLYAQNQADAATIREAGFTN
FT                   VSSFENGLALGDIRVYHTSGRHGVGEIGQRMGTVSGLVLTHPDEPTLYIAGDTIWCEEV
FT                   ETAIEQHAPDIIIVNSGAAQFLTGEPITMSQRDLLAVHQAAAEATIIVSHLESVNHCLL
FT                   RRDMIADFLAAHHLSAHFLIPDDGETISF"
FT   gene            complement(445066..445575)
FT                   /locus_tag="Exig_0426"
FT   CDS_pept        complement(445066..445575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0426"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bld:BLi01935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59908"
FT                   /db_xref="GOA:B1YIX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIX8"
FT                   /protein_id="ACB59908.1"
FT                   /translation="MMIRPVKEDDLKDILAIYNEGIEDRIATLETDTKELSFMEDWYRE
FT                   RTPRYAGFVAYEGTTILGFISLDPYNPRPVYQSVGELSVYITRTHRGQGIGRQLLHVIE
FT                   EHAITQGFHKLILFTFPFNKIGQKLYIRSGFRIVGTFKEQGMLNGYYVDVLAMEKLLPK
FT                   TIDDQI"
FT   gene            complement(445717..446256)
FT                   /locus_tag="Exig_0427"
FT   CDS_pept        complement(445717..446256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0427"
FT                   /product="Acireductone dioxygenase ARD"
FT                   /note="PFAM: Acireductone dioxygenase ARD; Cupin 2
FT                   conserved barrel domain protein; KEGG: bsu:BSU13620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59909"
FT                   /db_xref="GOA:B1YIX9"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR023956"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIX9"
FT                   /protein_id="ACB59909.1"
FT                   /translation="MATVLFQKTNERYTDQNEVSAFLASRGVLYEQWDVSKLPAELVDT
FT                   YTLTDADKQTILDTFQSEITDVSERRGYQTADIISLSDATPNLDELLVNFQKEHHHTDD
FT                   EVRFIVSGHGVFAIQDDEVGYYNIELNPGDLISVPVNTRHYFTLQEDRKVVAVRIFVTT
FT                   DGWVPIYEKDPIETAN"
FT   gene            complement(446272..446892)
FT                   /locus_tag="Exig_0428"
FT   CDS_pept        complement(446272..446892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0428"
FT                   /product="methylthioribulose-1-phosphate dehydratase"
FT                   /note="TIGRFAM: methylthioribulose-1-phosphate dehydratase;
FT                   PFAM: class II aldolase/adducin family protein; KEGG:
FT                   bpu:BPUM_1254 possible aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59910"
FT                   /db_xref="GOA:B1YIY0"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY0"
FT                   /protein_id="ACB59910.1"
FT                   /translation="MTFLTRYEELRAIKQEFAARDWFPGTSGNLAIRTNSSPTEFLVTA
FT                   SGKDKRQDTPDDFVHVDATGQLIGEQNGRPSAETLLHVEVFNRTTAGCSLHVHTVDNNV
FT                   ISELYGDRGEIRFRSQEIIKALGRWEEDAEVIVPIITNHADIPTLAADFAKHIRTESGA
FT                   VLIRNHGITVWAPTAFEAKKQLEAFEFLFSYTLKLQACRQAIY"
FT   gene            complement(446889..447548)
FT                   /locus_tag="Exig_0429"
FT   CDS_pept        complement(446889..447548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0429"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; HAD-superfamily hydrolase subfamily IB
FT                   hypothetical 1; KEGG: gka:GK0954
FT                   2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59911"
FT                   /db_xref="GOA:B1YIY1"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR017718"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY1"
FT                   /protein_id="ACB59911.1"
FT                   /translation="MTIRILCDFDGTVTEHDNIIALMTEFAPPEAFEPLKKGVLDQSLS
FT                   IQSGVGQMFRLLPSDRKQDYIDFLEQRAVIRPGFKTLLAFAKSNGIDFAIVSGGIDFFV
FT                   QPILQELLTDEAIYCNGSDFSGETIRIEWPHTCDAACNNQCGCCKTSIARKLKQDGDII
FT                   VTIGDSVTDFELAKQADHVYARDYLITLCEQHGIAYTPFETFYDIVDHLQTTEVYA"
FT   gene            complement(447545..448735)
FT                   /locus_tag="Exig_0430"
FT   CDS_pept        complement(447545..448735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0430"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /note="PFAM: ribulose bisphosphate carboxylase large chain;
FT                   KEGG: bpu:BPUM_1252 rmethionine salvage pathway
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59912"
FT                   /db_xref="GOA:B1YIY2"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR017717"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY2"
FT                   /protein_id="ACB59912.1"
FT                   /translation="MTYITATYQLGTTDQLPKRAEQIALGLTVGSWTDLNHLEQQQLES
FT                   FKGQVVHTEEHDGKGYITIRYPEHNVSRDFSAILTTVFGKLSLDGQIKLTDLQLPASFT
FT                   TDFPGAKFGIEGVRQLIQVHDRPLLMSIFKGVIGRDLTFLREQLEAQLAGGIDLVKDDE
FT                   ILYDNPLTPALDRARIGRDVLNAHYEKTGKRALYAITLSGSVFGLKDQTKRLIEAGATA
FT                   FLLNTFTYGLDVLRELAADPDISVPIFNHPALSGALIASPEYGIAAPVLLGTLPRLAGA
FT                   DLTLFPSPYGNVALAKDLARGIAVEATRIGETKTILPVPSAGIHPGLVAQLVHDFGTDS
FT                   VINAGGGVHGHPQGAAAGVLAFRQALDAALAGESLTSAATRQEELRVALDAWGITK"
FT   misc_binding    complement(448816..448917)
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (S box leader) as predicted by Rfam(R
FT                   F00162), score 71.39"
FT   misc_binding    449125..449227
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="SAM riboswitch (S box leader) as predicted by Rfam(R
FT                   F00162), score 64.48"
FT   gene            449306..450475
FT                   /locus_tag="Exig_0431"
FT   CDS_pept        449306..450475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0431"
FT                   /product="5-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /note="KEGG: bsu:BSU13560 methylthioribose kinase; TIGRFAM:
FT                   5-methylthioribose kinase; PFAM: protein of unknown
FT                   function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59913"
FT                   /db_xref="GOA:B1YIY3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY3"
FT                   /protein_id="ACB59913.1"
FT                   /translation="MGYQAFTVQDAIERVRTLGLIGNEPVTAEEIGDGNLNLVFRIQAG
FT                   EKRLILKQALPYAKVVGESWPLSLERAWIEQSALKEFAKVAVPFVPHVYHASKEEAFTV
FT                   MEDLSHLTIVRGGLLEGEKYPLLAEHIGSYLARTLFYTSDFAVGPVAKKQIARQYYNPD
FT                   LCDITEKLIFTDPFYDAETNAIEAGLEAEVDRIWNDAELKREVAKLEALFITKGDALLH
FT                   GDLHTGSIFASAEETKVIDPEFAFYGPFGFDVGQFIAHLFFAAYPDYDRLRDERIKDID
FT                   TFWLTFASTFKALWEREAVEPFRKADGLVDDVLSTILQDALGFAGCELIRRTIGLALVA
FT                   DLEQISDSTVRLERKRHALRLGAALIKRRTECKTFTDLRNFDVTEELSR"
FT   gene            450472..451518
FT                   /locus_tag="Exig_0432"
FT   CDS_pept        450472..451518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0432"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: gtn:GTNG_0837 methylthioribose salvage
FT                   protein; TIGRFAM: translation initiation factor, aIF-2BI
FT                   family; eIF-2B alpha/beta/delta-related uncharacterized
FT                   protein; PFAM: initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59914"
FT                   /db_xref="GOA:B1YIY4"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIY4"
FT                   /protein_id="ACB59914.1"
FT                   /translation="MSQFVQSIIYENRTVTILDQTRLPEEEHYEIIHDLAQAIDAIKQL
FT                   RVRGAPAISLFGGFVLVQEAFRTTGTLAEAKQELLEVSAQLLATRPTAVNLRNVLDELN
FT                   QLIVSATTLKELPVRLEQKALELYQTDAKTSRQIGVHALELFESGDRVLTICNAGSIAT
FT                   AAYGTALAPFYLAKEQGIPLSVYASETRPLLQGARLTTWELQRAGIDVTLITDNMVAHT
FT                   IKEKQITAIIVGADRITRNGDTANKIGTFQLALLARAFGIPFYVAAPLSTFDFTSLSGD
FT                   EIEIEERDAREVTQLAGKATAPAGVPVFNPAFDVTPHDLITAIITELGVIEHPDVETIK
FT                   RTIGQHTH"
FT   gene            451538..452620
FT                   /locus_tag="Exig_0433"
FT   CDS_pept        451538..452620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cko:CKO_03979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59915"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY5"
FT                   /protein_id="ACB59915.1"
FT                   /translation="MKKLALAVLAPAVLLAACANSEATPVKKISGVPEGVQGDVKIAVI
FT                   RNLASDDHTKQFLDGARSEGEALGFQVNTFISEGNDVKFKELVAQAVQQDYDGLIISHG
FT                   KEDYAYDMIKPAIDKGIKVVTFDTVTKKKDQTLKGITETFQDDHKLAQLSLDEVTKVKD
FT                   DKPVRVIKLWFGPGFAPLDRRQEIYKTYEADGKIKTLETVGPTNFQDVQGDIATKMNAI
FT                   LAKYPKGSIDAVWGAWDEVAKGAYKSLKDNKRQEIPLISIDVSNQDINLMREKGSNWVS
FT                   TSAVDPHLIGQTDMRLLAKKLAGEKTPDSFDLDAKLVEQKALKADTTMYNLDTIIKGWS
FT                   TSEKFNEPWMDQLRKANDGK"
FT   sig_peptide     451538..451603
FT                   /locus_tag="Exig_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.501 at
FT                   residue 22"
FT   gene            452617..454140
FT                   /locus_tag="Exig_0434"
FT   CDS_pept        452617..454140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0434"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pmo:Pmob_0637 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59916"
FT                   /db_xref="GOA:B1YIY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY6"
FT                   /protein_id="ACB59916.1"
FT                   /translation="MTPPVNEQRLEMRGISMEFPGVKALDDVHFSVKRGEIHALVGANG
FT                   AGKSTLMKVLAGAYASYEGTILFDGVPLAIDSPNAAKRAGIEIVYQEVDTALVDYLTVA
FT                   ENICLDMLASGQLKGVIRRRRYEEIAERALQKLKASIDVRQRVSELRLAEKQLVLIARA
FT                   LVQESRFLILDEPTAPLSGRETEQLFRIIRELAEKEHLGVIFISHRLQELFEICESISV
FT                   MRDGKMVSRQLLAGQTKETVVEQMLGRRLQKSSREARPAGAPSLELDRITVAGQLDEIS
FT                   LTVRAGEVIGIAGLVGAGKTELCKTIFGSIPVTSGLMRLAGETRRIRSAYDAVRLGIGL
FT                   VPEERRKEGILVADPIEQNMTAASLKQFVNRFGFVEKKKERAAANRIVQQLSIKVSDTR
FT                   QRAAELSGGNQQKVAIGKWLLADASVLVLDEPTKGVDVGAKAEIFQVIDQLAAEQKAVI
FT                   YASSELDELLAVTDRIYVMYDGQIVFEATTSETTEEQLLWYATGGQQHE"
FT   gene            454133..455152
FT                   /locus_tag="Exig_0435"
FT   CDS_pept        454133..455152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0435"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   spe:Spro_3219 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59917"
FT                   /db_xref="GOA:B1YIY7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY7"
FT                   /protein_id="ACB59917.1"
FT                   /translation="MNDVLHEPAAQPEAPRTAAGKPVLRFLNDWGIVLAILALILFFAM
FT                   TAPNFLQGTNLVNILRSISIVTIIAIGLTVSLTVNGFDLSVGSTATFASSLVVSFFVWY
FT                   SLPLGVSIGLALVIALAVALVNILLIVKFKIPDLFATLATMFIFEGVAMTYTGGGSISA
FT                   GMPRLDGTPTVGLIPESFLKISQAPWIILIMLVVVAVTHVFLNHTRHGRFLYIIGGNPE
FT                   AAHLTGIRVNRYRAVAYLIAGLLAAVGGILLASQVGSSQINAGSGYLMPAVAAAFIGSS
FT                   FAGQGKPNALGTLVGACLVGILENGLVMLSVPYYSLNIIKGAVLAIALASTYYRFKKN"
FT   gene            455518..456474
FT                   /locus_tag="Exig_0436"
FT   CDS_pept        455518..456474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0436"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: bpu:BPUM_0545 methanol
FT                   dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59918"
FT                   /db_xref="GOA:B1YIY8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY8"
FT                   /protein_id="ACB59918.1"
FT                   /translation="MRTYTKEIQAIIDNVEKVIIGKENVITQSLAALLAGGHVLLEDVP
FT                   GVGKTMLVRAFSRSIGLTFKRVQFTPDLLPSDLTGVSMYNQKTSQFEYRPGPLMGNIVL
FT                   ADEINRTSPKTQSALLEGMAEANVTVDGEIHTLPNPFFVMATQNPIEHEGTYPLPEAQL
FT                   DRFLIKVKMGYPDFQQEMKLLTRFERDEPIETLESVITRDELLRMKEDVKAVHVSQPVK
FT                   KYIVHLVQATRTHASLYLGASPRSSIALMKVAQAWAYMEGRSFVLPDDVKELLTPVLSH
FT                   RLILTADARYHGQTAERILEQVKKEVAVPIQQDVESL"
FT   gene            456471..457553
FT                   /locus_tag="Exig_0437"
FT   CDS_pept        456471..457553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0437"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   bpu:BPUM_0546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59919"
FT                   /db_xref="GOA:B1YIY9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIY9"
FT                   /protein_id="ACB59919.1"
FT                   /translation="MTKWQIGWRYAVLLITVTALWIYARIDGGNVASLLVYIMAGLTVY
FT                   WTLFLIWPVTQAIATREVSNKMLIAGTDLPVSLRVRRKYPFLIGAVDVTEAVPDTLSEE
FT                   PLDIRHPLRAHYRKVEHIDYLIPSIRRGLYQIPGCVLEIRDPFGLFMRKKLYPVETYLA
FT                   VEPARLAVQLPHEDDRGDGGISPVSLDLRQSSFTVVGVREYVSGDRMNQIDWKSTAKRQ
FT                   GLMTKTFEREQERETTIVFNEGTVSDENFEKSISMLAAATDQLNKRHLNYRIHLVGHGV
FT                   QSLSLPLEGAKLTHYLMTAQPSRTRSFIESWEYSSKALRLSGNVLFITPDLESNNEMWI
FT                   SKIRQEASVHVYTPERRTTG"
FT   gene            457550..459622
FT                   /locus_tag="Exig_0438"
FT   CDS_pept        457550..459622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0438"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   oih:OB0715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59920"
FT                   /db_xref="GOA:B1YIZ0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ0"
FT                   /protein_id="ACB59920.1"
FT                   /translation="MMRRLIWNLLAGLLFASFMPPLLELTTFESVIPFLPLLLTPLLLS
FT                   HVRRSWFLLGSLLALLVSFYLILIPGEAPWNLFREIAGDINRVINGELPGRPAFAFSIG
FT                   LISFLIGYLARRTFPNRGFVFGLALGVIGFIAYCDTWTDYSGEQFIIYPIVLALFLLYA
FT                   TEVSERPMASYVRPFSALLIIGATVVAAVQSPVITATWQDSWYDWTDGFESEGTSSSQI
FT                   QKVGYGNNDEQLGGPFQMDDREVFQVESEGSRYWRVETKDVYTGKGWVLSKSEPEIDSR
FT                   GFFSHFGDDVKKREERATFELSRELPFVPYNGDNVRLSVDKQRQNLLIDPENQKVSYLD
FT                   DAERQQNYQIQYTYPLFTEELLQTDEPITLSEMEQDRYLQLPDTLPNRVRDLAEEIVAD
FT                   EDSPWDKAKAIESYFEQENFEYNTEEVAVPEENQDYVDQFLFETKLGYCDNFSTSATVL
FT                   LRAVGLPARWVKGFTGGESDVIGAAVTSYTVRNKNAHSWVEVYIEGPGWVPLEPTVSFD
FT                   GAGQYTIDQETNNETEQANPQRDTETDTETATPERPQENLLDEEQTTTAAQTEQQSFPI
FT                   WPVVGVIVGLVFLYLFRKPLTRTAAILFFRNQLHRPEGFKRMYRFLLRRLDKQGFHYKD
FT                   GRTLTELAHEVDGYYETYAMRPLTDAYERMVYGGESLSVDKKREYFENIIRRIEG"
FT   sig_peptide     457550..457624
FT                   /locus_tag="Exig_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.676 at
FT                   residue 25"
FT   misc_binding    459660..459762
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch as predicted by Rfam
FT                   (RF00167),score 63.74"
FT   gene            459867..461411
FT                   /locus_tag="Exig_0439"
FT   CDS_pept        459867..461411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0439"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; ExsB family protein; KEGG:
FT                   bha:BH0607 bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59921"
FT                   /db_xref="GOA:B1YIZ1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YIZ1"
FT                   /protein_id="ACB59921.1"
FT                   /translation="MEAHLDQEMILVLDFGGQYNQLITRRIRDLGVYSELHSHKITAAE
FT                   VKDIAPAGIIFSGGPRSVYAEDAYRCDPEIFDLGIPIFGICYGMQLMSQHFGGTVERAG
FT                   HREYGKATLTLNDPSPMYANLPLEQTVWMSHSDLVTSVPNGFVVDGTNVSCPIASIKNE
FT                   ELKMYGVQYHPEVNHTMFGKELLKNFLFEVCQCTGDWSMENFIEIEIAKIKEEVGDKKV
FT                   LCALSGGVDSSVVAALIHAAIGDQLTCMFVDHGLLRKGEAESVMKTFADHFHMNVIKID
FT                   AQDRFLNKLKGISDPEQKRKIIGNEFVYVFDEEASKLTDMDFLAQGTLYTDIIESGTDT
FT                   AQTIKSHHNVGGLPEDMQFKLIEPINTLFKDEVRELGKELGLSDEIVWRQPFPGPGLGI
FT                   RVLGEITDEKLEIVRESDFILRDEIKKAGLEREIWQYFTVLPPLRSVGVMGDERTYDYA
FT                   VGIRAVTSIDGMTSDWARIPWDVLEKISVRIVNEVQNVNRVLYDVTSKPPSTIEWE"
FT   gene            461712..462251
FT                   /locus_tag="Exig_0440"
FT   CDS_pept        461712..462251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lwe:lwe0405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59922"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ2"
FT                   /protein_id="ACB59922.1"
FT                   /translation="MIDWTWPEVDRLEHQENWNEAKEYLIKAWQQNPTDLKTTVRLGFF
FT                   CWYVVVEQGPLGITDADIDTDELESVLTEVTNFGLAHFITHEDFLWCFGYMISMFPYYF
FT                   GDYEQWEEKGISMLKHAYELYPEEPIYKYSYLGSFTNTYRTRRTSKNELKRVKPVLEDR
FT                   FRGEGLLSEYFKSIFS"
FT   gene            462564..463508
FT                   /locus_tag="Exig_0441"
FT   CDS_pept        462564..463508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bsu:BSU28340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59923"
FT                   /db_xref="InterPro:IPR019060"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ3"
FT                   /protein_id="ACB59923.1"
FT                   /translation="MSRKENTFIDVFNTQAEVLSKVNELKAQGYNESDMYVVAQDKDSF
FT                   SMLKDQTDVHVDTTGEEQHQGFMGKFMAAFSEDSSAGAFSGMGLDRTESEEYRRQVQNG
FT                   KLVLYVDSEYGDSYEKHNQSYGVASDMNGDQGYGTTSGVDRNQDYDNSSKTDRTSSIAP
FT                   DAGTEEERLRLHEERLNVDKERVQTGEVNVSKRVVEDQQSIEVPVEREEVYVERRPVNE
FT                   SETRTDAFVDENDSIHVPLSEERVVVSKQDVVTEEIVVGKRKVQDTETVSETVRREEAD
FT                   INDGTNMTNDLNRDNDRDNRLDRDNDLDRDERR"
FT   gene            463693..464562
FT                   /locus_tag="Exig_0442"
FT   CDS_pept        463693..464562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0442"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: oih:OB3032
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59924"
FT                   /db_xref="GOA:B1YIZ4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ4"
FT                   /protein_id="ACB59924.1"
FT                   /translation="MNGRDRVYDHAKLILIFLVVLGHIIEPFISKSRGLEGIFNFIYLF
FT                   HMPAFIFISGYFTKGKLTFRTGLKLSLDYFVLFIMIQLVFVAVMKGIGIDQYQFLTVQP
FT                   AYIYWYLFAMFVWSLMLPAALWLGRSVKIGIGRVFLVSVLVALGAGYIDQIGWAWSLSR
FT                   IVVFFPFFVLGYYFKSRGWIIYQVFPNRWMALAVMLAGALMMWIWPDLFQFNLVSGANS
FT                   YAKIGLNDTGLIVRLVLYLTQWMMIMAFFTLLPKRPFVLSHLGTKTLTIYILHGFIVKG
FT                   LIATAYFN"
FT   gene            464692..465793
FT                   /locus_tag="Exig_0443"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(464692..465378,465380..465793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Exig_0443"
FT                   /product="putative transposase IS891/IS1136/IS1341 family"
FT                   /note="PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; KEGG: bcz:pE33L466_0042 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59925"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ5"
FT                   /protein_id="ACB59925.1"
FT                   /translation="MIALLKAYKFRLYPTKSQQEYFMKTFGCVRFVYNKMLEERIRLYE
FT                   DSKLNPGVKQKLPTPAKYKPEFPFLKEVDSLSLANAQMDLNRAYQNFFRDQSVGFPKFK
FT                   SKHNDRASYTTNNLKGSIRIEDRKVKLPKIGFVKLKQHRSFDGVIKSATVSMTKTSKFF
FT                   ISILVDQSEEQWVPAKNKVGIDLGLEHFAILTNDEWTSEKVANPRFLRKSEEKIKKAQL
FT                   ALSRKKKGSKNRDKARIILAKKHEKIVNQRQDFLHKLSKRMVDDNQVIVVETLKSNNMM
FT                   KNHKIAKSIGDVSWYEFVRQLAYKCTFYGRTLIKADQWYASTQSCSSCGTKGEKKTLDV
FT                   REWTCTCGAHHDRDINASINLLLLAD"
FT   misc_binding    466079..466181
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch as predicted by Rfam
FT                   (RF00167),score 71.67"
FT   gene            466268..467620
FT                   /locus_tag="Exig_0444"
FT   CDS_pept        466268..467620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0444"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   oih:OB0723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59926"
FT                   /db_xref="GOA:B1YIZ6"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ6"
FT                   /protein_id="ACB59926.1"
FT                   /translation="MSTQMKPQQPKQKENAIARYFDFNGLGTNMRTEFIAGMTTFFAMA
FT                   YILFVNPNTLAEAGMDAGAVFGATALVAIIGSVTMGLLANYPIALAPGMGLNAFFAYSV
FT                   VIGMGIPWQTALSGVLVSGLVFMVLTASGIRETIINAIPEPLKMAVAAGIGLFIAFIGL
FT                   KTGGIVVANEATLVSLGNLGQGTTLLAVFGLVISAILMTRGIKGAIFFGMIITAIAGMI
FT                   FGLIPVPSGLGEIVSAPPSIAPTFGQAFLHFDEIFTVQMAVVILTFFFVDFFDTAGTLV
FT                   AVANQAGLIKENKVPRAGRALIADSTATVAGSILGTSTTVSYIESSAGVAAGGRSGMTA
FT                   IVTGLFFGLALFFSPLLAIITAPVTAPALIIVGVLMASSLLQIDWKKFEYAVPAFLTVI
FT                   MMPLTYSIATGIAFGFLFYPITMIAKGRGKEVHPIMYAMSLGFLAYFIWLH"
FT   gene            467711..468622
FT                   /locus_tag="Exig_0445"
FT   CDS_pept        467711..468622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0445"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: gtn:GTNG_2962
FT                   prolyne dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59927"
FT                   /db_xref="GOA:B1YIZ7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ7"
FT                   /protein_id="ACB59927.1"
FT                   /translation="MIEKITGPVFEYLAEHKGLIETARKVGLPLGGTFFVGGQETEETI
FT                   QTVRELNEDGRAVTVDCLGEFIEKEQDAIGIADECIKVIHRISEEKLNAQVSLKLTSVG
FT                   LRLNPKIAVAQMTRILETAETFNLRVTINMEEEAVCESIIQVFEQLHRRFSNVGIALQA
FT                   NLYRTRFDLERLQSTVRVVKGAYTGPEDIYIERKETVDATYLQLVKQNLLQGCYTQVAT
FT                   HDEDMIQEVIRFVHRQGIGFDQFEFQMLQGMRPRRQQELVAEGYRVVIYVPHGVDWYTY
FT                   LMKRLAERPANIGFTAMSMLRL"
FT   gene            468958..470512
FT                   /locus_tag="Exig_R0054"
FT   rRNA            468958..470512
FT                   /locus_tag="Exig_R0054"
FT                   /product="16S ribosomal RNA"
FT   gene            470695..473589
FT                   /locus_tag="Exig_R0055"
FT   rRNA            470695..473589
FT                   /locus_tag="Exig_R0055"
FT                   /product="23S ribosomal RNA"
FT   gene            473645..473759
FT                   /locus_tag="Exig_R0056"
FT   rRNA            473645..473759
FT                   /locus_tag="Exig_R0056"
FT                   /product="5S ribosomal RNA"
FT   gene            473856..474062
FT                   /locus_tag="Exig_0446"
FT   CDS_pept        473856..474062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59928"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ8"
FT                   /protein_id="ACB59928.1"
FT                   /translation="MAKKQKMRVAVEENETISDCLDRIDAMGYRPTVRREEPIFGLDAN
FT                   DEPYPIRQQIIFDCKPKLEAENV"
FT   misc_binding    474287..474389
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch as predicted by Rfam
FT                   (RF00167),score 72.51"
FT   gene            474480..474971
FT                   /locus_tag="Exig_0447"
FT   CDS_pept        474480..474971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0447"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: lwe:lwe1793 phosphoribosylaminoimidazole
FT                   carboxylase I; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59929"
FT                   /db_xref="GOA:B1YIZ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1YIZ9"
FT                   /protein_id="ACB59929.1"
FT                   /translation="MSKVEIGVIMGSQSDWVTMQKTCDVLDQLDIGYEKKVVSAHRTPD
FT                   LMFRYAESARERGLKVIIAGAGGAAHLPGMVAAKTTLPVIGVPIQSKALQGIDSLLSIV
FT                   QMPGGVPVATVAIGDAGAKNAGLLAAQILGTVDERIARALDHMRVELEGDVIASEVYLT
FT                   "
FT   gene            474968..476071
FT                   /locus_tag="Exig_0448"
FT   CDS_pept        474968..476071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0448"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bcz:BCZK0264 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59930"
FT                   /db_xref="GOA:B1YJ00"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ00"
FT                   /protein_id="ACB59930.1"
FT                   /translation="MKRVGILGGGQLGRMMALSARQMGYSLITLDPTENAPCAQVADQQ
FT                   IQAPFTDVEAAKRLAAESDVVTYEFENISHEVAEAIGYKLIHGTELLFRTQHRIREKEL
FT                   IEQLGYKVAPYQGVQTSEDLLGAKRQLGFPFVLKTARFGYDGKGQTVIRTELDLQTAMK
FT                   TFEATEYVAEKWLPFDQEISVIVMRSERETKVFPVSENIHQDNILHLSIVPARIPIDLE
FT                   QKAIELATRLANDVDLIGTLAIELFVVGSELIVNELAPRPHNSGHYSIDACETSQFEQH
FT                   IRAICGLPLGDTRLTTPVVMANILGQHITALDEALPMLSSRTKVHLYGKQDAKQGRKMG
FT                   HLNILADSVEEALAEVERLQIWKETVR"
FT   gene            476068..477363
FT                   /locus_tag="Exig_0449"
FT   CDS_pept        476068..477363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0449"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: bld:BLi00695 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59931"
FT                   /db_xref="GOA:B1YJ01"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ01"
FT                   /protein_id="ACB59931.1"
FT                   /translation="MIERYTRPEMKAIWTEQNKFEAWLKVEILACEAWSELGVIPKEDV
FT                   QLLWEKASFDVNRINEIEQETRHDVIAFTRAVSETLGEERKWVHYGLTSTDVVDTALSY
FT                   LLKQANDILAADLDRFIEILKVKANEHKYTVMMGRTHGVHAEPTTFGLKLALWYEEMKR
FT                   NKVRFEAARETVEYGKMSGAVGTFANIDPFIEKYVCEKLGTKPAPVSTQTLQRDRHAHY
FT                   MSTIALIATSIEKMATEIRGLQKTETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIILPDATGLLNYMLNRFGNIIKNLTVFPEN
FT                   MKRNMDRTFGVIFSGHVLLALIEKGWSREAAYDFVQPRAMQAWEEQIMFRDVLWQEADI
FT                   QELFTEEELDACFDPTYHTSRVDEIFERCGLN"
FT   gene            477424..478131
FT                   /locus_tag="Exig_0450"
FT   CDS_pept        477424..478131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0450"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: bsu:BSU06450
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59932"
FT                   /db_xref="GOA:B1YJ02"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ02"
FT                   /protein_id="ACB59932.1"
FT                   /translation="MQPLYEGKAKRLYTTQDQDVLRIVYKDEATAFNGEKKAEFAGKGE
FT                   LNNRLTSHFFEVLAAAGIPTHFIEQTSEREQLVRRVTIIPLEVVVRNVVAGSLSKRLGI
FT                   EEGTVLETPIVEFYYKDDSLGDPLVTPAHINLLKIATTEELSLLEQEANRVNDVLRPYF
FT                   DEKGITLIDFKLEYGKTPAGEILLADEISPDTCRLWDKETGEHLDKDVFRRNIGSLIDT
FT                   YQTLFNRLGGNGQ"
FT   gene            478128..478376
FT                   /locus_tag="Exig_0451"
FT   CDS_pept        478128..478376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0451"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: bca:BCE_0321 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59933"
FT                   /db_xref="GOA:B1YJ03"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ03"
FT                   /protein_id="ACB59933.1"
FT                   /translation="MKKVTVAVALRESILDPQGVAVKGGLVQLGFAGVEEVRIGKRIEL
FT                   LVADETTDAMIHEMCQKLLVNTVMEDYRFDVEEVTTA"
FT   gene            478373..479056
FT                   /locus_tag="Exig_0452"
FT   CDS_pept        478373..479056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0452"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: bha:BH0628 phosphoribosylformylglycinamidine
FT                   synthase subunit I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59934"
FT                   /db_xref="GOA:B1YJ04"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ04"
FT                   /protein_id="ACB59934.1"
FT                   /translation="MKFAVIVFPGSNCDLDMYHAVKDALGEEVEYVFHTETSLEGYDGV
FT                   LLPGGFSYGDYLRCGAIAQFSPIMEEVKRFAAEGKTVLGVCNGFQILVEAGLLPGVLHR
FT                   NTGLKFMCRTVELKVENNETRFTSDYAAQETITIPIAHGEGNYYCDDATYAMLQTNRQI
FT                   AFTYTDNPNGSRGDIAGITNKAGNVLGMMPHPERAVELLTGGTDGLKLFTSLVKQGAHH
FT                   VKTTV"
FT   gene            479037..481256
FT                   /locus_tag="Exig_0453"
FT   CDS_pept        479037..481256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0453"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: btl:BALH_0288
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59935"
FT                   /db_xref="GOA:B1YJ05"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ05"
FT                   /protein_id="ACB59935.1"
FT                   /translation="MLKQQSEPTMEQIQEQRIYATMGLSDAEYEMVVNLLGRQPNYTEI
FT                   GLFSVMWSEHCSYKTSKPVLRQFPTTGPRVLQGPGEGAGVVDIGDNQAVVFKIESHNHP
FT                   SAVEPYQGAATGVGGIIRDIFSMGARPVALMNSLRFGHLGTPRVNQLFEQVVAGIAGYG
FT                   NCVGIPTIGGEVGFDHSYEGNPLVNAMCIGLINHEDIQKGLAKGAGNSVMYVGAATGRD
FT                   GIHGATFASEDLGEDTEAKRPAVQVGDPFMEKLLIEACLEIVGHPALVGMQDMGAAGLT
FT                   SSSAEMASKAGMGIEMHLDDVPQRETGMTAYEMMLSESQERMLLVVERGREAEIEAIVS
FT                   KWGLHAVHVGEVIDEKVLRLVHHGKIVAEVPVDALAEEAPVYNKPSRVPAYYEEFQAMD
FT                   ETLPVVEDAVETWRALLKQPTIASKRWVYDQYDHMVQTSTVVAPGSDAAVIRVRGTNKA
FT                   LAMTTDCNSRFVYLDPFVGGQIAVAEAARNIVASGATPLAITDCLNFGNPDKPEGFWQL
FT                   QQATAGMAEACRVLETPVIGGNVSLYNESAGKAVHPTPVVGMVGLHEQTEWITTQHVKQ
FT                   AGDAVYLLGETTAEFGGSELQYLQFEKSFGKAPHIDLAVEQERLLALQAAVQAGLVTAI
FT                   HDVAEGGLAVALAEMTFGTTLGLDVIFDGPALHLFSESQSRFVVTVKPEQEAAFVKQTG
FT                   AYKLGYVTDQDALQIKTNDTLIEATRSTLQADWEGAIACYMTSKD"
FT   gene            481232..482641
FT                   /locus_tag="Exig_0454"
FT   CDS_pept        481232..482641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0454"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: gtn:GTNG_0244
FT                   phosphoribosylpyrophosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59936"
FT                   /db_xref="GOA:B1YJ06"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ06"
FT                   /protein_id="ACB59936.1"
FT                   /translation="MLYDIKGLNEECGVFGIFGQPEAAQLAYYGLHSLQHRGQEGAGIV
FT                   ASDGKLLLPHRGQGLVTEVFSQETLDSLSGHHAIGHVRYSTAGGNTLENTQPLHFKSRT
FT                   GDLALAHNGNLVNADSLKHLLEAEGAIFQTTSDTEVVAHLVKRSKLPTLEDRIADSLAR
FT                   LVGAFAFLFLTEDTLYVAVDPHGLRPLSLGKTPDGGIVFSSETCAFDIVGAEFIRDIEP
FT                   GELVTITTSGMSSRQYMEPHERAMCSMEYIYFSRPDSMIDGVNVHTARKALGKKMFEEA
FT                   PVEADVVTGVPDSSISAAIGYAEASGIPYEMGLIKNRYVGRTFIQPSQELRERGVKMKL
FT                   SALRGVVNGKRVIMVDDSIVRGTTSRRIVGLLREAGATEVHVRITAPPITNPCYYGIDT
FT                   SSKDELISARLTPSEICQEIGADSLEFLTVNGMVNAIDRPFDGPLKGQCTACFTGEYPT
FT                   PIGALELEAKL"
FT   gene            482661..483695
FT                   /locus_tag="Exig_0455"
FT   CDS_pept        482661..483695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0455"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: bha:BH0631 phosphoribosylaminoimidazole
FT                   synthetase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59937"
FT                   /db_xref="GOA:B1YJ07"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ07"
FT                   /protein_id="ACB59937.1"
FT                   /translation="MSKQYEAAGVSLTAGYESVSRMKKHVARSMRKEVMTGLGSFGAMF
FT                   DLSQLNLKEPVLVSGTDGVGTKLKLAFALDQHDTIGIDCVAMCVNDIIVQGAEPLYFLD
FT                   YIALGKAIPAKIERIVAGVAEGCVQSGCTLIGGETAEMPGMYADGEYDIAGFAVGAVEK
FT                   QKLITGEHVQPGDVILGLASSGVHSNGFSLVRKIVAESGLRYEDELMMFGSTIGNTLLM
FT                   PTRIYVEAVKAALETEKIQAMVHITGGGFYENVPRVLPEGCGATFDPKKWPTLPVFDWL
FT                   EQAGNVPRHDMYNVFNMGIGYMMIVKPEDVAAVSARLARENETVYTIGTVTSEPGVRIL
FT                   GVDQ"
FT   gene            483692..484267
FT                   /locus_tag="Exig_0456"
FT   CDS_pept        483692..484267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0456"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: bcy:Bcer98_0276 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59938"
FT                   /db_xref="GOA:B1YJ08"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ08"
FT                   /protein_id="ACB59938.1"
FT                   /translation="MKIACFASGSGSNVEALFEAVETGRLQATIELVVCDQKQAKVIER
FT                   AQARGCDIFVFTAKDYPDKPSFEREIVAELERRGVERIILAGYMRLIGDVLLSHYAGRI
FT                   VNIHPSLLPAFPGKDAIGQAFRGGVKITGVTIHIVDEGMDTGPIIAQEAVRITEDMTRE
FT                   TLQQAIQQVEHRLYPQVIEEWMKEEANV"
FT   gene            484264..485784
FT                   /locus_tag="Exig_0457"
FT   CDS_pept        484264..485784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0457"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: bat:BAS0285 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59939"
FT                   /db_xref="GOA:B1YJ09"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ09"
FT                   /protein_id="ACB59939.1"
FT                   /translation="MRALISVSDKTGIVELGQAMHDAGIELISTGGTHQALEAAGLPVI
FT                   GISEVTQFPEMLDGRVKTLHPMVHGGLLGRRDLESHREQMAEQQIKPIDFVVVNLYPFK
FT                   ETVMNEDVSYADAIENIDIGGPSMIRSAAKNHAAVTVVVDPADYQAVIQEIHLGGTTFE
FT                   TRQKLAAKAFRHTAAYDALIADYFLTQTGEKFPDQLTITLEKVQDLRYGENPHQEAAFY
FT                   KTPIYRGASLASAKQLHGKELSYNNIQDANAALEILDEFREAAAVVVKHMNPCGVAVGP
FT                   TIDEAFRRAHAADPVSIFGGIVALNREVDLATAEQLSGIFLEIIIAPSFTEEAFTLLAA
FT                   KKNLRLLELDVKRVQSIRYTAVAGGMLVQDSDDETLDDASARVVTDRKPTAGEWEDLKL
FT                   AWRAVKHVKSNAIVIAKDEVTVGVGAGQMNRVGSANIAITQAGAKAVGAAMGSDAFFPM
FT                   GDTVEAAATAGITAIIQPGGSIRDQESIDACNKHGITMIFTNVRHFKH"
FT   gene            485800..487056
FT                   /locus_tag="Exig_0458"
FT   CDS_pept        485800..487056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0458"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: gka:GK0268 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59940"
FT                   /db_xref="GOA:B1YJ10"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ10"
FT                   /protein_id="ACB59940.1"
FT                   /translation="MKVLVVGKGGREHALVWKLVQDVRIETVYAAPGNVGMTEAVCVPI
FT                   REDAIEELVQFAREEQIDWTIVGPEGPLVLGIVNAFQAAGLKIFGPSREAAAIEGSKQF
FT                   AKALMDRAGIPTADHAVFTSAAEATAYIRRQGAPIVVKADGLAAGKGVTVATTIEQAVQ
FT                   AIDEIFGGDFGQQSSVVIEECLVGEECSLMAFVHEETVIPMVLSQDHKRAFDGDSGPNT
FT                   GGMGAYSPLPQFDEQAVTEEAMQRVLRPLVEQMASEGIPFTGFLYAGLMLTSRGPSVIE
FT                   FNARFGDPETEVILPRLETELLDVIMPLMQGDIPEVAWSDEAVVGVVIAANGYPEQPVT
FT                   GQPVPTDTIGSNLLVFHAGTAAGDDDVILSAGGRVLVCVAKAKDMKQAVASVYSGLDSF
FT                   DRTGFFYRTDIAKKAFRTI"
FT   gene            487277..489016
FT                   /locus_tag="Exig_0459"
FT   CDS_pept        487277..489016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0459"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="PFAM: amidohydrolase; KEGG: bcl:ABC1075 adenine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59941"
FT                   /db_xref="GOA:B1YJ11"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ11"
FT                   /protein_id="ACB59941.1"
FT                   /translation="MKKNCGRSPWTKTEVRTHQAVINGKLAPTLVIENATYLNQGLKTW
FT                   RTANIWISGDRIIYVGPDMPETADEVYDATGKFIVPGYIEPHAHPFQLYNPATLAKFAA
FT                   ERGTTTLVNDNMLLLLEPTEQAFAQVDALADLPTSMYWWARLDAQTELDADSITIDNRR
FT                   IQAWLKHPQVIQAGELTGWPRLSQGDDELLQWMQDAMKLGKPIEGHFPGASAKTLTKMA
FT                   LFGVTSDHEAMTVEEALMRLELGYTTTIRYSSIRPDLPDIFAGLVEAGLQNYEKVLVTT
FT                   DGSTPSFYKAGLMDETIRLMLAAGIAPEEAYRIASYNAARHFNLDHLLGSIAPGRIAHL
FT                   NILEAKDKPTPVDVVARGTWVRKNDIPCYPVEALDRAIDLMPASQVGLELTEQDFSFSM
FT                   PVGLEMVNSVIMKLYQVEHDTSMQVLPAGCNESFLMLVDREGRWRLNTVLKNFATHVGG
FT                   LVSSYSISGDILLIGKSKRDMQIAFDRMKAFGGGVVLVEDGEVVAEVPLTLMGQTSDLP
FT                   LEDLIVQETALREALFARGYQFEDPIYTLLFLASTHLPYVRITPQGIYEVLRKKVLFPA
FT                   ILR"
FT   gene            489084..489398
FT                   /locus_tag="Exig_0460"
FT   CDS_pept        489084..489398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0460"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp
FT                   repressor; KEGG: bsu:BSU06580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59942"
FT                   /db_xref="GOA:B1YJ12"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ12"
FT                   /protein_id="ACB59942.1"
FT                   /translation="MQLDKLRGKELDQLFTAIMKMDSLEDCYTLFEDLATVNEIQALAQ
FT                   RLEVARQLREGNTYHKIEKATGASTATISRVKRCLNYGSGGYDLALARLGLVEEEVADN
FT                   "
FT   gene            489438..490817
FT                   /locus_tag="Exig_0461"
FT   CDS_pept        489438..490817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0461"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: btl:BALH_1184 cation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59943"
FT                   /db_xref="GOA:B1YJ13"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ13"
FT                   /protein_id="ACB59943.1"
FT                   /translation="MDLAYQQKLQHFIRKLTPIQSLVIIYFVAVIIGVILLGLPWSTKG
FT                   NYDWDFTDLVFMAVSCVSVTGLTTVSVSDTFTTFGYFMIMILVQVSGIGLMSLHIAMWV
FT                   ILGKRIGFRERQLVVRDQNQTTMQGVVKYIREVIIIILSIEIIGALILGLYYTKYFPTL
FT                   GEAMLQGLFGSVSATTNAGFDITGESLLPFRGDLFVVFMQILLLTLGAIGFPVLVEVRR
FT                   YISYRATRQATRQPYHFSLFTKLTASTFFILVLFGTVSLLLFEWNQSFKGLPVNEKMVD
FT                   ALFQSVTTRNGGLTTVDITSFSQASIFVLSILMFIGASPSSVGGGIRTTTFAVAVLSVI
FT                   AFIRGEYGIKIFGREIGQSDIWKAFVVIVVSTGVTMIGLIVLLIFEDAPFLVLFFEACS
FT                   AFGTTGLSLGITNELSDVGKWTLSVLMFIGRIGVISFVLLLKANQPKRNYNYPKESVII
FT                   G"
FT   gene            490830..491054
FT                   /locus_tag="Exig_0462"
FT   CDS_pept        490830..491054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59944"
FT                   /db_xref="GOA:B1YJ14"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ14"
FT                   /protein_id="ACB59944.1"
FT                   /translation="MNRTFWINFGYIFMVPALPFLALVNGRALCSPDSPLLDIPVLGFF
FT                   LAEPWAFAVVYAFLAFGLATLLTKRRTRT"
FT   gene            491139..491822
FT                   /locus_tag="Exig_0463"
FT   CDS_pept        491139..491822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0463"
FT                   /product="geranylgeranylglyceryl phosphate synthase family
FT                   protein"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; PFAM: PcrB family protein; KEGG: bha:BH0647
FT                   geranylgeranylglyceryl phosphate synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59945"
FT                   /db_xref="GOA:B1YJ15"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ15"
FT                   /protein_id="ACB59945.1"
FT                   /translation="MLLPYNEWRHVFKLDPAKEIEEAALQAIATSGTDAIIVGGTDDIT
FT                   LDATLDLLMRLRRYPVAVALEVSELEAATMGFDAYLTPSVLNSGTLEHVIDKQVEALEE
FT                   VGHMLAHQDLVGEGYIVLNADAKVARVTQAKLLNDDQVVAYAQLADSVFRMPIIYLEYS
FT                   GMYGDPSLVASVKRVLKQGRLFYGGGIDSIERAQEMLTHADTIVVGNIIYDNLEAALAT
FT                   VAATR"
FT   gene            491867..494092
FT                   /locus_tag="Exig_0464"
FT   CDS_pept        491867..494092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0464"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM:
FT                   UvrD/REP helicase; KEGG: bha:BH0648 ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59946"
FT                   /db_xref="GOA:B1YJ16"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ16"
FT                   /protein_id="ACB59946.1"
FT                   /translation="MFNLSEQLVSGLNPEQAKAVKHTDGPLLIMAGAGSGKTRVLTHRV
FT                   AYLMAAKQVAPWNILAITFTNKAAREMRDRISRLVGGVANDIWVSTFHSMCVRMLRRDI
FT                   EKIGYNRNFTILDSSDQQSALKLVLKEQNLDPKKWDPRSMLSIISSQKNELRSAEFYAS
FT                   IVTNPYEKTVAEIYKGYEAVLRRNNALDFDDLIGKTTELFKQNPDVLSFYQRKFQYIHV
FT                   DEYQDTNKAQYDLVNLLAAAHQNLCVVGDSDQSIYRWRGADIANILSFEEDYPTAKVIL
FT                   LEQNYRSSKRILDAANHVIQNNSTRKDKKLWTENAEGEKLIVHTAENEREEAFYIVQEI
FT                   RNALRYGMKLNDVAILYRTNAQSRAIEETLLKSNVPYKMIGGTKFYDRKEIKDVLAYLR
FT                   LISNPNEDLSFARIVNEPKRGIGATTIDKLRDFADLQGVSLMEAIRDIELSSIAPKTAA
FT                   KLTDFRTMILGLQQMQEFISLSELVEEVLEKTGYRQVLKEDKTLEAQSRLENINEFITV
FT                   AQNFEKETEKADPEDQTIIAFLTDLTLVADVDSLDESDLGEQVTLMTLHSAKGLEFPIV
FT                   FLIGMEEGLFPHSRSLQDEDEMEEERRLAYVGITRAEKRLYLSHARMRSLYGRTNANLE
FT                   SRFLAELPEEVLERTGKKPKPLPWEDRPVPQGKAVIGRSVTKPTAMKTSGAESLGWNVG
FT                   DKAEHGKWGRGTVVQTRGAGDSLEIDIAFPEVGVKRLLAKFAPIKKV"
FT   gene            494107..496101
FT                   /locus_tag="Exig_0465"
FT   CDS_pept        494107..496101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0465"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: bay:RBAM_007020 LigA; TIGRFAM: DNA ligase,
FT                   NAD-dependent; PFAM: helix-hairpin-helix motif; BRCT domain
FT                   protein; zinc-finger NAD-dependent DNA ligase C4-type;
FT                   NAD-dependent DNA ligase OB-fold; NAD-dependent DNA ligase
FT                   adenylation; SMART: Helix-hairpin-helix DNA-binding class
FT                   1; NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59947"
FT                   /db_xref="GOA:B1YJ17"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ17"
FT                   /protein_id="ACB59947.1"
FT                   /translation="MIEQARIEELRQKLNQYSYEYYVQDQPTVPDSTYDQLLRELTELE
FT                   TAHPELITPDSPTQRVGAAALDAFEKVTHDLPMLSLGNVFDETEIREWVARIERSLGRS
FT                   TTYVAELKFDGLAISLKYEDGQLVRGATRGDGTVGENITQNLRTIKALPLRLRRNETVE
FT                   VRGEAYMPKQSFERLNADRAAREEALFANPRNAAAGSLRQLDSSITASRNLSLFVYGVG
FT                   VNTLSARSHSEAMLQLAELGLPTNKEMQTCETVEEILAYIAHWTMERSNLPYEIDGIVL
FT                   KVDRYDDQEELGFTAKSPRFATAYKFAAEEVMTTVEEVDFSVGRTGKVTPRARFAPVVV
FT                   AGSTVSYATLHNADFITEKDIRLHDQVIIKKAGDVIPAVVSVVVSERTGNEQPIEFPAH
FT                   CPACESELVRLEGEADIRCVSPECPAQLVEGIIHFVSRQAMNIDGLGEKVVRQLYEHEA
FT                   IRTLADLYRLDRDELLTYERMGETSVDNLLTAIEASKQNSLERLMFGLGIRLVGQKAAY
FT                   LLAERFDSLDGIAQAEYEDILAIDGIGSKIADSVTKYFEHPEAQALIKDLAELGLNQQF
FT                   LGQRVDQSNAPLAGKTIVLTGTLESLKRSEAGKRLELLGADVTGSVSKKTDILVAGEKA
FT                   GSKLTKAESLGIEIWNETQLLEELAKYEG"
FT   gene            complement(496191..496766)
FT                   /locus_tag="Exig_0466"
FT   CDS_pept        complement(496191..496766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0466"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: cac:CAC0204 sortase (surface protein
FT                   transpeptidase), YhcS B.subtilis ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59948"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042000"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ18"
FT                   /protein_id="ACB59948.1"
FT                   /translation="MKRQKFLGLLLLIAGILLILWPLYTNHQKQAAAEELKQQWTQNLK
FT                   AVDAKETKQPVATNGSGLLTIPSLNFEQVILEGASTAVLDQSIGHLKATGAPGKGNYAL
FT                   AGHRSFTKGLHFNRLPELKTGAHVIVTTKSHRYTYQMKTSQLVKPTDLSVLNQDVKQAT
FT                   LTLITCDPPETATNRLIKQGVLIKTESL"
FT   sig_peptide     complement(496689..496766)
FT                   /locus_tag="Exig_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.554 at
FT                   residue 26"
FT   gene            496899..498077
FT                   /locus_tag="Exig_0467"
FT   CDS_pept        496899..498077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0467"
FT                   /product="CamS sex pheromone cAM373 family protein"
FT                   /note="PFAM: CamS sex pheromone cAM373 family protein;
FT                   KEGG: bay:RBAM_007030 YerH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59949"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ19"
FT                   /protein_id="ACB59949.1"
FT                   /translation="MKSKKIAALTLTSTLFLGACSFDLSQKSDTKEVITESEQGKEVQA
FT                   VVSPAIDTTDSYYRTVLPFRPSVARGMTQKRVSSRLELDEIETGLMRHSTQFFAPDKYY
FT                   YQEGQLLEADQIAQWLLRKGKAVDGVSDPNGLNPAYTTGKSYKEKNQKSPLILSHILEQ
FT                   DYMLEEDKKLELGGTSVALVLNSEYVFQDENYGPTYTVKLDEKKVIAEGKRMANELVKK
FT                   MRKTDGIKTTPIHVALYLQESEGSPVSGHYVSSAFIGRGNQISSNDWKNYDEKYYYYPS
FT                   GAATNDVRDDAAKFDLFKDRLEDYFPNYTGMMGEGFYQEGELKKLEIKIPVQFYGKAEL
FT                   VAFIQYVTYLLENRWEYNRNVPTTITVTNLNGDTEAMLFIEPDTKKPIVKIR"
FT   sig_peptide     496899..496964
FT                   /locus_tag="Exig_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.493 at
FT                   residue 22"
FT   gene            498296..499150
FT                   /locus_tag="Exig_0468"
FT   CDS_pept        498296..499150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0468"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bld:BLi00190 YbbH"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59950"
FT                   /db_xref="GOA:B1YJ20"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ20"
FT                   /protein_id="ACB59950.1"
FT                   /translation="MKGGIFSQISAVHEELPSSSRKVADFVLAHMNEIAGMTIHHLAEE
FT                   SGTSAAAVVRFCRALGLKGYPELRMRISADTARTDLKGYHDIEKNERPADLVEKTVSNS
FT                   IQALQDTAKQLSEDRIAEAADVLDQARAIYFYGIGASNVVALDAAQKWTRVGKLTIQES
FT                   DQHLVATILANASQDDVFFAISYSGETEEVVELIRLAKIRGLKVISLTRFGDNRVSQLA
FT                   DIALWTSRAPEAPLRSAALSSRLAQLFAIDVLFLSYAAVHYDDTIERLQYTRESVKMLH
FT                   SKK"
FT   gene            499163..500338
FT                   /locus_tag="Exig_0469"
FT   CDS_pept        499163..500338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0469"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: bha:BH1613 N-acyl-L-amino acid amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59951"
FT                   /db_xref="GOA:B1YJ21"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ21"
FT                   /protein_id="ACB59951.1"
FT                   /translation="MKQTVEEMVEQLFPVMVERRRYLHRHPELSFHEVDTPQFIADRLT
FT                   ELGIEIRTGVGGRGVVGTIRGGKPGKTVALRADFDALPIQDEKTVDYRSTVPGVMHACG
FT                   HDGHTATLLAVAEILVRQKEQLAGNVVLIHQHAEEVVPGGARDMVADGCLDGVDVIFGT
FT                   HLWSTTKLGTIGYRIGPVMAAADKFELTLFGRGGHGAKPHETIDAVVLGATVVKELQSI
FT                   VSRRLDPLQQAVLTIGTLHAGNTFNVIADSAELTGTIRTFDPEVAEQIVHEMERTIKGV
FT                   CDAAGATYSFTYERGYPAVVNHPQETNLLRTVASDIMGADHVFEIAPTMGGEDFAYYLQ
FT                   QVPGTFFFTGAGDETFYPHHHPKFDFEEQAMQHAARILIEVTLRYLEESSN"
FT   gene            complement(500403..500594)
FT                   /locus_tag="Exig_0470"
FT   CDS_pept        complement(500403..500594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59952"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ22"
FT                   /protein_id="ACB59952.1"
FT                   /translation="MDGKKRADVKIGQHVSIVLKQDQRTGKRTEGIVKDLLTKSPNHPH
FT                   GIKVRLEDGQVGRVQEIL"
FT   gene            500787..501653
FT                   /locus_tag="Exig_0471"
FT   CDS_pept        500787..501653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0471"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: ppg:PputGB1_4905
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59953"
FT                   /db_xref="GOA:B1YJ23"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ23"
FT                   /protein_id="ACB59953.1"
FT                   /translation="MAKDYYRTLGVEKTASNQEIKRAYRKLAKQYHPDVNQEASADQRF
FT                   KDIQEAFDVLGDEEKRAQYDQYGSNYERMAGAGYGQSADYDDLFRQFNGRQSRTAGSAG
FT                   QSFGFEDMFGSFFSQEPEETDEELELTVPLSHLSQNDKVTIRLATGAIQMSLPKDLYDG
FT                   KKVRLRGKSSKRNRKGIAGDVYVTIHLKDDDQFRRQETDVISTVRVYPTVFVLGGEVVA
FT                   DTLEGKRVKLKIKPGTKPGARLRIPNRGLSNREGHRGALLVQLEVKLPEMEPSFYEEWE
FT                   NRLSVKE"
FT   gene            501661..504234
FT                   /locus_tag="Exig_0472"
FT   CDS_pept        501661..504234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0472"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: bce:BC1168 ClpB protein; TIGRFAM:
FT                   ATP-dependent chaperone ClpB; PFAM: AAA ATPase central
FT                   domain protein; Clp domain protein; ATPase associated with
FT                   various cellular activities AAA_5; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59954"
FT                   /db_xref="GOA:B1YJ24"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ24"
FT                   /protein_id="ACB59954.1"
FT                   /translation="MDFEKLTDRAHEAIVSAQAIAKQRRHSEITEWHLLLALLSQEEGI
FT                   ARIVFEKLDQRIDQLETGVNEALGRLPALGQSSTPRISNSLLQVLTEAETEARLMQDDY
FT                   VSVEHLLLGLVKQSSPATQYLRNEGVTEQVLREAIIEMRGNRKVTTKNPEATFDVLKKY
FT                   GRDLVADFRSGKTDPVIGRDDEIRRVIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRI
FT                   VRGDVPESLKNKQLFSLDMSTLVAGAKYRGEFEERLQAVLNEVKEAEGQILLFIDELHT
FT                   IVGAGKTEGAMDAGNMLKPMLARGELHCIGATTLDEYRKYIEKDPALERRFQQVLVAEP
FT                   DVEDTISILRGLKERFEIHHGVRIHDNALVAAAILSDRYITDRFMPDKAIDLVDEACAM
FT                   IRTDMESMPAELDSLVRRVMQLEIEEAALKKETDEASRKRLETLQQELSSVREDESALR
FT                   TRWEREKDSSQNVQQLRADLEKAKLALQEAEGRYDLNTASEIKYGQIPALENQLKVAEE
FT                   SAEHVAHELVREAVTDEEISDIVSKWTGIPVSRLAQGEREKLLYLEDTLHERVFGQDEA
FT                   VRLVSDAVIRARAGIKDPNRPIGSFLFLGPTGVGKTELAKALAAAMFDSEEHIVRIDMS
FT                   EYMEKHNVSRLVGAPPGYVGYEEGGQLTEAVRRSPYSVLLFDEIEKAHGDVFNILLQVL
FT                   DDGRLTDAQGRVVDFKNTIVIMTSNIGSHILLEAAKDGDIDAAEEEAVRQELKKYFRPE
FT                   FLNRIDDTILFHPLHRAEIERIIDKAVSKMAERLSGREITIDVTEAAKTLIFNEAFEPQ
FT                   YGARPINRYIQRTIETKLARALISGSIQDGSHVAIDTDGTELVIR"
FT   gene            504382..505314
FT                   /locus_tag="Exig_0473"
FT   CDS_pept        504382..505314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0473"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: bwe:BcerKBAB4_0416
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59955"
FT                   /db_xref="GOA:B1YJ25"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ25"
FT                   /protein_id="ACB59955.1"
FT                   /translation="MNVTQQQLEELIAECRPYTVLGQVASYIPELAKSEPTQLGIAVCN
FT                   ADGSFVSAGDAETMFTLQSVSKIITLAFVLETFGEDYVFSKVGMEPTGDAFNSIAKLEE
FT                   TIPTKPLNPMINAGALAVTSMLPGEDAADKLNRLRQFIADLLDIELDMVKYDAEVAKSE
FT                   FETTDLNRALLYFMRYHGVIEGNVEEIIDVYTKQCAILTNCKGLAMMGKILSQSGKTPS
FT                   GNQVISRRNARIIRAIMTTCGMYDASGEFSVQVGLPGKSGVSGAIVACGRSDFDMADLG
FT                   IGIFGPALDLKGNSIAGTKMLELLVQRHP"
FT   gene            complement(505311..506093)
FT                   /locus_tag="Exig_0474"
FT   CDS_pept        complement(505311..506093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59956"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ26"
FT                   /protein_id="ACB59956.1"
FT                   /translation="MNHRDAENLTFELLETWSTFNHYAEEAQTFKNPEDVHQARIRLRK
FT                   LITFAKLVDQTEEPIYLIWKRLMAAFGQVRDLDVQLSQQGVTSPIEQLFAEHLALQLQG
FT                   KRATLLETMHLLISDELDRSVRRFLAGRLTKQLKRIDEKDLLQTAEKRFDKKKLHYEKV
FT                   QHKEGKKRIQMMHELRLATKFYRYTVEYLRPYTDFPKSSVDRLKRIQTQLGDINDTYNR
FT                   LERWRLFSVPDDQLAQQQKEITRLEKKLSKLLDQLSFD"
FT   gene            506190..507545
FT                   /locus_tag="Exig_0475"
FT   CDS_pept        506190..507545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0475"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: bha:BH0860
FT                   multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59957"
FT                   /db_xref="GOA:B1YJ27"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ27"
FT                   /protein_id="ACB59957.1"
FT                   /translation="MLETTTLSGKIQQFMKIFFPILVTQVAFYLISFFDTVMAGRYGSA
FT                   DLAGVGVGASLWAPVYTGLTGILLAVAPLVSQAMGARKEREVKRIVIQALYVSVVIIVL
FT                   TVLLGLVLVNPILNQMELSDQARHVARIYLVMLGFGIIPMFVFFVLRTLIDSLGKSNIT
FT                   MTLLLFSLPINVAFNYLFIFGKFGFPELGGIGAGVATAITYWILCIAVIGVVLKGELFQ
FT                   RLGILRRFYKPDVTRIKELVLLGAPIGLAIFSEVSIFSAVTLLLGAYGDVVIGAYQAAI
FT                   NFASFVYMIPLSAASALTITVGFEMGAKRVKDAVQYVWIGLLLCLVVSLFSGGLLYVQN
FT                   ERIAALYSNDPAVIKMAAHFMILAIFFQLSDAVAAPTQGALRGFKDVNVTFILTITAYW
FT                   VIGLPLGFYFERFTELGPDGYWWGLIIGLAVGASLLLLRLMHLVRKSKEVVK"
FT   gene            507542..510100
FT                   /locus_tag="Exig_0476"
FT   CDS_pept        507542..510100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0476"
FT                   /product="protein of unknown function DUF470"
FT                   /note="PFAM: protein of unknown function DUF470; protein of
FT                   unknown function DUF471; protein of unknown function
FT                   DUF472; KEGG: bwe:BcerKBAB4_1388 protein of unknown
FT                   function DUF470"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59958"
FT                   /db_xref="GOA:B1YJ28"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ28"
FT                   /protein_id="ACB59958.1"
FT                   /translation="MRFNKQRVLTVAKIILPIILIAFIFYQGQNELRSLSLKESIRAIQ
FT                   QIPSWKFILLIVSGLAAVATMFFYDFFLLRSLQVKVPIGLIFRASWIANSFNGIIGFGG
FT                   LAGMGVRTALYRPFVEGTRLLKAIGWMAPTLISGLSILSALSLLNVFPAFEVLDLKKWL
FT                   WPVIIGVAFFFPVYLLFTFRRGSSSIRPSSIALYSLVSLAEWFSAGVVVYFILAALGTD
FT                   VSFSKVIGVFIIAATAGLISMVPGGFGSFDLVFLIGMQRAGVEEGIVLTGLLIYRLVYY
FT                   LIPFVIGVIFSAREFSGPVVKMIEDKPIVGPSVEVGGVIWRLQLRFLSKVRHFTLALIT
FT                   LLAGIAIWGLAILPPNSTQYEYLEARLPHELLLLANSFFLMAGLLYVLLAPSLYRRTKR
FT                   SLYMIYGVSAFALIGMALRGFNLISLSVVLIVLVLVTMSRSAFHRERTLITTTRLIRAA
FT                   FAGFLYLGGFIFFGYAFYTLGSADGTKVYPAHEIFMFAASAAIFALVYTLVFIRLFNTF
FT                   NQPVLGEKLDMQKVKDVLTEEGGNYLSHLAFLGDKRFFFSESGRSFIQFSQTGNRIMML
FT                   GDPSGNPEEHSQLIACFLRRVEDLGYIPNIYQIQAQNMSLYHDFGFNFFKLGEEAIVDM
FT                   TTFTVSGKKRAGLRSIKNRFEREGMTFEVVSPPFSEALLDQLRDVSDEWLGGKSEKGFS
FT                   LGYFNESYLNQAPIGIMRDANQQMLGFMTFMPAYQEGVLSIDLMRFRPDGPNGIMDAMF
FT                   IRLFDYATEQGYHTFNMGMAPLSSVGEDETSFWQERVAADVFNNIRYMYSFTGLRRYKE
FT                   KYDPKWEGRYLAYRKRQSLTIAILKATRLISKKKDRILLP"
FT   gene            510249..511394
FT                   /locus_tag="Exig_0477"
FT   CDS_pept        510249..511394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0477"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: btl:BALH_3671 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59959"
FT                   /db_xref="GOA:B1YJ29"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ29"
FT                   /protein_id="ACB59959.1"
FT                   /translation="MPTMIHAEIYTGQTVIHDGFIRFEETIQEIGQMSAYTERDETVID
FT                   LAGKRLIPGMIDVHIHGGYDVDTMDASAEALYRLSEAMLAEGVTSFFATTITQDWHQIT
FT                   RALEVARDVIDSRETTIEGIHLEGPFINPDYAGAQPLEYIVEPDADQFLKWQQASGNQI
FT                   KLVTYAPEQPGARDFEAAVRKTGAIPSAGHTDATFDQNHLGNVTHGTHLYNQMRPLHHR
FT                   EPGTVGYCLLERSVFAEIIPDGIHSSKEMVEFAYRMKGPDRLTVITDAMRAKGLSDGEY
FT                   ELGGQTVHVKDGAARLASGNLAGSVLTMDQALRNIIRFTGCSLEQAVQMTSINQAEEFG
FT                   LTHKGRLEQGKDADFVVLTADLEVEQTVHRGKVHRFTNGKG"
FT   gene            511401..512159
FT                   /locus_tag="Exig_0478"
FT   CDS_pept        511401..512159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0478"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /note="TIGRFAM: glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   bce:BC4054 glucosamine-6-phosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59960"
FT                   /db_xref="GOA:B1YJ30"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ30"
FT                   /protein_id="ACB59960.1"
FT                   /translation="MKWMIVEKAEELANVSYQLLKQEIVRHPEGLTIGLATGSSPLGVY
FT                   EEWRKDRVDCRHVTTVNLDEYVGLSPDHPHSYHTFMQEHLFDAVDFKESYVPIGSTADP
FT                   REESDRYEALVRQLGIDIQLLGIGSNGHIAFNEPGTPFDAKTHVTKLTESTRQANQRFF
FT                   DRLEDVPTEAITMGIGTIMEAKKILLVASSERKAEAIRDMMEGPATTDCPATILQRHAD
FT                   VMVVLDEEAASLLSDEAKRTGRAAYTNFMK"
FT   gene            512372..513487
FT                   /locus_tag="Exig_0479"
FT   CDS_pept        512372..513487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0479"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   lwe:lwe2466 transcriptional regulator; putative"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59961"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ31"
FT                   /protein_id="ACB59961.1"
FT                   /translation="MQTRSARKRQPSAGKMFIKVIAALLLLLTVIGSGYAGAVFIKTQE
FT                   TLARTQINIPGSKVSSKYDDVPSESFLILGTDETKASKDRHEPARSDVMIVGVLNKKTE
FT                   QLVLTSIPRDSLVNIDYSKYDVPYGKTGVEQDKITHAHYFGSMDKSSSYNGIKLARETT
FT                   ENLLGIEINHVVKVNFQGFVQLIDALDGVDIDVRYAFKEQDSARKAGTITVPKGMQHLS
FT                   GEQALAYVRNRHDDPLGDIGRGQKQMQVIQAVAKEAASFRSLGAYRDILDAVGDNVETN
FT                   LGPNDYLRLADFTTALRNTTEYQLAGEGYIGISGKWEYHLDPNQLDRVKANLAKAMQGQ
FT                   EVSLMKEETGTPGATDPTTTDDSTTVEQPVQ"
FT   sig_peptide     512372..512488
FT                   /locus_tag="Exig_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.632 at
FT                   residue 39"
FT   gene            complement(513603..514337)
FT                   /locus_tag="Exig_0480"
FT   CDS_pept        complement(513603..514337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0480"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="TIGRFAM: phosphonates metabolism transcriptional
FT                   regulator PhnF; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   gka:GK2275 transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59962"
FT                   /db_xref="GOA:B1YJ32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ32"
FT                   /protein_id="ACB59962.1"
FT                   /translation="MIQHINKNSPLPIYYQIEAALKQQIEEGLLQPGDLIPSEREFAEA
FT                   HQISRMTVRQAISNLVNAGYLIRQKGRGTFVANKKIVMQLSGLTSFSEEMEHLGLEPAS
FT                   ELLSYQTIAAEMTIANKLGIREGAKIYELKRLRIANEQPLALETVYIPEQLLPGLNQDV
FT                   AITSLYAFAEASGLNLGRASQTFESRLATKEEAQHLGLSVSSPVLSVEQLTFLATDQPF
FT                   EYVISAYRGDRYTFTVEMERQR"
FT   gene            514466..515617
FT                   /locus_tag="Exig_0481"
FT   CDS_pept        514466..515617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0481"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD; KEGG:
FT                   hau:Haur_4632 threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59963"
FT                   /db_xref="GOA:B1YJ33"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ33"
FT                   /protein_id="ACB59963.1"
FT                   /translation="MRSEQIYPDVRTFESIVTGTKEEQGYWVRLEQSYFYPESGGQPAD
FT                   RGTLNGVSVLDVQLQEGDVWHLLDSPLLENEVQGEVDDVIRTDHAAQHTAQHVISAILQ
FT                   DEFQIKTVSFRTGTEESTLDLDLGDWDETLQSRLEERLRTVIQANLLITATEYTEEEAL
FT                   QLPLRKTPQVTEKIRVVQIGELDYSACGGTHLASTSELELILFTGLEKVRGNIRLAYVA
FT                   KDRAFRLLTTERRVLTETARAVSAKKNQVHLVVEDLKQEQVRLNRQIGQAEDLHVKTVL
FT                   KQLLATDEPVLTVRHDQEDVRFSEKLLKALAETGRTGFVWNENAKKLFMCSAGSIHLGK
FT                   FAKTHLKQFNGRGGGSENNAQAVFQTYEEAQAYAEALKEELHT"
FT   gene            515614..516042
FT                   /locus_tag="Exig_0482"
FT   CDS_pept        515614..516042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0482"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sth:STH1973 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59964"
FT                   /db_xref="GOA:B1YJ34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ34"
FT                   /protein_id="ACB59964.1"
FT                   /translation="MTVIQVKTTEQKQAVRMIRERVFVEEQGVPSHLEYDTHDETAIHL
FT                   LVLDEMNRPVATGRTRPYDEQRMKVERVATLAATRGKGYGGELMQAMERIARREGRTIL
FT                   TLGAQVKAIPFYQGLGYAIVSDEFDDAGIPHRTMEKKI"
FT   gene            516164..517369
FT                   /locus_tag="Exig_0483"
FT   CDS_pept        516164..517369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0483"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   btl:BALH_4210 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59965"
FT                   /db_xref="GOA:B1YJ35"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ35"
FT                   /protein_id="ACB59965.1"
FT                   /translation="MTKQKLILAYSGGLDTSVAIKWLSKDYDVVALCMDVGEGKDLSVI
FT                   KEKALLVGAIESIVLDVKDEFANDFVLPALQYGAHYEGAYPLISALSRPLIAEKLVEVA
FT                   HAQGATAVAHGCTGKGNDQVRFEVSVAALDPSLEVIAPVREWKWSREEEIAYAKENNVP
FT                   IPINLNSPYSIDMNLWGRSNECGVLENPWTEPPQDAYALTVAPEDAPDQAEEVIIGFEA
FT                   GVPVSINGTAYPLAKLITELNIIAGAHGVGRIDHVENRLVGIKSREVYECPGATVLLKA
FT                   HAALETITLTKDVAHFKPILSKQYAETIYNGLFHAPLTKGLKAFLTATQQDVTGEVRVK
FT                   LYKGNATVTGRQSAVSLYDEKLATYTKEDAFDHEAAKGFIKLHGLAISTHASVHRQEGV
FT                   KK"
FT   gene            517366..518739
FT                   /locus_tag="Exig_0484"
FT   CDS_pept        517366..518739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0484"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: lin:lin2196 similar to argininosuccinate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59966"
FT                   /db_xref="GOA:B1YJ36"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ36"
FT                   /protein_id="ACB59966.1"
FT                   /translation="MTKLWGGRFTESASAQAEAFGASISFDQKLAAVDLQGSLAHAQML
FT                   YEQGILEKTEWEQIEAGLKQLQTTLEQHVYTTVDEDIHMNLERLLTEQIGPVAGKLHTA
FT                   RSRNDQVATDLHLWMEQHVLELLSSLRNLQSVITEQAEQHVETVMPGYTHLQRAQPISL
FT                   AHHLLAYFWMFERDADRLTDNLKRIRMSPLGAGALAGTTFPIDRFKSAELLGFEQVYPN
FT                   SLDAVSDRDFVIEYLGIASTVMMHLSRFCEEIIIWASQEFSFIELSDAFSTGSSMMPQK
FT                   KNPDFAELIRGKTGRVYGNLMGFLTTMKALPLAYNKDMQEDKEGVFDTADTVLQSVQIF
FT                   TGMIESATFKTEALKKATMQDFSNATELADYLVTKGIPFREAHEIVGKAVLHCVQSGCF
FT                   LKDLTLSTYQTFHPVIAEDVYPLLDPVQAVARRGSYGGTGFTAVRDQLALAKKQLEKL"
FT   misc_binding    518807..518985
FT                   /bound_moiety="lysine"
FT                   /note="Lysine riboswitch as predicted by Rfam
FT                   (RF00168),score 100.64"
FT   gene            519099..520298
FT                   /locus_tag="Exig_0485"
FT   CDS_pept        519099..520298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0485"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: sha:SH1518 aspartokinase II; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59967"
FT                   /db_xref="GOA:B1YJ37"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ37"
FT                   /protein_id="ACB59967.1"
FT                   /translation="MTTVLKFGGSSVATVEQIQSIANYLKNRTEQGEKLVVVVSAMGKM
FT                   TDSLIAQAQAITDRPERRELDRLLAIGEEQTISLLSIALNSLGIKALSQTGAQAGISTM
FT                   GLHTKSKIKQIDGELLRKKLETYDVIIVAGFQGVNELGDVTTLGRGGSDTTAVALAAVL
FT                   DKRCEIYTDVDGVYTADPRIHATAQPIPHISYDEMMEMSALGSKVMEMRSVELGKKYGV
FT                   HIFVGKTLESERGTWIMEATETMEQKAVTSVSVTKNVLTVSIKHVPQTNSAVADIFELL
FT                   SGRHVNIDMISQTTFDSDIFLSFSCPLDEEEFLEEALQDIINRFPTVKVDRHNQHAKLS
FT                   VVGIGMRDATGVASKLFATFRAENITFYQVTTSEISISYTIAQADIERTVAAIAKAFDL
FT                   "
FT   gene            520311..521303
FT                   /locus_tag="Exig_0486"
FT   CDS_pept        520311..521303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0486"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: sha:SH1517
FT                   aspartate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59968"
FT                   /db_xref="GOA:B1YJ38"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ38"
FT                   /protein_id="ACB59968.1"
FT                   /translation="MYHVAVIGATGAVGQKMLQVLAEHDFPVRQISAYASARSAGKIVQ
FT                   FKGQDVTIQALSENITKDGIGVALFAAGGTISEQYAPLLAAAGTLVVDNSSAFRMQADI
FT                   PLVVPEVNSQAIGPNDRLIANPNCSTIQSVVALAPLQPFGLKRVNYTTYQAVSGSGQKG
FT                   IEDLARGSRGEEPVNYPHPIHDNILPHIDVFLPDGYTKEEQKMIDETRKIFRLPELPVS
FT                   ATCVRVPVTNSHSVAINVTFEQETSVEAIRAALAEAPGVVLVDDVSHNQYPMPLDASGT
FT                   DDVYVGRIRQDQSLANTFHIWCVADNIRKGAASNAVQVARQALESSIHS"
FT   gene            521324..522205
FT                   /locus_tag="Exig_0487"
FT   CDS_pept        521324..522205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0487"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="KEGG: aoe:Clos_1163 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59969"
FT                   /db_xref="GOA:B1YJ39"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ39"
FT                   /protein_id="ACB59969.1"
FT                   /translation="MFKGAGTALATPFTSTGELDLAVFEQLIEQQLAANIQALVVGGTT
FT                   GEGSTLTNEEFETLLETAIRVTAGRVPVIAGTGTNNTAQTIEKTQTAARLGADAAMLVT
FT                   PYYNKTSQAGLVAHFTAVADAVDLPIMLYNVPSRTGVAISVETAVTLAKHPNIQAFKEA
FT                   SGDVSFMGELMTALPDGFAVFCGNDDQILPYMAWGAQGVISVLSNPYPAETQALAEALL
FT                   ANDYTTARRIQSDLMPVISALFSDVNPIPVKAALEEIGLAVGAPRLPLVRQSEAGHAHL
FT                   LETMRSYKGVVG"
FT   gene            522202..522948
FT                   /locus_tag="Exig_0488"
FT   CDS_pept        522202..522948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0488"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   tte:TTE0831 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59970"
FT                   /db_xref="GOA:B1YJ40"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ40"
FT                   /protein_id="ACB59970.1"
FT                   /translation="MRLAIHGYGATGHYVHELAPDAVVAVIDKTKTAEQVPSYGTLAEM
FT                   TESVDAIIDFSHPSLLPDLLAYGIKTKTPLVIATTGFSEAELQTIRDASTQIPIFQSYN
FT                   MSFGIAMMQQLLKTLVPLAGAFDIELLEKHHNQKVDAPSGTAELLLRTIQDLRDVQPVY
FT                   ERESTREKREPNEIGMHSMRGGTIFGEHEVLFAGVDELIEIKHTALSKKVFASGAIKAA
FT                   EALIQKSAGLYTLETLYTQEDSHVIN"
FT   gene            522935..523642
FT                   /locus_tag="Exig_0489"
FT   CDS_pept        522935..523642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0489"
FT                   /product="Tetrahydrodipicolinate succinyltransferase domain
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Tetrahydrodipicolinate succinyltransferase domain
FT                   protein; KEGG: cpf:CPF_2165 putative
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59971"
FT                   /db_xref="GOA:B1YJ41"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJ41"
FT                   /protein_id="ACB59971.1"
FT                   /translation="MLLTDAYEIAKFIKDAKKQTPVKLYVNGDLAGLTIEGATAFGTDQ
FT                   SKIFFADAGLASTFLEEYADRITEVHVEYDRRNSAVPMLDTRHLNARIEPGSWIRDHVV
FT                   IGDNAVIMMGAIINIGASIGDGTMIDMNAVVGARGTIGKNVHVGAGAVVAGVLEPPSKT
FT                   PVIIEDGVLIGANAVILEGVRVGKDAVVAAGSVVTEDVPAGSVVAGTPARVIKQKDEKT
FT                   AEKTQLVDDLRSL"
FT   gene            523668..524600
FT                   /locus_tag="Exig_0490"
FT   CDS_pept        523668..524600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0490"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: har:HEAR2611
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59972"
FT                   /db_xref="GOA:B1YJ42"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ42"
FT                   /protein_id="ACB59972.1"
FT                   /translation="MAVDTQYGEAIWLDGVFHDPKEANTSVMSHAIHYGSGFFEGIRAY
FT                   ATPDGPAIFQLTEHIERLFRSCAFYHVTIPYTVEELVQATIDLVAKNGFESCYIRPFVF
FT                   LGTPWQALMAKDTTVHVGISCWELGEYFDKGAGIRAKVASYRRVSSTMMPMQAKAAANY
FT                   MNSQLLKGEAQRDGFDEAIALDMNGNVSEASVANLFMLKNGTIYTPSLDCSVLDGITRQ
FT                   VIMRLAQDQGYPVVERHIGRDELYVADEIFLTGTAAEITSVGEIDHIVINGGTRTVADE
FT                   LLDLYRQTVSGQLPQYADWLTHVTPAVAE"
FT   gene            524597..525655
FT                   /locus_tag="Exig_0491"
FT   CDS_pept        524597..525655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0491"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: sha:SH1512 alanine racemase 2; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59973"
FT                   /db_xref="GOA:B1YJ43"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ43"
FT                   /protein_id="ACB59973.1"
FT                   /translation="MSSRTVVTIDREAVRHNVASVFARSNKQIFAVVKNNAYNLGMIEM
FT                   VATLMEAGVRHFAVAEVYEAIEIKTNFPDSYVLAMNPASDFKEVRLHGVALGIPSLDWL
FT                   TRHQADLSGIELHLKINVGMNRFGVSSLEEALAVLETVREQELTLTGLYTHFPLADEPG
FT                   ADHDGQVERFLEIGNPLQAKHSFTYIHAENSATIVKHDPRLACCNYVRPGIFLFGYSPI
FT                   EKMDWLVPSLRMTTEVVEIRQVEAGEHVGYGTSYTAPTAIRVAVLPVGYGDGVVRGRSS
FT                   LPVIINGKRYPIISKLFMSHTFIAVDSTVEIGDKVVLYGDGIEIDDITRTGTANNSEQM
FT                   CARSWRLTHRYL"
FT   gene            525668..526981
FT                   /locus_tag="Exig_0492"
FT   CDS_pept        525668..526981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0492"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: bsu:BSU23380
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59974"
FT                   /db_xref="GOA:B1YJ44"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ44"
FT                   /protein_id="ACB59974.1"
FT                   /translation="MYGSRYLTEQNNELQIDGVAVTELAKQYGTPLYVMAERELTDRLA
FT                   TVRDAFLKKYPNTYASFASKALTIGAVYQQVVRHGLGIDVVTGGELFIARKAGVPAERI
FT                   YFHGSNKSTQDLQYAVKEGVGKIVIDHYGEIAQLNQIAGDTCQTVQVLIRIVPQVIGGA
FT                   HTKIQTGGVDTKFGFSTHDDSYLQAVEAVLAAEHLVLLGIHCHVGSQIQEIELFERTAR
FT                   TMMGFVETIRERTSFVASEVNLGGGFGIAYTQDDQPLDFEQTMERVMAIIDEETTRLAI
FT                   DRPRIGIEPGRWVVANAGTTLYTVGAIKEVQGVRTYLSVDGGMADNIRPALYGAVYETV
FT                   IANRIKGETRHVTVVGAACESGDLVAESADLAEPVSGDTLAVFGTGAYNYSMASNYNQF
FT                   LRPAVVFVNQGESREVVRRQTYADLIQCDLGLENIPSS"
FT   gene            complement(527035..528057)
FT                   /locus_tag="Exig_0493"
FT   CDS_pept        complement(527035..528057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0493"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: Peptidoglycan-binding LysM; polysaccharide
FT                   deacetylase; KEGG: tte:TTE0866 predicted xylanase/chitin
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59975"
FT                   /db_xref="GOA:B1YJ45"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ45"
FT                   /protein_id="ACB59975.1"
FT                   /translation="MHGKWIRIIMIMLISLFPFFSYGLTADAASSTFVTKGSTTSKVVA
FT                   LTFDDGADGGNITKILSILKANNVKATFFLTGTGANNHPQLIKNIATATPTHQLGNHSY
FT                   THPDFTKLTATQMTSELSKTENLIKSLTGRTTKPIFRAPFGASNSAVLAAVGNAGYTKT
FT                   IQWNIDTTDWKGISSTAILARVVPNIVPGSIVLMHTGAGAPGTPVALPSMISQLKAKGY
FT                   KFVTISELLKLPPSGSKTYTVKSGDTLYKIANLYNVTVAALAKANNITNYNLITVGQVL
FT                   VIPGTTPPPPTTVTYTVKAGDTLYSIATKYGVTVTALASANKITNVNLISVGQVLVIPK
FT                   "
FT   sig_peptide     complement(527971..528057)
FT                   /locus_tag="Exig_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.896 at
FT                   residue 29"
FT   gene            528263..529390
FT                   /locus_tag="Exig_0494"
FT   CDS_pept        528263..529390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0494"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: cno:NT01CX_0629 glycine
FT                   betaine/carnitine/choline transport ATP-binding protein;
FT                   TIGRFAM: glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit; PFAM: CBS domain containing protein; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59976"
FT                   /db_xref="GOA:B1YJ46"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ46"
FT                   /protein_id="ACB59976.1"
FT                   /translation="MIEFKNVGKQFKDNVVLKGLTLEIKEGELVVFIGPSGCGKTTSLK
FT                   MINRLIEPSSGTILVNGKDIMKTDTIELRRHMGYVIQQTGLFPHMTVRENIQLIAGLEG
FT                   KDHDQMDVRTEELLQMVGLDPKQFIDRYPSELSGGQQQRVGFARALMNDPDVILMDEPF
FT                   SALDPVTRNDLQEELFNLQEEVKKTIVFVTHDMDEAIKLADRICIMRDGEIVQFDTPEE
FT                   ILRHPKDEYVESFIGKNKIWSSPAFIKAEDIMIEDPVSISGKRTLLQGIEIMRGRKVDS
FT                   LLITDRDRILQGIVKLKNIQTAPDKGVRIEDVMEGELVAVDEQDSLLDVLEVMNHEETG
FT                   YLPVTNKSGQLRGLITRSSLLSVLSEQFIQEEEVQ"
FT   gene            529387..530970
FT                   /locus_tag="Exig_0495"
FT   CDS_pept        529387..530970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0495"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; Substrate-binding region of
FT                   ABC-type glycine betaine transport system; KEGG:
FT                   cbh:CLC_1663 glycine betaine/L-proline ABC transporter,
FT                   permease/glycine betaine/L-proline-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59977"
FT                   /db_xref="GOA:B1YJ47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ47"
FT                   /protein_id="ACB59977.1"
FT                   /translation="MNGFLDYVQNNTGQIFDLLLEHLQLTVLAVVIAVVLGIPIGILIT
FT                   RYQRFAKPILALTSVVQAVPSLALLGFLIPFIGIGSTPAIIMVVLYSLLPIVKNTYTGL
FT                   SSIPGDMLEAAKGIGLTDRQILGKVQIPLALPIMMAGIRISAVTAVGLMTISAFIGAGG
FT                   LGYLVFSGIQTVDNNQILAGAIPAGILALAIDFIVSRIEYSVAPNGIPLADGRVKSRAR
FT                   KRRKAMSAGKKIAIAAIVFLLIGGTVAYSFLKTDKIVIGSKNFTEQLILGNMLADLIED
FT                   KTDLEVERQLNLGGTKVAYGALETGEIDAYVEYTGTLLIDVLKQKLETDPEAVYKKVGK
FT                   MIPEKSQVDVLEPIGFNNTYALAMTKEDIKKYDLKTVSDMAGVSNRLILGSTIEFANRE
FT                   DGYLGLKEKYPDMKFKDVQPVDGGLRYTALTNGKTNVIDSFSTDGLLKKFDLTVLEDDK
FT                   EFFPPYYAVPIVRQETLEEHPELKEVLNLLKDKITDKKMQELNFKADVEKERPEDVARE
FT                   FLIEEELIKK"
FT   gene            complement(531115..531312)
FT                   /locus_tag="Exig_0496"
FT   CDS_pept        complement(531115..531312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59978"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ48"
FT                   /protein_id="ACB59978.1"
FT                   /translation="MTPLFEERLMADLFSSTNNPSYGLPTLPVYETDGLTKELQARIVN
FT                   DAEQKSLSLGIIQSREEEHV"
FT   gene            complement(531421..531960)
FT                   /locus_tag="Exig_0497"
FT   CDS_pept        complement(531421..531960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59979"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ49"
FT                   /protein_id="ACB59979.1"
FT                   /translation="MKYRVGQLVPNVDPSVYIADGAKVIGEVEIGKDSTVWFNTVIRGD
FT                   EGPIKIGERVNIQDGSMIHQYEGYPTIIEDDVTIGHMAMIHGGIIRQGALIGMSATILD
FT                   QAEIGSGAFVAAGSLVPPKMVVPPNSMVMGVPAKIVREISDHDRFIMERTIRKYVKRGQ
FT                   QYAADCTPLEEDLTTM"
FT   gene            532085..533815
FT                   /locus_tag="Exig_0498"
FT   CDS_pept        532085..533815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0498"
FT                   /product="adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="KEGG: gka:GK2098 adenine deaminase; TIGRFAM: adenine
FT                   deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59980"
FT                   /db_xref="GOA:B1YJ50"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ50"
FT                   /protein_id="ACB59980.1"
FT                   /translation="MNQTIRARLITIAAKKEKAAVVYQGIQVIDVMTRETYQADVAVDS
FT                   GYIAAVGDGYEGIEMIDGTGKFIAPSFIDGHVHIESSMVTPSEYEQAILPLGVTTVIAD
FT                   PHEIANVKGAEGLQFMLDDAAGLSLDVRMMLPSCVPATSFEHAGASLDAAALAPFVKHP
FT                   GVHGLGEVMDYPAVERADRDMLKKIEQIESAGKLVDGHAAGLGARELNIYGVAGIRTDH
FT                   EAVSKQEAIERARRGLYVEVREGSAARNLQEVLDAVTESNAGRFLFCTDDKHLDDTLRE
FT                   GTIDYNIRYAIQHGIKRETAYAMASLHAANAYQLNDRGAIVPGRRADFVILQDADQVII
FT                   DEVFVSGEPVARAGKTIISSQKIAVPSTLRGELKTKPITDQVFELVLEKTKAHVIGIIP
FT                   KSIVTEHLILDVPLQDGKFVPVPEQDLLKIAVIERHNATNFSAVGIVKGFGMKRGAIAA
FT                   TVAHDSHNLVIVGTSDAEMKLAAERLIKAGGGVIAVNGTEVLAELPLEIAGLMTSRPFQ
FT                   EVGDTLEALNDALDVLEADRSFNPYLTMSFLCLPVIPNLKLTDSGLFDVKTFQHIAVQA
FT                   "
FT   gene            534003..534260
FT                   /locus_tag="Exig_0499"
FT   CDS_pept        534003..534260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59981"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ51"
FT                   /protein_id="ACB59981.1"
FT                   /translation="MDKSYFEGHEKLIADVYRSFIDQFHELPNNRRTKRQLRNLAFSVI
FT                   RQAGPTYQERTVLYAFFAEFFRAVEEGQREEIEFYKQIAQ"
FT   gene            complement(534348..535982)
FT                   /locus_tag="Exig_0500"
FT   CDS_pept        complement(534348..535982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0500"
FT                   /product="4-phytase"
FT                   /EC_number="3.1.3.26"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: btl:BALH_1801 oligopeptide transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59982"
FT                   /db_xref="GOA:B1YJ52"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ52"
FT                   /protein_id="ACB59982.1"
FT                   /translation="MKKQTKIAFAGLSSMALLAVAACGQSNESDGNSSSSKEKKQEVTL
FT                   ISTTDVPQLDPTKTTDSTSIIVTNNVFEGLYRLDGDNKPTAGIAESVEVSDDKKTYTFK
FT                   LRKDAKWSDGSAVTADDFIYSWKRALDPKTGAEYAYILQDLKNANKILAGEAELDSLGV
FT                   KKVDDQTLEVQLEAPAPYFLGLTSFPTYLPLKQSFVEEKGDKFATNVDSMLFNGPFILD
FT                   KWQSNSGWTYKKNPDYWDKANVKMEKIDVKVVKEISTGVNLFESKDVDFAPITSEFVSQ
FT                   YEKSDNYKTRPDARINFLRFNQKNKALKNENIRKALALGFEKQGITDVILNDGSKPANF
FT                   IVAKDFTFTPDGEDFRAKYPDLQSFDATEAKKAWDSGLKELGVKTVELDMLSRDEDAFK
FT                   KVSEFLKGDLEKNLPGLTVNIKQQPFKNFLDLESKGDYDISAAGWGPDYQDPMTFLDMC
FT                   LTGGSFNRMEYSNKEFDKMIKEAKAEPDEAKRWSTLQEAEKMLLAEDYAIAPIYQKGEA
FT                   YLQRANIDKLYRHPFGADMSFKWMEVK"
FT   sig_peptide     complement(535908..535982)
FT                   /locus_tag="Exig_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.588 at
FT                   residue 25"
FT   gene            complement(536091..536774)
FT                   /locus_tag="Exig_0501"
FT   CDS_pept        complement(536091..536774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0501"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bha:BH3225
FT                   magnesium (Mg2+) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59983"
FT                   /db_xref="GOA:B1YJ53"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ53"
FT                   /protein_id="ACB59983.1"
FT                   /translation="MNWIHSFQLEDFFKLMIAALFGIIIGFEREIKNKPVGIRTSLVIT
FT                   LISCLLTIVSIKSVVLYSTIAPNAQMDPMRLVAQVVAGIGFIGAGVILRRPHDIVSGLT
FT                   TAAIIWAASGIGIALGAGFILEATFLVLFLFFSLEGLTWVMKRVNNSRFEANVIVAHLT
FT                   LAADTDAQTVKTALEKKGVRITNIRLRGHARQLTLRMYSPHKLTIFILYDYLKTLGIEH
FT                   IDLDQ"
FT   gene            536893..538287
FT                   /locus_tag="Exig_0502"
FT   CDS_pept        536893..538287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0502"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Spore germination protein; amino acid
FT                   permease-associated region; KEGG: cpr:CPR_0159
FT                   arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59984"
FT                   /db_xref="GOA:B1YJ54"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ54"
FT                   /protein_id="ACB59984.1"
FT                   /translation="MNQQKIGFFALAAMVIGSMVGGGAFNLPGAMAQKASAGPILIGWG
FT                   ITGLGMIMLALVFQHLANSKPELEGGIYAYAREGFGRFVGFNSAWGYWVSAWIGTVANI
FT                   TLVFNALSYFFPIFSSENRVFLLVMSIVVVWGLFFIVSSGIKEATLVNLITTIAKLVPI
FT                   LIFILLVAIAFNVKTFNLNFWGEGTELGSIFTQVKGTMLVTLWAFVGIEGAVVLSTRAN
FT                   KRSDVGKATVVGLVGVLVIYILISVLSLGVLNQEQLAGLQEPTMAYVLEAAIGPFGATL
FT                   IMVGLIISLSGALLGWTILASEISYLVAKDGAFPKFFAKTNRKGAPVGALLITQIATQF
FT                   VAGIALFSAQTYLVLSSIAGICALLPYLLSAVYSVRFSRAERNTKMLIFSTIAAAYSLW
FT                   LVYASGIWYIVIAALVYAPGIIAYLMAEREQKRGGMSRYEMIASGILIILAAVAVYGMI
FT                   GGQIQL"
FT   sig_peptide     536893..536991
FT                   /locus_tag="Exig_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.563 at
FT                   residue 33"
FT   gene            complement(538373..540430)
FT                   /locus_tag="Exig_0503"
FT   CDS_pept        complement(538373..540430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0503"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: sdn:Sden_3424 GGDEF domain; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59985"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ55"
FT                   /protein_id="ACB59985.1"
FT                   /translation="MDRSTISSYETVMQGFPLPAFILHVDLTVHSWNEAAESCWGWSAQ
FT                   EVTGQLVPLLDPEDAAFSRQIWYSFLEKRQSMQLPNTTFLHKSGDRSTSTLLVSPLFDE
FT                   KNEPSGAFFCQLPSSTQQNATKPLFQGLMDLRYAFDQIACVAIFDARGTIQYANTNLTD
FT                   ITGFCPHLLLGQPWTILLDSSEDVLPMIRSQIKKKKAWSGKLSISTQDESKKVFHATLI
FT                   PVYDVNGVRFQHLFIGTDITETEHLEQELDFLVHHNELTHLLNRRGFLREGQVLFSKAS
FT                   DDLPISLILFDIDRFKVINDSFGTHVGDQLLQALAKRLSEHAKQLLTFHPTSDLFGVVL
FT                   EVTDRNALFQYARKLQQVLQRPYYINGHSLIISCTFGITVYPSEAKSLEDLYRRSEMAL
FT                   YAGKSIGTGTIQYLTHEMDEQFTRKLQLERSLFTALEDQALHLVYQPIINLKTKHVDGF
FT                   EALLRWNHTALGSIPPDEFIPLAEEAALITPINNWVVIEACERLALWQKQIAPDLTMAI
FT                   NISPHQFQSDSFVRTLQHVVSQKKIDPRFVTLELTENIAILQTQRTIERMQLIQALGFR
FT                   LSIDDFGTGYSSLQYLRAFPIDELKIDKVFIDGIDLGENGLLDSIIQLGQNLKLNLVAE
FT                   GVETTTALSYLEATACQQMQGFIFSEPLSVEEVELRFGSSNPEEPDNKDN"
FT   gene            540604..541806
FT                   /locus_tag="Exig_0504"
FT   CDS_pept        540604..541806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0504"
FT                   /product="ornithine aminotransferase"
FT                   /note="TIGRFAM: ornithine aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: bld:BLi00422
FT                   ornithine--oxo-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59986"
FT                   /db_xref="GOA:B1YJ56"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ56"
FT                   /protein_id="ACB59986.1"
FT                   /translation="MNQTEKIITQTEKFGAHNYHPLPIVISEAEGVFVKDPEGREYMDM
FT                   LSAYSAVNQGHRHPKIIEALKRQADKITLTSRAFHNDQLGFFYEKVAQLTGKDMVLPMN
FT                   TGAEAVETAVKAARRWAYEVKQIPGDAEIIVCEGNFHGRTMTAVSMSTEAEYQRGFGPL
FT                   LPGIKTIPYGDLEALKGAITENTAAFIVEPIQGEAGILIPYEGFLKDAQDVCKEQNVLL
FT                   VSDEIQSGLGRSGKWFASDWDNVTPDMYILGKALGGGVFPISCVAANHDILSVFNPGSH
FT                   GSTFGGNPLACAVSVASLEVLEEEKLPERSLELGTYFMNRLKEIDNPMIKEVRGRGLFI
FT                   GVELTEAARPYCEALKEKGLLCKETHETVIRFAPPLVITKEELDWAFERIEQVLGVSVA
FT                   Q"
FT   gene            541952..542149
FT                   /locus_tag="Exig_0505"
FT   CDS_pept        541952..542149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0505"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bwe:BcerKBAB4_3320
FT                   CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59987"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ57"
FT                   /protein_id="ACB59987.1"
FT                   /translation="MSHDSGLNKKADGLVDKVAGKAKEALGKATGDKSTEREGKKDQLK
FT                   GDAKKTVGNVQQNLEDTNRR"
FT   gene            542309..543817
FT                   /locus_tag="Exig_0506"
FT   CDS_pept        542309..543817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0506"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: bce:BC0482 PTS
FT                   system, N-acetylglucosamine-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59988"
FT                   /db_xref="GOA:B1YJ58"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ58"
FT                   /protein_id="ACB59988.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGIVLRLGSADMLDIPLMVAAGGA
FT                   IFDNLPLIFAIGVAIGLSIDASGAAGLAGAVGYLVLKTGVDSMNKDYSNAQIQAKYDAI
FT                   AAIVNDSSTKVDGATLSSIANQATLGSMVNMAVFGGIIAGIVAGLLYNRFYNIKLPDWL
FT                   AFFGGRRFVPIITSAAMLVLAFVFGYLWPFIEDGINNAGEWMVSLGAGGAALFGFFNRL
FT                   LIPVGLHHVLNNIFWFVFGSYEKADGTIANGDIARFFAGDPTAGIYQAGFFPIMMFALP
FT                   AAAAAMVMAARKENRKAVAGAMIGLGLTSFLTGITEPIEFSFMFLSPVLYVMHAVLTGV
FT                   SMAVVNLLGILHGFSFSAGFIDYVLNFGIATKPLLLLVVGLVFAVIYYFLFYFMITKFD
FT                   LKTPGREDESLVTDAGPVTGVSDDKYEQQAARIFAGLQGTDNVTAIDNCATRLRLQVKD
FT                   STIIDEAAIKAAGAKGVMKMGAKNVQIIIGTDVEFVADAMKRQK"
FT   gene            complement(543850..544755)
FT                   /locus_tag="Exig_0507"
FT   CDS_pept        complement(543850..544755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0507"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; UAA transporter; KEGG: btl:BALH_4572
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59989"
FT                   /db_xref="GOA:B1YJ59"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ59"
FT                   /protein_id="ACB59989.1"
FT                   /translation="MNRSKATLFVLIGAISYGVLSTIVKLAYGAGFDSAAVSGSQFFFG
FT                   WLMIFVLALLSKNLRLHPKTALTLMAIGISSGTTGYLYYQSLQTVSASVAIILLFQFTW
FT                   IGVVIDSILAKRLPSRSHFLSAVLLIGGAVLASAAYTSALDVRGTLFGLGAAVSFSIFL
FT                   LASGRVANHVPVIKKSFYMMTGGLLFVMIMYPPTTFLTATNFEQGLIWYALPLGLFALI
FT                   LPPLLFAAGAPHLSPASVSLLGAAELPTAVICSVLILGEHLSGSQWIGIIIILIGIFYP
FT                   IYVSSLKQSTTSVPRQNDLS"
FT   sig_peptide     complement(544666..544755)
FT                   /locus_tag="Exig_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.340 at
FT                   residue 30"
FT   gene            complement(544849..545499)
FT                   /locus_tag="Exig_0508"
FT   CDS_pept        complement(544849..545499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_2062 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59990"
FT                   /db_xref="InterPro:IPR019454"
FT                   /db_xref="InterPro:IPR036785"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ60"
FT                   /protein_id="ACB59990.1"
FT                   /translation="MINKRMILTSCLTCLGLLFLSACSSDPAASIYNQLEEQAKSERKA
FT                   AAIAEQRTRQDEISVNTYQAVLEAGADDIKRAQNEREELTALNQNRADLLKQEKTIRTR
FT                   AFDKLDLSELTGSLSSLPAAKKDGTALIKVFKEREKAFDTFLKRYTAAIVSEKKVLSYL
FT                   TEKPNFVKIDEATADLNRTSRQATEALKTFNRLTVRYNELKPTFYKKAGLNIK"
FT   sig_peptide     complement(545425..545499)
FT                   /locus_tag="Exig_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.614 at
FT                   residue 25"
FT   gene            complement(545512..546360)
FT                   /locus_tag="Exig_0509"
FT   CDS_pept        complement(545512..546360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0509"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: bca:BCE_2061
FT                   polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59991"
FT                   /db_xref="GOA:B1YJ61"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ61"
FT                   /protein_id="ACB59991.1"
FT                   /translation="MDPYNSGNPLGLGPRHRKPKRKYFAKLFILMALILLPLGGYIVYQ
FT                   YLTSTQQQADVKSVQSLQEVPTPNLDKARVEKWNGITKKVAYLTFEDGPTALTSDILKS
FT                   LKEQEVKATFFLIGSNINEQPDVVRSMAKAGHYIGPHSETHDYDTLYKKKQYVPEMLRV
FT                   QKQINQLTNHSPLLTRPPYGSTPGITKSIAKEIEQAKLRVWDWSIDSMDWYYKDSAKEV
FT                   ANTVISRAEGPVEIILLHEQPQTLQALPAIVAGLKKKGYQFSIYDEDFHVPYNFAKFSN
FT                   L"
FT   gene            546619..547557
FT                   /locus_tag="Exig_0510"
FT   CDS_pept        546619..547557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0510"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bha:BH3950
FT                   transposase (10)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59992"
FT                   /db_xref="GOA:B1YJ62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJ62"
FT                   /protein_id="ACB59992.1"
FT                   /translation="MSYIHLTISERVKIETYLELGFSVRKIAGRLGRQPSTISRELKRN
FT                   PHYDSSHAGQRYVERKKKCGARTKFTLEKGICILEKLRETWSPEQIAGRLFQEEGLSFK
FT                   TIYRWIYSGLVEADSGLLRQKGKRQKPRETRGRFNVGLPISKRPSDVKGRQTFGHWELD
FT                   TVVSGRGTSKACVATFVERKSRFYLAVPMENRSAQSMESAIQALHLSFPLGTFQTATTD
FT                   RGKEFSCHERIRDTLGLPMYFADPYSSWQRGSNENANGLLREFFPKGTDFGKVSRSEIA
FT                   QALAWINGRPRKCLNWKTAYEVFTEEVLHLI"
FT   gene            complement(547623..547769)
FT                   /locus_tag="Exig_0511"
FT   CDS_pept        complement(547623..547769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59993"
FT                   /db_xref="InterPro:IPR025432"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG3"
FT                   /protein_id="ACB59993.1"
FT                   /translation="MEQPFYQETSPEFYRQLPVKTCSHCGKEMDEQCESYKTECDECAV
FT                   TEH"
FT   gene            547964..548590
FT                   /locus_tag="Exig_0512"
FT   CDS_pept        547964..548590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0512"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bld:BLi02275 YodC"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59994"
FT                   /db_xref="GOA:B1YJG4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG4"
FT                   /protein_id="ACB59994.1"
FT                   /translation="MNQTLSDTLSLLTERRSVRHYDETFTLSHEDVQELIELTTAAPSA
FT                   WNLQHWHFVAFHSEEAKQQLAPIAYNQPAISSSSVVIAVLGDLQANRNYNPVYGPAVEA
FT                   GGMTEDLFDSIKGQVEGAYQSEAYARDAAMSNASLAAMQLMLVAEAKGLSTLAMGGFNH
FT                   QLFTETFITDERYVPVMLIAVGKAVEDAKKRPALRLPVDQVTTIL"
FT   gene            548734..548806
FT                   /locus_tag="Exig_R0057"
FT                   /note="tRNA-Val2"
FT   tRNA            548734..548806
FT                   /locus_tag="Exig_R0057"
FT                   /product="tRNA-Val"
FT   gene            complement(548851..549417)
FT                   /locus_tag="Exig_0513"
FT   CDS_pept        complement(548851..549417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0513"
FT                   /product="protein of unknown function DUF1541"
FT                   /note="PFAM: protein of unknown function DUF1541; KEGG:
FT                   bsu:BSU05790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59995"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG5"
FT                   /protein_id="ACB59995.1"
FT                   /translation="MKKQLFVTSLALSAVIGLSACGSDSNSSNSHDMHDDMKDSHAGMM
FT                   HSSDGKIPAGLKQAENPKFKDGANVVLSSDHMKGMDGAEATVVDSFDTTVYAVSFTPTN
FT                   GGKKVSNHKWVIQEELSPVPDSPLKAGDKVTLAADHMKGMDGAKATIDQADETTVYMVD
FT                   FKPTTGGKTIKNHKWVTEDELQAKN"
FT   sig_peptide     complement(549349..549417)
FT                   /locus_tag="Exig_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 23"
FT   gene            549570..550931
FT                   /locus_tag="Exig_0514"
FT   CDS_pept        549570..550931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0514"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: gtn:GTNG_1608 two component
FT                   system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59996"
FT                   /db_xref="GOA:B1YJG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG6"
FT                   /protein_id="ACB59996.1"
FT                   /translation="MRHISYYIGLLFLTAILVIGGILFSTLYFNLVNQRTDEVVLGLLN
FT                   RGNTHRDVLEESFNAETLEHVSLMESASEFTVVITDQKGKILKASHPLTPKMKVELIHT
FT                   EFQTQRKDRILRAQAETKGFFMTDSPITISGVHRGHVFMFAPETLIQQVVDPLRQQFIQ
FT                   VGIIAVLLSLTTVVLCTRLISRPLIEMERATAKLKEGNLDVDLPVNRSDELGALARSIT
FT                   QLAKDLDFLNRERTEFLANISHELRTPLTYMKGYADILHRPNLPESEKTAYLSIIKEES
FT                   DHLSTLIEQMMLLARSDTNAFSVERVPLALDQLIVSTTEKMRPAIEEKGLHLHVSGEPV
FT                   EIAGDEIRLKQVLINVLDNAKKYTATGEIVVRYGRNETGPYFQVRDTGSGISQESLPHV
FT                   TKRLYRSEPSRSRSRGGSGLGLTIALAIVQAHDATLDIKSEKNAGTSVMIQWKV"
FT   gene            550936..551616
FT                   /locus_tag="Exig_0515"
FT   CDS_pept        550936..551616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0515"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bcy:Bcer98_0503 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59997"
FT                   /db_xref="GOA:B1YJG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG7"
FT                   /protein_id="ACB59997.1"
FT                   /translation="MARILIVDDEQRMLQLMKLYLTPYGHTCHLVDSAEKAIEIVKTVP
FT                   IDIALLDVMMPEMDGWTLCENIRRIADFPIIMVTARNQMEDVVRGRTVGADDYVAKPIH
FT                   EGELLGRIELLIGREKREQYTFHGLHYDAKGYDCSFDEQKILLTKTEFQLLGKLLASVN
FT                   RILSREQLVRSLWSDDQSIEPRTIDSHMRHLREKLRRSGFPIDEYLETVRGVGYRLLEQ
FT                   TKDS"
FT   gene            551630..552190
FT                   /locus_tag="Exig_0516"
FT   CDS_pept        551630..552190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0516"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bcz:BCZK1571
FT                   phosphoglycerate mutase family protein; possible
FT                   fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59998"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG8"
FT                   /protein_id="ACB59998.1"
FT                   /translation="MTTTIYLVRHAHSTYSTDEKARPLSEQGRYDAEQLTTLFEGIKPD
FT                   QIYASPYRRAIETVQPLAEQYGLVIQEAAAFQERLLAPEELPDFQQAVGYVWEHPDENP
FT                   YGGESNVTAQRRIVPEIKRLLEKHKDQTVVIGTHGNIMVLLMQHFDPAYGYAFWKTLKM
FT                   PAVYQMTFKDETFLQIEEVCQHN"
FT   gene            complement(552238..553722)
FT                   /locus_tag="Exig_0517"
FT   CDS_pept        complement(552238..553722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0517"
FT                   /product="phytoene desaturase"
FT                   /note="TIGRFAM: phytoene desaturase; PFAM: amine oxidase;
FT                   FAD dependent oxidoreductase; KEGG: sas:SAS2450 putative
FT                   phytoene dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59999"
FT                   /db_xref="GOA:B1YJG9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJG9"
FT                   /protein_id="ACB59999.1"
FT                   /translation="MKKQAVVIGAGLAGMSAAIRLAGDGYEVTMLEQNGNVGGKLNQRS
FT                   GQGFTFDTGPSILTMPWVLEQLFTSVHRRLDDYLEIERIEPQWRTFFEDGTQLDVKGDL
FT                   PGMLEEFKKVSDQADFVELFSYSKKMYDLCLDSFYKYSLEDLKDLKKYHTMSELLKMDP
FT                   LNTVASGTKKHLNNKYLEQLFNYMVMYVGSNPYEAPAVFNQMIYVQMGLGIYYVKGGMY
FT                   NIARAMKTVLDELRVTIHVNTPVARVVTEGKRAIGVETTDGTFYPADVVVSNLEVIPTY
FT                   QHLISEKKGPKQAKKLNQSFVPSVSGLVLLLGVNREYKDLKHHNFFFSDDPEREFAQMF
FT                   KDGVPPEDPTIYVGVSSKSDASQAPEGKDNLFVLTHVPPLTKQDGKTDWDAYREVVLDK
FT                   LERMGLTDLRESIEFEYRFTPEDLKSLYGPNGGSIYGVAADRKKNGGFKIPSKSDLYEG
FT                   LYFVGGSTHPGGGVPMVTLSGQLTADLIQKHEKVKA"
FT   sig_peptide     complement(553654..553722)
FT                   /locus_tag="Exig_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(553745..554290)
FT                   /locus_tag="Exig_0518"
FT   CDS_pept        complement(553745..554290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0518"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: xcv:XCV0113 putative protein-S isoprenylcysteine
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60000"
FT                   /db_xref="GOA:B1YJH0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH0"
FT                   /protein_id="ACB60000.1"
FT                   /translation="MTILDKVFIAVSLLWLFELFLFRNRKKEPSPLEERQSFYWILATL
FT                   ITTILFSVLFSDSIRLPLSREIGLLLLTSGVVLRYWGIYHLKHQFTRHVAVNPGDRLVS
FT                   TGPYRALRHPLYSGLFFITLGFPLYFGNLFVTLCAGILMFIALLHRIRIEEQMLTKGFG
FT                   PAYTDWARKRKRLIPFIY"
FT   gene            554526..555338
FT                   /locus_tag="Exig_0519"
FT   CDS_pept        554526..555338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0519"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; SH3 type 3 domain protein; KEGG: cdf:CD2504
FT                   putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60001"
FT                   /db_xref="GOA:B1YJH1"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH1"
FT                   /protein_id="ACB60001.1"
FT                   /translation="MKKLKQTVIGLLAILLSLVSFSLAAEASSYRQAKTPLNLRSGAST
FT                   TKAVVAVIPTTVYVNEISRLGTWSKVRYGTQTGYASTKYLLTDQQIGGLRIGKTLIVNP
FT                   NLPLRSTYAPGESTVARAAFEKMKRAAKAEKITLVAFSTYRSYAYQKALFEKYVARDGF
FT                   EKASTYSAQPGKSEHQTGLGFDIGGADSSKYAKFSFSSTKEAKWLAANAHRFGFHLRYP
FT                   LGKESWTGYTYESWHYRYVGATLAAQLKMTGLTMEEYYQLAPGKPSTP"
FT   sig_peptide     554526..554600
FT                   /locus_tag="Exig_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.731 at
FT                   residue 25"
FT   gene            555433..555944
FT                   /pseudo
FT                   /locus_tag="Exig_0520"
FT   gene            complement(555956..559060)
FT                   /locus_tag="Exig_0521"
FT   CDS_pept        complement(555956..559060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0521"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gka:GK2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60002"
FT                   /db_xref="GOA:B1YJH2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH2"
FT                   /protein_id="ACB60002.1"
FT                   /translation="MNFLTRFSLKNSVAVFIIAILLVLGGVYSFSQLKVDQFPEIEFPQ
FT                   ISVEAVYPGASPDDVDKQVVSKLETALKGIEGSTKITSSAYESIGIINIEFPFDTDMDK
FT                   VEQQIDAAIQDANLPEEATTKLNRFSFGSFPIYNISFFSKDGKEIESLLKNEIEPELNK
FT                   IPGINSVSVGGYKDDLVQITVDNKKATAAGLSLSSIKEQINAKYVSFPSGQLAEGDSKI
FT                   PIRVEEKLENLDKLKNLQLTSSVASGAASGGQGQPAQSGPPAGATGETGAPTEQAEPVR
FT                   LSDIATIEAVSKQSEKTRYDLKDSLSMAITKKQDANTVEIADGVTKILNKYDDQIDYTI
FT                   GIDSAKDIEESVATLVKEGLLGALFASLAVLLFLRNIRATIIAIVSIPLSLLIAAIFLN
FT                   WQAISLNIMTLGGMAVAVGRVVDDSIVVIENIFRRVRKSDGGMTDEVIEQSTKEILKAI
FT                   TSSTLTTVVVFLPIGFVGGITGKFFLPFALTIIFSLLASLLVAITIVPILAKFAFKKVP
FT                   AEEKEGVLQRWYGTLIEKSLSHKAIILVVSFLLLGGSLAIVPQLGFTFIPNEASKTLTA
FT                   SLELPAATSLEKTSDVSLNMEKMFDQENAIADVTTSVGARDFTTGLRLDNKASYFLNLK
FT                   DGADVEKTIKSLETKMDDIAKEDGVDVKISVAELSTGGPPSNNNVDVDLFSTDLEALQK
FT                   AAKLVEDNMNKNNDLKYVTNNFSEKQKQFLVEIDSEKASDRGLSGFQILGTVNDQTKPV
FT                   TVGTLNLDDKDQDVQLSYKEDLTSKEDLENVQLFSAAGPVALKDVATVNEVDTFTSIQK
FT                   LDGKVYARVSGQVKGDNVQTVSSDVKAAVEKIDLPDGVSLTSGGGNDDTVEIFQSLGIA
FT                   IVVAIGLVYLTMLITFGKARIPFIILSSLIFVPIGSLVTLFLANEPLSVSVMIGFLMLI
FT                   GIVTTNAIVLVDRIGQNITRGLPVRESLIEAGKTRLRPILMTAFATIMALVPLALTTSS
FT                   GTLISKGLALTVIGGLTTSTLLTLIIVPVVYELFFFKKVKKERQS"
FT   sig_peptide     complement(558965..559060)
FT                   /locus_tag="Exig_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.724 at
FT                   residue 32"
FT   gene            559237..559309
FT                   /locus_tag="Exig_R0058"
FT                   /note="tRNA-Val3"
FT   tRNA            559237..559309
FT                   /locus_tag="Exig_R0058"
FT                   /product="tRNA-Val"
FT   gene            complement(559402..560415)
FT                   /locus_tag="Exig_0522"
FT   CDS_pept        complement(559402..560415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC0757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60003"
FT                   /db_xref="GOA:B1YJH3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH3"
FT                   /protein_id="ACB60003.1"
FT                   /translation="MKEYAMDRMVKVSAGMANAVLVTLGVGLLIETFGNLLHIEMLLTI
FT                   GGVAKVLLAPALGAGIAYQLGGNTLVLFSAMIAATIGGAALQPTDAGLVLVPGQPISAL
FT                   LAAAVAVFVGKRMTGKTKFDMMVIPVSAVLAGGFTGLGAAAVTTPLLTRFSAMVTASVE
FT                   SSPIATSLVIALIFSVLLMSPASSAALAIALQLDPVASAAALIGCSAQFVGFTLMAYRQ
FT                   TDPGGLIASFFVTPKVQFPNIVKNPRLVVAPFLAAMISAPIATLVLSLEVPYELAGLGL
FT                   NSMIAPLNIFVNQGFNAFLIFFATGVVLPGVLTLVFYRMTTMAGWTKMGDLRLEIQ"
FT   gene            560763..561497
FT                   /locus_tag="Exig_0523"
FT   CDS_pept        560763..561497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0523"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ssp:SSP0734
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60004"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH4"
FT                   /protein_id="ACB60004.1"
FT                   /translation="MKFAVITDIHGNATALEAVLKRITEEADVSEIFCLGDLIGIGPQT
FT                   NEVIEIVRSTPHMTTISGNHDENVLALIHGQKYPDSYRHAKKHHQWIADQLTPDNQRFL
FT                   EQLPRTVRKTFSEQEALFTHYAYLDETKAIGEEPLADTVDGTEQSLPELFKGEQASLIC
FT                   FGHHHPKQLVRAMGITYLNPGALGCQPEAVAPFAVVELNSGEWNVNVIEVKYDDRPYLE
FT                   AFNAAPMPEKELLRKLFLGGRT"
FT   gene            complement(561550..561867)
FT                   /locus_tag="Exig_0524"
FT   CDS_pept        complement(561550..561867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60005"
FT                   /db_xref="GOA:B1YJH5"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH5"
FT                   /protein_id="ACB60005.1"
FT                   /translation="MIDPYSYLNGVFYLSQLLLSNFLFTLALLVYVIVSLVDMWKSYTR
FT                   TSSKTDFLFFILTLITLFIGFLVSPFLALAFQWKRSRTKRIIGILLIAVPLMLVLVSRF
FT                   L"
FT   gene            complement(561907..562467)
FT                   /locus_tag="Exig_0525"
FT   CDS_pept        complement(561907..562467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0525"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bay:RBAM_010380
FT                   YhgD"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60006"
FT                   /db_xref="GOA:B1YJH6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH6"
FT                   /protein_id="ACB60006.1"
FT                   /translation="MTLSDKEHLILDAAMACFSELGYKGTTIERVAKRAHVGKPTVYQL
FT                   FESKLDLFESLVTRVLQEMKAEAENAYTTTASVEENKQAMIDAIVNHQQQHLFILQITQ
FT                   ETQTLKLQEMSELRIRIEQHIVEYIKNLLETRLELEKRSPAVPVEVTAFLLFKTYIALI
FT                   SEWPLIGKPLDLKTISQAMLKLL"
FT   gene            complement(562454..564895)
FT                   /locus_tag="Exig_0526"
FT   CDS_pept        complement(562454..564895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0526"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="TIGRFAM: YhgE/Pip N-terminal domain protein;
FT                   YhgE/Pip C-terminal domain protein; PFAM: ABC-2 type
FT                   transporter; KEGG: lwe:lwe2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60007"
FT                   /db_xref="GOA:B1YJH7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH7"
FT                   /protein_id="ACB60007.1"
FT                   /translation="MFRSEWKKLKSPMMIIVILALILVPFLYNSIFLSAFWDPYGKTEN
FT                   IKVAVVNEDKATKFEGEKIDIGNQFVKKLKKNDDFDWQYLSRKDAAKKLRAGDIYMTVV
FT                   IPKKFSHNATTLLDDHPKKIELEYYLNPAKNYSGTQISSAAAKQLNEKIRKSVTKQYSS
FT                   AIFGSLKKIAKGLEDASEGSAKLEDGAKKTTDGAKTLTTNLSKLTSGTNELSTNLTKAA
FT                   DGSVQLTSGLNTLSGGTKTLAEKSGELSSGLNQLDDNSGKLMKGSADLQAGSTKLRQGL
FT                   ESSAAGSTKLRQGLESSAAGSTELRQGLETASAGASKLDNNLPEFTAGLDQLNARAQEA
FT                   NASLVAVNDAADTLKQELSTRREALEENIASIKAVIASSETLTEEEKGALLQSIATMEQ
FT                   NVQNLAQQESILDASLAKANDATEKINQLAVGGQSIASAVSQLDGGLAQLLDGSKRLEQ
FT                   GQTQLLAGSKQLEQGQTQLLAGAKSLEQGQGTLTQGLTAYTDGVHKAAVGSTQLTAGAQ
FT                   QLATGANDASTASGQLTSGLGQLSDGAVAISSGAGQLTDGASRLADGNSKLADGANTLK
FT                   TELGKGAKDATVKPSNARDNMLAEPVVLKEHDYSTVNNYGSGLAAYILSIALFAGALMF
FT                   SSVYQIRPEHGETLTWRFLVGKLSIILPIGALQGIAASVAIIYVLDADVASTPALYGFA
FT                   ALTGMTFITLLFMLTMLFGRVGQFSAFLLLLLQIGGSGGTFPVEMTPSFFQTIHRFLPM
FT                   TYSVTGFREALGIGVTDTLITNGQILGLILFSALAISFAGALGGKRILLSTKARKRHDT
FT                   V"
FT   sig_peptide     complement(564788..564895)
FT                   /locus_tag="Exig_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.727 at
FT                   residue 36"
FT   gene            complement(565087..566052)
FT                   /locus_tag="Exig_0527"
FT   CDS_pept        complement(565087..566052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0527"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bce:BC3477 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60008"
FT                   /db_xref="GOA:B1YJH8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJH8"
FT                   /protein_id="ACB60008.1"
FT                   /translation="MRALRFRTFGDSSVLHYEEYPTPEIKSNEVLIEMKAIGLNFADIY
FT                   RRKGNYHLEGTPPYLLGYEGSGIITQIGAAVTDLQVGQRVAFADVPNANAEFVAAPVDK
FT                   VIPLPDFVSYETAASVLLQGLTAHYLTRDSYTIRPKDLVLVHAAAGGVGQLLTQIVRLH
FT                   GAIPIGLTSSMEKADIAKQAGAEHVFLYSDNWVEQILTLTDQRGVDVVYESVGSTLMNS
FT                   FEVTKIHGTVVFYGMAGGDPVSVDPRFLMDTSKTLTGGDLWNVLTTREERIRRAGELFS
FT                   WLESGQLQIASPTTFSLSDGQRAHDYLESRQSTGKILLLP"
FT   gene            566159..566425
FT                   /locus_tag="Exig_0528"
FT   CDS_pept        566159..566425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0528"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   btk:BT9727_4526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60009"
FT                   /db_xref="GOA:B1YJH9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJH9"
FT                   /protein_id="ACB60009.1"
FT                   /translation="MKQVLLGGIHFYQKVISPMKPATCRFYPTCSHYGKEAIEKHGALR
FT                   GGYLTTRRLLRCQPFHPGGLDFVPETFDWKAPLQRENPAEHQK"
FT   gene            complement(566475..566864)
FT                   /locus_tag="Exig_0529"
FT   CDS_pept        complement(566475..566864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0529"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bsu:BSU26660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60010"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI0"
FT                   /protein_id="ACB60010.1"
FT                   /translation="MPLLRFDVIEGRSDEELKLLLDTAHEAMLEAFDVPERDRYQIVHT
FT                   HKANEMIIEDTGLGLTRSNQVVVISVTSKTRTEEKKQALYRLLAERLEAVCGLSPADLM
FT                   VSIVENDAADWSFGLGKAQFLTGDL"
FT   gene            complement(566931..568415)
FT                   /locus_tag="Exig_0530"
FT   CDS_pept        complement(566931..568415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0530"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: bha:BH2010
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60011"
FT                   /db_xref="GOA:B1YJI1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI1"
FT                   /protein_id="ACB60011.1"
FT                   /translation="MQQHTKSSLNTDFTKIFINGQWRKGASDSNMTNTNPFTGETLFEI
FT                   SAANNDDLDDAYQSAKVAQKEWAKVPALKRQGLIEEFLKVMYEEKETIVNWLIKESGST
FT                   RIKAEGEFLASVLIVKEAATFPLRMHGEIRPSVVPGKENRIYRKALGVIGVISPWNFPF
FT                   HLAVRSIATAIAIGNAVVVKPATDTPVSGGLIFASLFEKAGLPKGVLNVIVGRGSEIGD
FT                   SIVEHPVPRLISFTGSTEVGRHIGELAGKHLKKTALELGGNNVFVVLDDADLDRAVESA
FT                   VYSKFYHQGQICMSTNRILVAQSIHDEFVEKYVARVKELQFGDPSNGRTQVGPLINQSQ
FT                   VDRIMEEIEKTKAAGATVRVGGEADGNVIAPTVVTGVTNDMPLAKNEIFGPVAVIIPFK
FT                   DDAEALELANSLPYGLSGAVHGSSIERATEFALQVETGMIHINDQSVNDEPHMPFGGEK
FT                   DSGLGRFNGEWVLEEFSTVQWLSVMHERRQYKPFFE"
FT   gene            568609..569814
FT                   /locus_tag="Exig_0531"
FT   CDS_pept        568609..569814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0531"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: oih:OB0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60012"
FT                   /db_xref="GOA:B1YJI2"
FT                   /db_xref="InterPro:IPR018723"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI2"
FT                   /protein_id="ACB60012.1"
FT                   /translation="MQKLKLVYRETNWWWPLLYGVGGAVLTAVVLMVDLYAKELFPNDW
FT                   KTTLGLAQTIHSAVFTGLLTMMTFTFSTILVVLTTYSSQFSPRTLPNFIENRQVQHIFG
FT                   IFIGTVTYSITMLFFMRSSLKDSVVASAVAVIVVLIAVIAFVAFVHIVSQSIRVTTLLD
FT                   RLHEEGCTLIEEHVEAINGGQYQLVPENRSTYSFGLTALQTGYLQAIDYELLMKSGERV
FT                   AIEVTIGSYVTQGQRIGSAEKENVEQGILVGPTRSAEQDFAFVIQKLSEVALRAISPGI
FT                   NDPNTARHAMRQIGDLFRRYTMLLDGNLLVNGEGSVTVKRLAFSELLYLTFYQLRHYGE
FT                   EDISVLSTMLESLEIMKRNALPEHRASIDRFIPFVCSEVDWSALNDWDRQHLEQAQKRA
FT                   LS"
FT   gene            569878..570360
FT                   /locus_tag="Exig_0532"
FT   CDS_pept        569878..570360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0532"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   bpu:BPUM_2231 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60013"
FT                   /db_xref="GOA:B1YJI3"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI3"
FT                   /protein_id="ACB60013.1"
FT                   /translation="MTIILWSLIAVCFLVAFAGLVYPVIPSAPLLIIGFLIYGFGFGFT
FT                   ELTVSFWVIQAIFVILLFTLDYLVSSYTVDRRGGSQAAKIATTVGLIAGPFILPGIGLL
FT                   IFPFVFAILTEKIISKKTWKDSVSIGIGTVLGILSSALLKGIAMLLMIVVFILYVV"
FT   sig_peptide     569878..569934
FT                   /locus_tag="Exig_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.927 at
FT                   residue 19"
FT   gene            570505..571890
FT                   /locus_tag="Exig_0533"
FT   CDS_pept        570505..571890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0533"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: sha:SH2193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60014"
FT                   /db_xref="GOA:B1YJI4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI4"
FT                   /protein_id="ACB60014.1"
FT                   /translation="MEVNPLSLGKRLDSTHAVETFDTTTIIIRLLIIALLIVLTAFFVA
FT                   AEFSVVKMRMSRIDQLITEGSKTAKTAKKLLDNLDYYLSACQLGITVTALGLGWLGEST
FT                   VGAILAMVFKEIALPESVSTVVSFTLAFSVVTFLHVVLGELAPKSLAIQKTEAITMLLA
FT                   PPLYWFGKVMKPVIWLLNGSARVFLRLFGVEPVGHEDAHSEEEIKIIMTQSYKSGEINQ
FT                   TELSYMQNIFSFDERIAKDIMLPRTDLITISNDASMEDIIALVEEYQFTRYPVAEEGDK
FT                   DKILGFINAKQLFTDHMANKGKALSFYVHNLPIVSEYSPLQDAMLKMQVERTPMALVID
FT                   EYGGTAGVITMEDILEEIVGEIRDEFDKDEKADIEQIHERLYRISGRVLIDDLNERFNL
FT                   GIEEEDIDTIGGWVMAQDTEVSSGQEFRYKNHTVKVMEVDNHQVKSIYLQLPEKEPVTE
FT                   EIV"
FT   gene            572037..572477
FT                   /locus_tag="Exig_0534"
FT   CDS_pept        572037..572477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0534"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bcl:ABC1785 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60015"
FT                   /db_xref="GOA:B1YJI5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI5"
FT                   /protein_id="ACB60015.1"
FT                   /translation="MTKTILTSRATAVGGRDGKVASDDNVINLDLVMPGTKGKEDIPTS
FT                   NPEQLFAAGYAACFDGAFNLMARQDKKRVETRTNSEVSLLEDEEAGGVKIAAKLVVEVV
FT                   GVTEEEAQDLLEKTHQFCPYSKATRGNIDVDLSVKVVDSLDN"
FT   gene            572509..572679
FT                   /locus_tag="Exig_0535"
FT   CDS_pept        572509..572679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60016"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI6"
FT                   /protein_id="ACB60016.1"
FT                   /translation="MAPKETERPNEQFEDERKRLTDKERELSPEQQEEVLKGKDEMPDD
FT                   PVSPRDRGMDK"
FT   gene            572710..573222
FT                   /locus_tag="Exig_0536"
FT   CDS_pept        572710..573222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0536"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bsu:BSU07850 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60017"
FT                   /db_xref="GOA:B1YJI7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI7"
FT                   /protein_id="ACB60017.1"
FT                   /translation="MGKKVAVVLADHFEDVEFTGPVDALKEAGHEVTVIGTEKGAELVG
FT                   KQEEAKVTVDVTIDETSSSDFDALLIPGGFSPDLLREDDRFVTFTEEFDTSKKPIFSIC
FT                   HGPQLMINAKIVKGRKMTGYKSIRIDLENAGVSYEDKEVVVDDNFVSSRQPDDIPAFNR
FT                   EMLAKLG"
FT   gene            complement(573277..573684)
FT                   /locus_tag="Exig_0537"
FT   CDS_pept        complement(573277..573684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0537"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bca:BCE_1995 glyoxalase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60018"
FT                   /db_xref="GOA:B1YJI8"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI8"
FT                   /protein_id="ACB60018.1"
FT                   /translation="MYLDHTGIAVRDMQEAITFYTTVLGGTLIREYSNPTPGVASNIAV
FT                   IEFEDAHIELLTPTSPESPIARFLKQRGKGVHHIAYRVDDLDQAILEAKQRGITFLEDT
FT                   YRQTPLGRRLIYMDPRHSHGVITELCDYPEN"
FT   gene            573940..575364
FT                   /locus_tag="Exig_0538"
FT   CDS_pept        573940..575364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0538"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: bcl:ABC3063
FT                   metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60019"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJI9"
FT                   /protein_id="ACB60019.1"
FT                   /translation="MKKTFASLIVSALILSSTSHFVAADDLSEQKAKNEQKQQENAKTQ
FT                   KNLESSVNQEGQKISKTQQEVNRLDEALNEKMFAVETKDRQIKATEAEIVELGKQIEKY
FT                   KAKLKRQEKLLGDRLRVMQENDGNSIKWEEVIFGSKDVGDLVSRVLAGKSISQQDDKMI
FT                   TDYQNTQKKLAAAQQELKDKKAKLVTEKQELKRQQAELEQQLKERNKRLKELRKQKKKF
FT                   ETQLMDAKEVQQILIAQEQAIAAEKAAREREARIEKERQAQAAREAKARAEAQAAQAAA
FT                   EQQAAEAAAAKAAAKAEQKSSTPATSTKQSTPSVTVPKAAPAPTPEPAAPTPAPSSSSM
FT                   FIHPTSGSITQGYGSASGSNGYSFHNGIDFGAPVGTPIVAAATGTVITASSGGPYGNHV
FT                   MIAHQLNGKTYTTVYAHMSSLNAHAGQRVSQGQQIGALGSTGNSTGPHLHFEIHVGGYS
FT                   YSASGPANSVNPMSML"
FT   sig_peptide     573940..574014
FT                   /locus_tag="Exig_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            575574..576860
FT                   /locus_tag="Exig_0539"
FT   CDS_pept        575574..576860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0539"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: oih:OB2491 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60020"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ0"
FT                   /protein_id="ACB60020.1"
FT                   /translation="MLKKLLSTVLLGVLLVSTAPTSGHAATIKEKKSQNATEQRRLEKA
FT                   IKNQEAKISAEQREINKIDAAINENIFRISEKNKQIKQLNLQIEDLEAEIVRYEIMLTR
FT                   QEELLGDRLRVLQENDGNSIKWEEVIFGSKDLGDLFSRVMAGKKIAEQDDKMISAYLET
FT                   QEKLAEMKKNLITKKEERVQEKKSLLIQKKQLKQQMKERSATLKKLRKGKTKFTTKLLS
FT                   AKELQATLEAQERAIAAAKAAAKAAAEKAAAEKAAAEKAAKAAKEAAKSKPESSESTVV
FT                   PTPVSSGPTGSAKFVRPASGGVSQGFGPASGANGYTFHNGVDFSGPVGSPIRAAASGTV
FT                   ITAGSGGPYGNHVMISHFLDGQVYTTVYGHMNSLSVSAGQTVTQGQTLGTLGSTGNSTG
FT                   PHLHFELHIGGYQYSASGPANTVNPLGYL"
FT   sig_peptide     575574..575651
FT                   /locus_tag="Exig_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 26"
FT   misc_binding    576921..577031
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 67.65"
FT   gene            577149..577958
FT                   /locus_tag="Exig_0540"
FT   CDS_pept        577149..577958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0540"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: cbe:Cbei_4490 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM: protein of
FT                   unknown function UPF0031; Phosphomethylpyrimidine kinase
FT                   type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60021"
FT                   /db_xref="GOA:B1YJJ1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ1"
FT                   /protein_id="ACB60021.1"
FT                   /translation="MKHVLTIAGSDSGGGAGIQADLKTFSALGVYGMSVITAITAQNTL
FT                   GVQAVEDVSPELVEAQLTSIFSDIRVDAVKIGMVSNQDTIQVIARQLEKYSLPIVLDPV
FT                   MVAKGGHALLQPNAEQALLEQLLPLATLVTPNIPEIERMIGGTVHSLADMKQAAVKLTE
FT                   RRAGAVLLKGGHLEGQDATDLLYTDERYVVFEQERIASRHTHGTGCTLSAAIAGNLALG
FT                   HSLEDSIRYAKRYVTEAIRHGFALGHGIGPTHHFHELWRDTHVTTHP"
FT   gene            577939..578709
FT                   /locus_tag="Exig_0541"
FT   CDS_pept        577939..578709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0541"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG:
FT                   aoe:Clos_2694 hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60022"
FT                   /db_xref="GOA:B1YJJ2"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJJ2"
FT                   /protein_id="ACB60022.1"
FT                   /translation="MLRRIHDKKPLIHHLTNTVTINDCANMTLALGGSPVMAEDLLEVE
FT                   EMVGLADAVVINTGTINPDMRKAQLLAGKTANRLGKPVILDPVGAGATTLRTDFMKQLM
FT                   EEITFTVIKGNASEIKTLLGQAARTKGVDVAEGESLDLQSVHAFASQTKQVIVVTGPVD
FT                   FVTDGVRQHHLDVGTKRLGQVTGTGCMTASLIATFLGAGYGRFDAAVFGTYAMGKAGET
FT                   AGNRPGIGSFRTGLFDAVSLMTEESLPEVQMNGQ"
FT   sig_peptide     577939..578055
FT                   /locus_tag="Exig_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.970 at
FT                   residue 39"
FT   gene            578699..579337
FT                   /locus_tag="Exig_0542"
FT   CDS_pept        578699..579337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0542"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: amt:Amet_1247 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60023"
FT                   /db_xref="GOA:B1YJJ3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ3"
FT                   /protein_id="ACB60023.1"
FT                   /translation="MDSEYLIYAVTDRRLHPHLPLEDAVEATIKGGATIVQLREKEMSG
FT                   KNFLESAVVLKDLTASYNIPLIINDRIDIALLVEAGLHIGQDDIPLTEARRLLPTATIG
FT                   VSVSTVEQAVAAEQDGADYLGVGSLFPTATKQDATFMSRVTLEQIRKAVRIPLVGIGGI
FT                   SETNVSLLDSLVDGYAVVSALFANPEIERTTKKFKQTVEQVRQSVSDRV"
FT   gene            579358..579795
FT                   /locus_tag="Exig_0543"
FT   CDS_pept        579358..579795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60024"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ4"
FT                   /protein_id="ACB60024.1"
FT                   /translation="MKWQSVRFRGRWIRYKIEPQIIRVENRGKYHLGAALFPFPNRYSY
FT                   QLAVLLKNKYQQQYKRSLLIQTSSIATEIWGHTHLDIFYRMLLPLPLPRFLRERYQERL
FT                   KSTGVIDIGVRAVDSNRIVWDIGNFLGGWFFYAVSRRNRDK"
FT   gene            579956..580321
FT                   /locus_tag="Exig_0544"
FT   CDS_pept        579956..580321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0544"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: gka:GK0584
FT                   cadmium efflux system accessory protein (cadmium-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60025"
FT                   /db_xref="GOA:B1YJJ5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ5"
FT                   /protein_id="ACB60025.1"
FT                   /translation="MDAPRCETIAIDQVRAQEIEQVVDTIPTTDIGKLFKVLSDATRLR
FT                   IAYALTVEEELCVCDVSASVDCSIATASHHLRTLLKQGLVKYRKEGKVVYYSLDDHHIS
FT                   SLVHLAMEHVNEGKASS"
FT   gene            complement(580357..581001)
FT                   /locus_tag="Exig_0545"
FT   CDS_pept        complement(580357..581001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bwe:BcerKBAB4_4865 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60026"
FT                   /db_xref="GOA:B1YJJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ6"
FT                   /protein_id="ACB60026.1"
FT                   /translation="MNQLWRHRIILILVVSLFASIPLLYALSGYRTISKLTAEMHTQDI
FT                   PMIKQVDQLIEHNRDRANAVRGLLLYEDDRYIEQYYFSTSKVHDLRRLLNSSNQTPGAV
FT                   KDLLSRNNTWEEEIQEVFTVYETDHPQRAKKLAKQTTQTTQTILEDLSQIKDKLYRDLE
FT                   QKLELTTEMTAEYKRMCFSLSILAFLLIATTIILFHRSKPILENKTNTYRP"
FT   sig_peptide     complement(580921..581001)
FT                   /locus_tag="Exig_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.885 at
FT                   residue 27"
FT   gene            complement(581164..582033)
FT                   /locus_tag="Exig_0546"
FT   CDS_pept        complement(581164..582033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0546"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   cno:NT01CX_1578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60027"
FT                   /db_xref="GOA:B1YJJ7"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ7"
FT                   /protein_id="ACB60027.1"
FT                   /translation="MKTKQPAKKKRTEKIGFLLIGTLLYSLYISLLLSPNDIGSGGIMG
FT                   ITLIVQELFHTPIGLTQLVLNIPLFLLGFRFLRKRFMFLSGLIVLASSFLIDWIPTQIV
FT                   PESLNDPLVASIFAGLVSGLAMALIFFGGASTGGLDILGKFFYTRFHNWPLPRIFLMQD
FT                   LVIYVLVWFVFDLKHVMYALIMSFVRAKALQTVYSFYSASKQCIIICEKADEINDVITK
FT                   ELGRGVTILDARGGYSKRTKKMVYVVVQNNEILKLQEIVSSVESNAFVTFSEIHTVFGN
FT                   YKEHSYSF"
FT   gene            582173..582781
FT                   /locus_tag="Exig_0547"
FT   CDS_pept        582173..582781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60028"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ8"
FT                   /protein_id="ACB60028.1"
FT                   /translation="MKKIILVILCIGLGLSAGSWFVLNLQQPPEEERFKDGQVIARHVG
FT                   ISVSNTAAIEELVKQLPFSEALTAVSIEGTSVKMTYEPAGKEQADWTGSNEKTIRSAGT
FT                   SFLESRLSKLIMHHTLALFLSVSDLSELQIRYTDTVSDVTFETDRQRIEDYTPRDIERA
FT                   TSSATRFNRVVVEDYVLVESRRSVFFKKFEDALQILPSN"
FT   sig_peptide     582173..582247
FT                   /locus_tag="Exig_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.535 at
FT                   residue 25"
FT   gene            582965..583801
FT                   /locus_tag="Exig_0548"
FT   CDS_pept        582965..583801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0548"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   bwe:BcerKBAB4_1223 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60029"
FT                   /db_xref="GOA:B1YJJ9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJJ9"
FT                   /protein_id="ACB60029.1"
FT                   /translation="MNEVEALEGLRKKAVKSTQMLRMRPLEYLVRAMLAGVFIGFAIIF
FT                   TLKAINGLYLNESPVTTLVGGLTFGVALVLIVYGGAELFTGNTMYFTTSTMRGFTSKMD
FT                   TLKVWTLCFIGNGLGGLAFALLFSQTGIIQELGMENWLFAVSETKIHHTTWEIFTRAIF
FT                   CNWMVCLAIFIPKNMKNELAQIMMMMILVAVFFASGFDHVIANMALFSLALVVPHPEAI
FT                   SFAGAIHNLVPALLGNIIGGALFMGMVYTWLNKSKLEVEQSNEQAATINIASKQKA"
FT   gene            583923..585484
FT                   /locus_tag="Exig_0549"
FT                   /note="ribosomal slippage"
FT   CDS_pept        join(583923..584567,584567..585484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Exig_0549"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   cpr:CPR_2608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60030"
FT                   /db_xref="GOA:B1YJK0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK0"
FT                   /protein_id="ACB60030.1"
FT                   /translation="MSKSKFSPDEKLRIIRMCEDRMDSIKSIASLFELSVTTLNRWRAK
FT                   YRTYGSSSLRDRTEWTGYPEELKMEAVRAVLTQEESLTSATVRFNISSLSVLARWIRKY
FT                   TSHNTQGKPLKERSIMTKGRTTTFEERVQAVMDCIQNGKDYQNIMKTHRVSYQQIYSWV
FT                   RKFEKDGMDALMDRRGRQKPVAELTDTERFALELKRLEKENERLRMENDFLKKVRGDRE
FT                   EVTLSQIRLQDKYEAIQSSVEQFGYPIIALCHLADVSRAAYYKWLRRIGIPKAHEAENM
FT                   KIIEEMNQIHLSVKGIYGYRRMKLNLKRRFGRNVNAKRVRRLMHIASIHCVIRRKRPSY
FT                   IRNRPQQIAENILNRDFNAAGPNQKWVTDVTELKYGSSQKAYLSAILDLYDGSIRAFVL
FT                   GHSNNNQLVFDTFELALQGASGSRPLLHSDRGFQYTSHAFRHMTRVAGITQSMSWVGKC
FT                   IDNGPMESFWDALKCESYYLHKFAEFDELQLAIQKYIHFYNEERYQQRLNGLAPLEYRV
FT                   QAV"
FT   gene            complement(585566..585988)
FT                   /locus_tag="Exig_0550"
FT   CDS_pept        complement(585566..585988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0550"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   mca:MCA0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60031"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK1"
FT                   /protein_id="ACB60031.1"
FT                   /translation="MMEFTPGDFKSAYTYFHRQALNAVGNAKAQEDLLIQGELGLARLT
FT                   TDLASEDGSDVEREAELVLYFQLKQLLEMLRALYNKRFEMQPEQEQLLLTAVLYFTSPV
FT                   DALPDENILGLFDDAQIVEAIYEELAADVDRFQHLE"
FT   gene            586084..587307
FT                   /locus_tag="Exig_0551"
FT   CDS_pept        586084..587307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0551"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   bcz:BCZK0301 aminopeptidase; peptidase_M29"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60032"
FT                   /db_xref="GOA:B1YJK2"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK2"
FT                   /protein_id="ACB60032.1"
FT                   /translation="MPTQEQLKKYAALAVRTGINLQAGQQLEIRAGIENAPLVREITRV
FT                   AYEVGASNVYVQWSDDEMTKIRYFDAPEDSFDAFPDWLKARFDQLAEEKTAFLSVVSED
FT                   PDLLNGVESSRIARANKAAGVALANWRKFVMSDNVSWCVIAAPSDAWAAKVFPDSEHAV
FT                   EDLWEAILKATRVDQDNPVAAWEQHDANLRTKATFLTEKKYNKLHYSAPGTELTIELPE
FT                   RHVWLGGGGPNADGVDFIANLPTEEVFTLPKKTGVNGYVSSTKPLSYSGNLIDEFTLWF
FT                   EDGKIVKAEAKQGQAALDELISLDEGARYLGEVALVPHHSPISDSGILFYNTLFDENAS
FT                   CHLAIGRAYSTCLENGPSLSNEELAAQGANDSMTHVDFMIGSGQMSIDGELSDGTREPL
FT                   MRDGNWAI"
FT   gene            complement(587404..588318)
FT                   /locus_tag="Exig_0552"
FT   CDS_pept        complement(587404..588318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0552"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bcl:ABC3971
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60033"
FT                   /db_xref="GOA:B1YJK3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJK3"
FT                   /protein_id="ACB60033.1"
FT                   /translation="MMTEQLLAGLYEGIAKEAVLINEPLKNHTYTKMGGLADLFLIPST
FT                   YEETAFAVRYAYEHDLPLTMLGNGSNLVVRDGGIRGIVLSFEKLTDISVEGHELIAQSG
FT                   AAIIQASRIAYDHALSGLEFACGIPGTIGGALIMNAGAYGGEVKDCLHSATVLTRKGEL
FT                   LNISHEELELGYRTSCFSKKEYIILEGRFSLTEGDPALIKEMMDDLTHKRETKQPLEYP
FT                   SCGSVFKRPEGYFAGKLIQDSGLQGARIGGAEVSQKHAGFIVNIKDATATDYISLIRHV
FT                   QETVQEKFGILLEPEVKIIGEEA"
FT   gene            588579..589094
FT                   /locus_tag="Exig_0553"
FT   CDS_pept        588579..589094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0553"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   btl:BALH_3950 ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60034"
FT                   /db_xref="GOA:B1YJK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK4"
FT                   /protein_id="ACB60034.1"
FT                   /translation="MESERLEMRPFVEEDFTFYKTLVQNEQVMRYINGGVVLDEDKARS
FT                   WFERQLDRYKDERQTGFLLLIKKETNEPIGFAGLLLQTVDGIEELEVGYWLTPIHWKVG
FT                   YGREAAKRLMREAFERGHDRLISIIHPENHSSQNVARANGLQWEKDTLFNGIPVVIYSC
FT                   RLSRLFRG"
FT   gene            589124..589591
FT                   /locus_tag="Exig_0554"
FT   CDS_pept        589124..589591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0554"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vvu:VV1_0730 ElaA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60035"
FT                   /db_xref="GOA:B1YJK5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK5"
FT                   /protein_id="ACB60035.1"
FT                   /translation="MYQTKWMGFNELDNTSLYQLLKLRTDIFVVEQNCPYPELDNRDQD
FT                   ALHGLAYDGERLIGCLRILPRKSSGAVAIGRVAVQTDYRSNGVARKLLNEAITHIEKQG
FT                   ESLIDLQAQAHLKRFYGSFGFKETSDVYLEDGIPHLDMQMNLREDSKRLQE"
FT   gene            589648..590007
FT                   /locus_tag="Exig_0555"
FT   CDS_pept        589648..590007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60036"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK6"
FT                   /protein_id="ACB60036.1"
FT                   /translation="MKKVLVILALSLIGVLSFAVGISYAELQSSQRSAEEQLTKMLQTQ
FT                   HNIDKTSLLEVKASFSIQHRQVIKVRLRGEPAITYEFIQPKQQIEYSGSVGTSVEKTGK
FT                   QDEAFRNSHLQLSKK"
FT   sig_peptide     589648..589725
FT                   /locus_tag="Exig_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 26"
FT   gene            590125..591057
FT                   /locus_tag="Exig_0556"
FT   CDS_pept        590125..591057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60037"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK7"
FT                   /protein_id="ACB60037.1"
FT                   /translation="MKRFVKNEAIAPALNAFLTLENEAFQTYNQLLTAQERQALNFVGR
FT                   AVALQSDKHLALALETKQPLIEMDRLLMKLTEIEQGALLFRQLLASGLDLNQLITVEGH
FT                   RSLVRQPLSFPVGLYTVYDHVLFQLAVDSGLDLNYTTTLQRSDRFLETDEINTLDIVLL
FT                   LTHEQAPDEQSLPLFQHPATVGLAERLQRAKFESLQSIIENTRYVTTFRYAKHFPLFYA
FT                   IVGRQTEQFPKMLDAVLMEQNQEEILKDALLAFHNHQPGLATSMGTDYYESLFVIGDHL
FT                   KRQAGIDFNTLDDQYILSEYSEIVQRLRS"
FT   gene            complement(591046..591888)
FT                   /locus_tag="Exig_0557"
FT   CDS_pept        complement(591046..591888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3901 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60038"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK8"
FT                   /protein_id="ACB60038.1"
FT                   /translation="MLNILSYDQLSHPQRRLVHRLLRTTPSSPSSFSYPPIEHQQWTIW
FT                   HEDHVQATLGFHVFEHTVQLLNASYTDLQAFQILAHHVHLQALSFSPRHIDVQIIPPND
FT                   FGFITTWNALGYSLSCEQFRLIGLTRGRPVSVQFKPLSLRNRQLFLTIRNDAIRYSDFL
FT                   FPYDAIHLDYLVDQGVLPYLVYDKNTVVGTLLIEQHKQVVRLLEITCLPQLKNQGYGRR
FT                   ILDTFQMKLHKKNILSFEVYCFSTHQEALRLYQPTTFCDIQIFSNWHRYSCEPVSLTT"
FT   gene            591999..592262
FT                   /locus_tag="Exig_0558"
FT   CDS_pept        591999..592262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60039"
FT                   /db_xref="GOA:B1YJK9"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJK9"
FT                   /protein_id="ACB60039.1"
FT                   /translation="MTRLLMATGLFLILIGMNPVHAQEIEKKETTVRQSTTYGSYGTMD
FT                   EIITDQKEPTYDGFDSPNDMAFLFACIALLATVGLGIVNATD"
FT   sig_peptide     591999..592067
FT                   /locus_tag="Exig_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(592330..593241)
FT                   /locus_tag="Exig_0559"
FT   CDS_pept        complement(592330..593241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60040"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL0"
FT                   /protein_id="ACB60040.1"
FT                   /translation="MRIRKLRLLLEQYGDTTLRDIIVEIYRQLPKQVIEEKDLDLMLSQ
FT                   FAKYKGLQKEQDQPTVEQAIEQTEQFIQLAYDLQYLEPNELVSVREQKNWYVAAKRLLK
FT                   HLRHYIGRKNGTRVAFEEFFFLLSSAAGEEPLFLSNDPFRLIKVTQVELFEELVGYYKL
FT                   DASDQTWMQRAIYTAVKVPIDVDTERSDLFLAVLTHCTDVSEREAYVALLNTHAKKLRA
FT                   KVRVDADMLVLYQEIRFAELHALIALRELERAETMLFTEYIPYFSHRSTPFRYYLSLLE
FT                   QAGLKDEHDRIERVGRRKHIHF"
FT   gene            593429..594175
FT                   /locus_tag="Exig_0560"
FT   CDS_pept        593429..594175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0560"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bsu:BSU38110
FT                   FMN-containing NADPH-linked nitro/flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60041"
FT                   /db_xref="GOA:B1YJL1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL1"
FT                   /protein_id="ACB60041.1"
FT                   /translation="MNETIEHLLNHRSIRKFKPHQLDQETVETLVRSAQSASTSSYQQA
FT                   YAIIGVEDEALKRQLVDVASGQSYVAENSYFFVFCIDYHKHILAAKIASGSVDRTVETT
FT                   EALIVGAVDAGLAAQNLVIAAESLGYGTVYIGSLRNDAAKVSELLGLPDHVVPLFGVAV
FT                   GIPDQQPGKKPRLPMDAVFHRNTYTNDDTMRELLSQYEEETSTYYGERTDGRRTEGWVY
FT                   QMAASMREPKRTYMHDFLQEKHLARD"
FT   gene            594190..595407
FT                   /locus_tag="Exig_0561"
FT   CDS_pept        594190..595407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0561"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   bwe:BcerKBAB4_1838 cell envelope-related transcriptional
FT                   attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60042"
FT                   /db_xref="GOA:B1YJL2"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL2"
FT                   /protein_id="ACB60042.1"
FT                   /translation="MEEFHSGRSRLERRRQEELRESEKMEQGKASRESMDQNHEREQSA
FT                   SQRYLDEPSERTPARKEVSRPSAKRLQAGAGIIVRSGTRLASMTLNRFSQRRASRSNRT
FT                   KEPVREAEAEQRLKKQPVPKKKRRFKSKLFGLLLLVLIAAVLFSSQPFTFLLIGSDARP
FT                   GESLRGSRSDSLSVMQFVPLSRTIQLTSIPRDTYTPIACENGKKDKITHAFAYGGEDCT
FT                   SSAVSGLLDQDIDSKIVISFDSFIGLIDEIGGVDLVSTGTFSEQDASGKANQYSFQKGK
FT                   EYHMDGAMALAYSRHRKTDTDVARANRQSEVIQAVATHLMKPTGWSSIPGAHRYMKEEM
FT                   NLDVSVRQMMTAGLSLALFSKREHLEVEGVSERMNGIFYDFPKEKELKDLRAKLDTTFY
FT                   GTLKND"
FT   gene            595487..596197
FT                   /locus_tag="Exig_0562"
FT   CDS_pept        595487..596197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0562"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: bpu:BPUM_1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60043"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL3"
FT                   /protein_id="ACB60043.1"
FT                   /translation="MKVLVVGASGTIGARVVKSLAKGHQVTVIVRHQHLVERFEKLGVK
FT                   AHYVDIETELEKVIEQGVSGQDAVICAATAGVDGEPTEIELLDRTVALKTIDAAKKARV
FT                   RHFVLLSAYGADRPNQFKKEMYPFYAAKNAAEEQIEHSGLTYTIICPVNIVDGEGRGLI
FT                   EADEDLKDVKEATISETDVASILVAAVDNRALFNRRLEVKEGKTTLNEALGGDEAVGSV
FT                   KDNRQVKKQLPRYN"
FT   gene            596375..596920
FT                   /locus_tag="Exig_0563"
FT   CDS_pept        596375..596920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0563"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: bwe:BcerKBAB4_0525 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60044"
FT                   /db_xref="GOA:B1YJL4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL4"
FT                   /protein_id="ACB60044.1"
FT                   /translation="MKKYVVYLMAAIIISGIAYTSYSAYQTKQDQQQMKAKQQAEGGLE
FT                   TGMKAPDLEIEQDGRMIHLSDLTDQLIVINFWATWCPPCQQEIPELNAFAKSTSIPVYG
FT                   INVTTAERRLSDVKQFLKKTPITYSVLYDTKGQSEKTYQLVAMPATYIIDQTGTIVGKH
FT                   VGPVTQEMLKEMVRKIGG"
FT   sig_peptide     596375..596437
FT                   /locus_tag="Exig_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.432 at
FT                   residue 21"
FT   gene            596925..597374
FT                   /locus_tag="Exig_0564"
FT   CDS_pept        596925..597374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60045"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL5"
FT                   /protein_id="ACB60045.1"
FT                   /translation="MELYCAVCTYRQIIEIGQQEEWKGFPSVLTYGMESYASALPFLFV
FT                   PPYQEPLVSRQKIDDRIRAELIRTYHAHIEEIEDGWVPHQYDVFQCPTCQQISTRFWCA
FT                   LFLKGAIIEPVHRCEQDNSVLVRLSLDELTQTPCPSCAEQTLQIR"
FT   gene            complement(597462..597671)
FT                   /locus_tag="Exig_0565"
FT   CDS_pept        complement(597462..597671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60046"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL6"
FT                   /protein_id="ACB60046.1"
FT                   /translation="MIKRGTLERLDGKYAVLLWENGSSFIPRRYLPTEARLGDTILFDG
FT                   SNYSIDATNSTQSSFQTFSFRQMG"
FT   gene            complement(597929..599302)
FT                   /locus_tag="Exig_0566"
FT   CDS_pept        complement(597929..599302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0566"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="PFAM: Citrate transporter; Na+/H+ antiporter NhaC;
FT                   KEGG: bcl:ABC1725 Na+:H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60047"
FT                   /db_xref="GOA:B1YJL7"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL7"
FT                   /protein_id="ACB60047.1"
FT                   /translation="MRMSFRESAAVLGISIIILLSVIFGAKAEPHLAILSSLIFVVAYA
FT                   AVRGFRYEQLEQHMINGIREAIKPILIMLLVGMTIAVWMMSGAVPTLLHYGLETLSATW
FT                   FAPSALIITMIVSTFTGSSFTTIGTVGVALMGIAVALGVNPALAAGAIISGACFGDKMS
FT                   PLSDTTNFAPGIINVSVFDHIRFMMGTTIPAITITFILFFIFGRGDGSIDSQTIGSTQQ
FT                   ELTRLFNLSPWTLLSPLLVMILALRKTPVVPTLIVGVLSGLLLTGLTQGNWNIGQWMSV
FT                   IQNGLKIETANDTVASIVSKGGLQSMMWSVSLVMLALAFGGVLRGIGVIDVIIENTVSK
FT                   LKRDGSIISSAALASIGVNFMAGEQYLSILLPGQAFKQIFKDRSIDPRFLSRALEDGGT
FT                   LVNPLIPWGVSGAFFASTLGVPVTAYVPFAFFLLLSPFFTFVFAFTRPTKQAAKDLAA"
FT   sig_peptide     complement(599216..599302)
FT                   /locus_tag="Exig_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.837 at
FT                   residue 29"
FT   gene            599548..599643
FT                   /locus_tag="Exig_0567"
FT   CDS_pept        599548..599643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60048"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJL8"
FT                   /protein_id="ACB60048.1"
FT                   /translation="MFTAIFVVVIALMGASVYGIDHMVAQRAEKR"
FT   gene            599805..600836
FT                   /locus_tag="Exig_0568"
FT   CDS_pept        599805..600836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0568"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: btl:BALH_3747
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60049"
FT                   /db_xref="GOA:B1YJL9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJL9"
FT                   /protein_id="ACB60049.1"
FT                   /translation="MKCTIVGATGYAAIELIRLIELHPHLEIVSLISDSQTNQEMNDLY
FT                   SFMNNKQFPVLTAFSLEQIEAVETDLLFLATPSGISTKYLKQLDDWKGTVIDLSGDLRL
FT                   EKSLYEKWYPHESVDTVLQKKATYGLTEWKREQIKDSRLIANPGCYATAVLLGLLPLLE
FT                   ERVIDPSQIIIHASSGLSGAGKTLTEQTHHVRSSENVRLYKMNQHQHIPEIESIAEDIT
FT                   GQQITVSLATYLVPLNRGIMATMTLQPLVEKTEAEWRTWFIEKYKQESFIRVGQTDPEI
FT                   KSAAGSNYCDISVYLDTRTGRLTVVSVLDNMQKGAAGQAIQNANVIGGYPETLGLTQQP
FT                   FFI"
FT   gene            600845..602068
FT                   /locus_tag="Exig_0569"
FT   CDS_pept        600845..602068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0569"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: bca:BCE_4202 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60050"
FT                   /db_xref="GOA:B1YJM0"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM0"
FT                   /protein_id="ACB60050.1"
FT                   /translation="MNMLNIQLTSPLTVTTPKGFKATGVHVGLRRKRKDLALLLCEAGA
FT                   DAAAVYTTNQVQAAPITVTKEAISKSGGKVHAVLVNSGNANACTGQLGLEHAYASQQAI
FT                   ADQFQLAQEHVVIASTGIIGQPLAIDTLLQGIEQLQPDEGEEQADDFALAILTTDTGTK
FT                   TAGRQIWLDGELVSVCGVAKGSGMIHPNMATMLGFLTTDASIPSPLLQDILKSAVNRTF
FT                   NCITVDGDSSTNDMVMILASGAAQTQPLQPETDEIEQFQQAVEEVCQDLAKQIARDGEG
FT                   ATKLIEVNVHGTANEWTARKIAKQIVGSSLVKTAIFGEDANWGRIIAAVGSIDEPIDVG
FT                   QIDIRIGSQWVLRHSMPILFDESLASRELAQDVVEIEVNLNQGPASGHAFGCDLTYDYI
FT                   KINASYRT"
FT   gene            602065..602838
FT                   /locus_tag="Exig_0570"
FT   CDS_pept        602065..602838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0570"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: gtn:GTNG_0672 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60051"
FT                   /db_xref="GOA:B1YJM1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM1"
FT                   /protein_id="ACB60051.1"
FT                   /translation="MTKRKLIKLGGSVFEQLDPRYYEEWGQWLAEKNELIILHGGGPAL
FT                   SAYCRDMNIKAEFNNGIRVTTEQVLLGAERVLGGEVQSKIVYELNENGLPAIGLTGIDG
FT                   ASIRGEQQPAFGAVGEVTQINPKLFTTLMASGFLPVVTSLITGTEGTLNCNGDTCAIAV
FT                   AKGLAVDEFELLTDVSGVRLNGTFQSEVTVAELEEGIESTEINGGMIPKVEAVIEAVRQ
FT                   GIHQVKIRSGHDVTSQGTRIKEETNERFTTDVFTS"
FT   gene            602804..603946
FT                   /locus_tag="Exig_0571"
FT   CDS_pept        602804..603946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0571"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bwe:BcerKBAB4_3962 acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60052"
FT                   /db_xref="GOA:B1YJM2"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM2"
FT                   /protein_id="ACB60052.1"
FT                   /translation="MSALLPTYLRHDIELVAGNGSFVQDKAGKNYLDFVMGIAVCNTGH
FT                   RHPHVEQALQEQLQKLWHTSNLFMSSKQERVAAMLTENSHLSHVFFCNSGTEANEGAFK
FT                   LIRKWTQKKEILTFSQSFHGRTFAMMGATGQDKIKAGFGEMVPDFKHLTFNDFDSLEMI
FT                   TNQTAAVWLEVIQGEGGVIVAENAWLEALMEKARQYDVKVVIDEVQTGIGRTGSRFAFE
FT                   QTPLKPDIITVAKGLGSGFPVGAIITTPEATAVFTPGTHGSTFGGNPLAMAAAEATLDV
FT                   LLNEQQMKQVQQKGLYLMQQLKQLPETMVVDVRGRGLMIGIEFHEPVSSLITALQQAGM
FT                   LVVSAGPNVIRLLPSLCVTEQELDLAVGKIKTVCQQEVMM"
FT   gene            603943..604998
FT                   /locus_tag="Exig_0572"
FT   CDS_pept        603943..604998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0572"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: bha:BH2896
FT                   carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60053"
FT                   /db_xref="GOA:B1YJM3"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM3"
FT                   /protein_id="ACB60053.1"
FT                   /translation="MKGTGALTLADGHVYPGELIGSSSVQGEVVFFTGMTGYQEVLTDP
FT                   SYRGQIIVFTYPLIGQYGISEQDSESRQIQVSGVVVQTLANNGLRSDLADWLAASDIPV
FT                   LTQVDTRALVHHLRNQGDQIGILTCGTSSVQEQSNLIATVSIKQPEVYPTDYEAGHIVC
FT                   LDYGVKKSMIEALQERQMKVTVVPFDTPKTVIDELKPDGLLFSNGPGDPSQLDHLIPEI
FT                   NKLALAYPTLGICMGHQLIAKAFGCRIEKQHHGHRGANHPVRQLKTGRVFMTSQNHGYV
FT                   VQADSVQNSELNVAYEHINDGSIEGLLHPTHPILTVQFHPEAHPGPLEAMVIFDQFVAG
FT                   ILKQEVAYAGS"
FT   gene            604985..608017
FT                   /locus_tag="Exig_0573"
FT   CDS_pept        604985..608017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0573"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; protein of unknown function
FT                   DUF201; Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain oligomerisation;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: gtn:GTNG_0675 carbamoylphosphate synthetase heavy
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60054"
FT                   /db_xref="GOA:B1YJM4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM4"
FT                   /protein_id="ACB60054.1"
FT                   /translation="MQEVKKVLVIGSGPIVIGQAAEFDYSGTQACQTLREAGCEVMLMN
FT                   SNPATIMTDPSTADHIYIEAMTLEKATAIIKRERPTHLLATVGGQTALNLALSLEEAGV
FT                   LDQYQVKLLGTSLETIRDGEDRERFKQRMLELDQPLPISQTIETLEELEGFMEKAGVPL
FT                   VVRPAFTLGGTGGGIAQTKEEARKLAANGLQASPISQCLVEASIAGYKEVEYEVMRDAF
FT                   DTTIIVCNMENIDPVGVHTGDSVVFAPIQSISDKMNQILRTASREIVSALGVVGGCNIQ
FT                   FAIHPTEQTYYVIEVNPRVSRSSALASKATGYPIAKLATRLALGERLDDCINPVTKETM
FT                   ASFEPVLDYVTAKVPCFPFDLFPGSDRSLGTQMKATGESMAMGKTLEEALQKAWRGAGI
FT                   EQAPLYPNWMKQADTEVLWQEVNQITDRRLLAMLALLDRKAATHEELAEKTQIQSLFLT
FT                   TLETLILMQESLDLESKESLQQAKGFGFTDQQIAQITDVPLEVVQQQRNTFLIQPSFQM
FT                   IDTCGAEFSSLTPYFYGSWSGRTEVTPSSRKKVAVLGAGPIRIGQGIEFDYCSVHAVRA
FT                   LQKAGYETIMINNNPETVSTDFEVADRLYVEPLTIEDVVHVLEAEQCRQVLVQFGGQTA
FT                   ITLAAELEELGYQLLGTTADTIDEMEDRDRFYQFLDRLQIDRILGQEVSNEEELTAIVK
FT                   ELGYPLMIRPSYVIGGKGMHRLTTATDLEKLLPEMVFPILVDAYIEGHEFEVDCISDKT
FT                   TTYVPVIMEQIEAAGVHSGDSTMILPPVSALASLQDEIEQIAQTIGQHLDYQGAFNIQF
FT                   VVKDQTVYVLEINPRASRTLPIVSKVTGQPLLEWAVQAAIGMKVEALPANRLTLPFHAV
FT                   KTPVFSTLKLRGVDPMTGPVMRSTGETLQWTEAGLAKERFVFDQTTKTAMAKRTLRICG
FT                   AGTDAWSEGAAVQPDTEFDTCLVFFSKSESEREQREKALAQGAIVITEEHLAQYFESVQ
FT                   TIPMCTVKPLSEWTTQKERIQ"
FT   gene            608014..608952
FT                   /locus_tag="Exig_0574"
FT   CDS_pept        608014..608952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0574"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: bpu:BPUM_1048 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60055"
FT                   /db_xref="GOA:B1YJM5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM5"
FT                   /protein_id="ACB60055.1"
FT                   /translation="MTTTQRLKHLLTLEELTAEGLTDLLELAKDVKASPATYAQTLAGK
FT                   KVALLFEKASTRTRISFEVGVVELGGYPVVLNGSDMQIGRGESLSDTIQVMSRYVDALM
FT                   IRTFAHETVETLAAHGTIPIINGLTDLHHPCQVLADLLTIEEHFGQRKGKILAYIGDGN
FT                   NMTHSLLLGGALSGMTVRICSPAAYAPDQTIIDQAKMLAQQSGGQIEQYTDPVQAVAGA
FT                   DVIYSDVFASMGQEEESEARLKAFEGYQVNQTLLSSAATDVIFLHCLPAHRGEEVTAEV
FT                   IDGSHSLVFDQAENRLHAQKALMIELIGVMD"
FT   gene            complement(609005..609814)
FT                   /locus_tag="Exig_0575"
FT   CDS_pept        complement(609005..609814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0575"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   oih:OB0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60056"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM6"
FT                   /protein_id="ACB60056.1"
FT                   /translation="MIQMKMPGVMVYQSTLMKTTSTLIETPDCLIVVDPGWLPDEIATI
FT                   RRDVEIIRHDRPLYIVYTHAHFDHILGAYAFKDAIAIASRRFVDVDRTAALEEVQNFND
FT                   EYYIESPVLFPDITHVIEESETTLTIGKTKLIFFLTPGHESTHLSFVVMPLHLLVCGDY
FT                   ASDVEIPLIEHDSSEYLTTLELLESFIYEYEVKLLIPGHGHICDVRTEMIERLHLSYDY
FT                   ILALRAHKESDWSPSWQRTSFMGRLHEKNKRQITKEQTEQLARRQYD"
FT   gene            complement(609985..610058)
FT                   /locus_tag="Exig_R0059"
FT                   /note="tRNA-Gly6"
FT   tRNA            complement(609985..610058)
FT                   /locus_tag="Exig_R0059"
FT                   /product="tRNA-Gly"
FT   gene            610264..610776
FT                   /locus_tag="Exig_0576"
FT   CDS_pept        610264..610776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60057"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM7"
FT                   /protein_id="ACB60057.1"
FT                   /translation="MGKGWMATCHHQIDRYRFTTGEWFLNASLLAFSIEQDADMLPDVL
FT                   PNELKIPLVSERMKQILERLTPFSVQCLRVQLKTRTGLINYYLINILAVRRVEHLHKTE
FT                   IFRTLRKKQVYFMTERIVSTSLGPHHILRDERTERIFLSDTLARCFQQLAVTGIHFDEI
FT                   NRMEEII"
FT   gene            610773..611192
FT                   /locus_tag="Exig_0577"
FT   CDS_pept        610773..611192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60058"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM8"
FT                   /protein_id="ACB60058.1"
FT                   /translation="MKQYTVDNWITLQYPKTFEYQEEETFVSFYSTEENAMGTLQLSIY
FT                   ESDTEELTPFEAAEQEINLLVEEFGIELTGPLEARRNSSKEALLAVDGKEEEVFIRIYA
FT                   YSDGERLVLLTYSADRESLELEEIEAMILSLNWIH"
FT   gene            complement(611239..612210)
FT                   /locus_tag="Exig_0578"
FT   CDS_pept        complement(611239..612210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0578"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bce:BC1788
FT                   lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60059"
FT                   /db_xref="GOA:B1YJM9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJM9"
FT                   /protein_id="ACB60059.1"
FT                   /translation="MIDVTIDHTHWVASDGYTTTMHLLEATAPKGVVIVFHGMMEHGAR
FT                   YQEFAEFLYAHHYHTIIPDLRCFGARAQQLESLGHLEPNHGFAQLIQDAEELVYDIKDR
FT                   YPDLPIFVFGHSFGSLISRRLGQTLGHELAGIIASGPPTDSGLLGTVSQKIVGRLIEQT
FT                   SSQHPAEGISKLIFGRYNLRFFPALSSNAWLSSDPQSVLRYDEDPLSGQTVTLGFFNEL
FT                   LSATKSVNSLAYLYQHPRHLPLLLIAGEDDPVAFDGKGIHALFDAYNRVRVEGVQLTVY
FT                   RGLRHELFHEFERIRVFADIAGWLNKQIGSHPLSSLRKQGHQ"
FT   gene            complement(612221..613900)
FT                   /locus_tag="Exig_0579"
FT   CDS_pept        complement(612221..613900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0579"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   bwe:BcerKBAB4_1952 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60060"
FT                   /db_xref="GOA:B1YJN0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN0"
FT                   /protein_id="ACB60060.1"
FT                   /translation="MEKTIRSDLEIAQQTILRPISEIAEHIGLNDADYDTYGKYKAKLT
FT                   DGLVKRLATKADGKLILVTAINPTAAGEGKSTVTVGLGQALHRLNHKTMICLREPSLGP
FT                   TMGLKGGACGGGYSQVLPMEEINLHFTGDMHAITSAHNTISALLDNHLHQGNDLRIDPR
FT                   RITWKRVLDLNDRALRQITIGLGGPAHGVPRQDGFDITVASEIMAVLCLADSITDLEKR
FT                   ISRIVVAYSYDQQPVTVKDIKASGAATLLLKEAFRPNLVQTVEGTPALIHGGPFANIAH
FT                   GCNSLIATRTALKLSDYVVTEAGFGADLGAEKFFNIKSRIGHLHPDAVVVVATVRALKM
FT                   HGGVAKDQLAEENLAALVEGLALLEKHVETMDLFGVPAVVALNRFATDTDTERETVLEW
FT                   CRERNIRVAESEVFSQGGAGGEALAEQVFEALEEESQFTPLYPAELPLTQKIERIAKRV
FT                   YGAADVHFEEKALRELERCTEQGLGHLPICMAKTPFSLTDDPSKYGRVEGFTITVREIK
FT                   PSIGAGFIVALTGNVLTMPGLPKIPAANKMGISEDGTIYGLS"
FT   gene            614068..614958
FT                   /locus_tag="Exig_0580"
FT   CDS_pept        614068..614958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0580"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB2569 multiple
FT                   sugar-binding transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60061"
FT                   /db_xref="GOA:B1YJN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN1"
FT                   /protein_id="ACB60061.1"
FT                   /translation="MAVSNKKKVKRGLEFWMFVGPVFLVFAVIVLVPFFNGVMYSFTDW
FT                   NGITGELNWIGFDNYVRLFTVDEQFQQSFWLTTKYTVVAVVLTNLVGFILAFLLTQNIR
FT                   TRNFLRTIFFMPNLIGGLILGFVWQFIYVKGFASIGELTGWSLFELPWLGDARTGFWGI
FT                   VIVSIWQGGGYIMVIYIAALQNVPQELIEAAKIDGANRLSTLRNITIPLIMPSVTICLF
FT                   LTISWSFKLFDTNLSLTNGGPFKSTEMLALNIYKESFTNNNLGLGSAKAIIFFVVVAAI
FT                   TVTQVYLTKKREVEA"
FT   gene            614955..615842
FT                   /locus_tag="Exig_0581"
FT   CDS_pept        614955..615842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0581"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cno:NT01CX_0967 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60062"
FT                   /db_xref="GOA:B1YJN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN2"
FT                   /protein_id="ACB60062.1"
FT                   /translation="MSTAQPLPKPELKPEQPAPKKRGRYSVRLGTVEIAALLMGLLYMI
FT                   PFYYVISNSFKTQGDIFTNTSGLPKEWITENYTNAWEAMNFGKVFLNSVIITVGANAVI
FT                   VIFCSMAAWKLVRTKSRLSTIIFFLFVAAMIIPFQSIMIPLSKLSGDLGLQNSYWGLIL
FT                   MYLGFGSGLSIFLYHGFMKSIPEEIEEAAIIDGCSQWGVFWRIVFPLLKPITVTIVILN
FT                   TLWIWNDFLLPSLMLRDVELRTIPLATFYFFGQYTKQWDLALAGLILGIIPLLLFFFAM
FT                   QKQIIQGITSGSIK"
FT   gene            616313..617287
FT                   /locus_tag="Exig_0582"
FT   CDS_pept        616313..617287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0582"
FT                   /product="Aspartate--ammonia ligase"
FT                   /EC_number="6.3.1.1"
FT                   /note="PFAM: aspartate--ammonia ligase; KEGG:
FT                   bcy:Bcer98_1427 aspartate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60063"
FT                   /db_xref="GOA:B1YJN3"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN3"
FT                   /protein_id="ACB60063.1"
FT                   /translation="MTTLVSMKQTQEAITLVKKRFEEQFSAQLGLTRVEAPLFVESTLG
FT                   VNDHLNGTERVIRFDAIDHQAELEIVQSLAKWKRQALHTYGFAKGEGLYTLMHAIRRDE
FT                   VLDETHSIHVDQWDWERVISKEERTIDYLQKTVQAIYASIRQVEREVEEQLAIEAILPE
FT                   TIHFMTTQELEDAYPTLSTKERETEVTKEYGAVFLMQIGGALASGEKHDGRAADYDDWT
FT                   LNGDILVHHPEIGAFELSSMGIRVDRETLLAQIETTGEHAKLDFPFHQGVLAETLPLTI
FT                   GGGIGQSRMAMFLLKKRHIGEVQASVWSEETRASYREQGVHLL"
FT   gene            617463..617684
FT                   /locus_tag="Exig_0583"
FT   CDS_pept        617463..617684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60064"
FT                   /db_xref="GOA:B1YJN4"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN4"
FT                   /protein_id="ACB60064.1"
FT                   /translation="MSAILITGLVFALLFVAFLWFNIKGLRTMWRDYKRTGSMMALGFF
FT                   IVGIIGIFTGVWTTLVVIIYYLLRPARG"
FT   gene            617702..618295
FT                   /locus_tag="Exig_0584"
FT   CDS_pept        617702..618295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0584"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   btl:BALH_0738 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60065"
FT                   /db_xref="GOA:B1YJN5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN5"
FT                   /protein_id="ACB60065.1"
FT                   /translation="MLEWLFSAGESNLWLFLGIMILGLGTELIPAEVGLPLLGLYVSNG
FT                   TISWTAAVLIGFIGSLMGATLFYFLGRYAGRPILVRYGKWLMIKEREIIQGERIVSKYG
FT                   SWSALFGRFFPVVRSVVSIPCGLFNLSFKRYVLASSIGLFPVSFFYVWLGEKFGVERAE
FT                   SMLKGLEQELWWILGIIVVGIIGYIMYRRLKSKR"
FT   gene            complement(618336..619799)
FT                   /locus_tag="Exig_0585"
FT   CDS_pept        complement(618336..619799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0585"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-C domain protein; sodium/hydrogen
FT                   exchanger; KEGG: bld:BLi01940 potassium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60066"
FT                   /db_xref="GOA:B1YJN6"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN6"
FT                   /protein_id="ACB60066.1"
FT                   /translation="MSLQFTILLIGLLLFTAVWTTKLSSRLNIPALLIFIALGMIAGSD
FT                   ITGFIRFDDAELAQLLGTVALIIILFEGGLQTAWKEVKTELSPSLSLATFGVFIATTIV
FT                   AVASHYILGFSWANAFLLGAIVGSTDAAAIFSVLSGQSVRRKVGSTLELESGTNDPMAV
FT                   FLTVFFLEFVTNPKEASLVSGLTSLVWEMVIGLLLGLFIGWIASTLLNRIDLSSSSFYP
FT                   ILLMSFAFLSFGIADTIHASGFLAVYVTAIYISNHELVYRQTLVRFTMSMAHLAQIGMF
FT                   IVLGLLVFPKQLLDPQVILSSIALALILIFIARPVSVWLSLLPFKYSWQEKVFVSFAGL
FT                   KGAVPIILATYPLVAGIDNAGMIFNIVFFTVLLSTLIQGSMLTFLADRLHLNDTGSSAI
FT                   QTVIEFMSIGKPNAEIIELTIPNSHPFVGKAIMDIDLPQEFLITAIIRDDQIVTPRGDT
FT                   LFEGRDQLLLLTPKHRIKTLKRFLFPKTP"
FT   sig_peptide     complement(619737..619799)
FT                   /locus_tag="Exig_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.713) with cleavage site probability 0.495 at
FT                   residue 21"
FT   gene            619990..621276
FT                   /locus_tag="Exig_0586"
FT   CDS_pept        619990..621276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0586"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cbe:Cbei_0230 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60067"
FT                   /db_xref="GOA:B1YJN7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN7"
FT                   /protein_id="ACB60067.1"
FT                   /translation="MRKRKWAALPVMTTAMVVALAACGGGGTLNSDDSKDSGSSKDGKT
FT                   LNVFQFKAEIAKDMEKMAKAYEKETGVKVVVQTVGGGSDYGAALKSQFASGNEPDVFNN
FT                   GGFTEAKTWQDKLEDLSDEKWVSDLTDLSKEPMTIDGKLYGMPMNLEGYGFIYNKEIFK
FT                   KAGITELPKTLTELTEASKKLKADGVTPFSIGYGEWWILGNHLMNIPMAQQDDPDQFIA
FT                   DLNSGKGKFEDNKQFKEFMNLFDLTIEYGNKNPLTTDYNTQVSQFAEGKTAMIQQGNWA
FT                   QQLITDVNPDIEMGFIPMPINDDKEKMDRLPVGVPNNWVVNKNSKNKEEGKKFLEWMAT
FT                   SDTGKDYMVNKFKFIPAFKSIEAADLGPLADDIIKYSKEDKTISWNWFKYPDGAVNEFG
FT                   AIMQAYVGKQKTSEEMLQDFTKTWQKMKK"
FT   sig_peptide     619990..620064
FT                   /locus_tag="Exig_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.360 at
FT                   residue 25"
FT   gene            complement(621327..622619)
FT                   /locus_tag="Exig_0587"
FT   CDS_pept        complement(621327..622619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0587"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bay:RBAM_027090 YtiP"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60068"
FT                   /db_xref="GOA:B1YJN8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN8"
FT                   /protein_id="ACB60068.1"
FT                   /translation="MFKLSAHDTTVKREIQAGFITFITMAYILFVNPTILSEAGIPQDQ
FT                   AFSATIVATLIGTLLMGFYANLPIAVAPGMGLNAYFTYTLVIGEKIPYQTALSVVFVAG
FT                   IIFLLLSLSPLRTKLIEVIPTTIKLAITGGIGLFIASLGLKMSGILVADPATLITIGSL
FT                   TSPEALITLVGLLVAAILTVKRVPGGLLYAMVLSGVLAFLTGELTFSKTLIALPTLPEG
FT                   ILVANPLSAVQDVIQYGLFSGVLSFVLVTMFDTTGTMVAVGEQAGLIEEDGSLKNSERA
FT                   LLSDSTAMIVGSMFGTSPTTAYVESASGVAAGGRTGLTSVTVGILFALSAVFGPIVQSI
FT                   SSVPAITAPALLLVGALMLQNIKQIQWEDFSEAFTAFMIIIIMPLSGSIATGIAFGFII
FT                   YPIMKAVQKQRVHFLIYLFAVLFFIQLFFLH"
FT   gene            622828..624585
FT                   /locus_tag="Exig_0588"
FT   CDS_pept        622828..624585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0588"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   histidine kinase internal region; KEGG: bcl:ABC3586
FT                   two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60069"
FT                   /db_xref="GOA:B1YJN9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJN9"
FT                   /protein_id="ACB60069.1"
FT                   /translation="MKSIRTRLIRLVVLAILIPTTLATSASYLYVRHQNIEQAERSSLS
FT                   GLKRGSNQISHYMEDVRRLPTSLYANRSLLNIMNVGADAELSESEGVISRALLGLFLSR
FT                   QDIEQLHFVILKGNSEYSVYNMKTSSRGKFDWLQETDYFRLMKQKNGWLIDPAHQIAAY
FT                   NTHTMILDEKEIVSFRYRINRVETDEPLGFLSVDIPTSVFEQQLKLFENFPGESLWLLN
FT                   GNQLIAKTGKELPVTNDRLTGKSGSMRVGDSFIVYAKTTTQGVPITLIKTTPYASVVKG
FT                   ANETALILILIGIGSLVLMIIAASLAALKITKPIKQLTANVWRVEQGDLSAQFVATTND
FT                   EIGLLNRQFQRMIQRIDRLIKREYRLALENRTNELRALQSQLNPHFLFNALQSIGTTTL
FT                   QGDRKIAYRSITGLSQMMRYSMNNEQTIVTLKQEVDHLQSYMRLQQQRFPDRFRYIVDV
FT                   PWHMNSIEIPKMILQPFAENYFKHAFNQQADATENYLAYKVRSDGDQLIIQVENSGSVM
FT                   EAAKLESIDQTMRMHRRPEDRQTSGIGLHNIYERLLIFYGEEASMILQSPAEGGFRIVI
FT                   RIPVEQEEL"
FT   sig_peptide     622828..622905
FT                   /locus_tag="Exig_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.654 at
FT                   residue 26"
FT   gene            624585..625289
FT                   /locus_tag="Exig_0589"
FT   CDS_pept        624585..625289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0589"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: bcl:ABC3587
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60070"
FT                   /db_xref="GOA:B1YJP0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP0"
FT                   /protein_id="ACB60070.1"
FT                   /translation="MNVLIVDDEKHVRDAVKLLGEWDTWQIGNIFEADDGVTAKRFLEQ
FT                   EKIDLMLTDVEMPGLDGLSLLEWTKNHHPKVVTIVLTGYDDYTYMRRAILHQSFDYLLK
FT                   PIDPDILNDALGRAMELIGPVQEQGEAIDQIAKYISTHYAEELTLQLMSERFYLSREYI
FT                   SRRFKQRFSVNLSDYIQTIRLNRAKELLGETDARIYEIALEVGYHDDKYFRKVFKKQFG
FT                   MTPNEFRELLSV"
FT   gene            625315..626022
FT                   /locus_tag="Exig_0590"
FT   CDS_pept        625315..626022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0590"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG: cpf:CPF_1652
FT                   purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60071"
FT                   /db_xref="GOA:B1YJP1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YJP1"
FT                   /protein_id="ACB60071.1"
FT                   /translation="MSVHINAAEGQIAETVLLPGDPLRAKYIADTFLEDVVLYNEVRGM
FT                   YGFTGTYKGKKVSVQGTGMGVPSMSIYANELVQSYGAKNLIRVGTAGGITPDVKVRDVV
FT                   IAMSASHDMAQNRVRFNGLDYAPTASFDLLHKAYMTAKEHGIDAKVGQIFTTDQFYQDD
FT                   FHHFKKWADFGCLAIEMEAAGLYTLAAKHKVNALTILTISDHLLTGEETTAEERQTTFN
FT                   DMMKVALETAIQL"
FT   gene            626125..627507
FT                   /locus_tag="Exig_0591"
FT   CDS_pept        626125..627507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0591"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase_; KEGG: bcy:Bcer98_1006
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60072"
FT                   /db_xref="GOA:B1YJP2"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP2"
FT                   /protein_id="ACB60072.1"
FT                   /translation="MGLTTTGLDVARQIEVQRGFFKTGATRSIAFRLSMLTFLKQAIET
FT                   HEEAIYDALKVDLNKGRQDAFTTEIGFVYGEINRMEKQLRRLAKPRRVKTPLLHFGSKS
FT                   EIRFEPYGNVLVIAPWNYPFQLALAPVVGAIAAGNTVVLKPSELTPNVSRVLREVFETA
FT                   FHERFGVVIEGDAEVSTAVLEEKFDYIFFTGSTRVGKIVHQAAAKHLTPVTLELGGKSP
FT                   TIIHKDADLRLAAKRIAWGKWLNAGQTCIAPDYVFVHRDVQETFLRLIEEEAFSQYGNG
FT                   VGVGSYVKIVSDGHLERLTGYLEQGNIEFGGQVDPETRKMAPTVMTNVPLDSKLMQEEI
FT                   FGPILPVLVYDEIEDVITFVTDRDKPLALYLFTENEFVKERVLNRISFGGGCVNDTLMH
FT                   VAQHNLPFGGVGASGIGGYHGKYSFETFSHRKGLVHNTTKFDLPFRYMRSNTDSKWMRF
FT                   LL"
FT   gene            627576..628796
FT                   /locus_tag="Exig_0592"
FT   CDS_pept        627576..628796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0592"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: lmf:LMOf2365_1103 teichoic
FT                   acid biosynthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60073"
FT                   /db_xref="GOA:B1YJP3"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP3"
FT                   /protein_id="ACB60073.1"
FT                   /translation="MKRQLRQWMIKRTKLVETGLHLVMRVFACLPVHPNRFLFESFLGK
FT                   QYSDNPRSIYEALKKDHPEYELIFSKDRHRVFDDPSVRTVNRMTIRWIYLLATSRVWVS
FT                   NSRLPSWLFKRKGTIYLQTWHGTPLKKLALDMDDVQMADTTTERYKRDFAREASKWDLL
FT                   ISPNAYSSRIFRRAFDFSGELLEIGYPRNDLFYETKRHPEIRERVYSRYNIDRTKKIIL
FT                   YAPTWRDNEYVAKGSYSFKLPFSLEQFEKQFGTEYTLLIRMHYLVADQVDTAGYPSVRN
FT                   ASDYPDISELYIAADAMVTDYSSVMFDYAHLKRPMIFYTYDLEHYRDQLRGFYFDFEQE
FT                   APGPLVLQQSRLFEEIDRLHEWSDRYGPAFDAFEKKFCQWDDGTASVQAYQRLLQPVSN
FT                   QHKGESS"
FT   gene            628793..629182
FT                   /locus_tag="Exig_0593"
FT   CDS_pept        628793..629182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0593"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="KEGG: bcl:ABC3101 glycerol-3-phosphate
FT                   cytidylyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; glycerol-3-phosphate cytidylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60074"
FT                   /db_xref="GOA:B1YJP4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP4"
FT                   /protein_id="ACB60074.1"
FT                   /translation="MKKVITYGTFDLLHWGHINILKRAKEMGDYLVVAISTDEFNRLKH
FT                   KESYHSFENRKLILESIRYVDEVIAENNWDQKITDVQEHQIDTFVMGDDWAGEFDFLKE
FT                   YCEVVYLSRTEGISTSQIKTELGKG"
FT   gene            629238..630380
FT                   /locus_tag="Exig_0594"
FT   CDS_pept        629238..630380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0594"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase; KEGG: bsu:BSU35760 polyglycerol
FT                   phosphate assembly and export (possibly involved in
FT                   teichoic acid linkage unit synthesis) (teichoic acid
FT                   biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60075"
FT                   /db_xref="GOA:B1YJP5"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP5"
FT                   /protein_id="ACB60075.1"
FT                   /translation="MRESIVQIYLLLFRIFYRIFCLLPLRPVTLFWVTYGDNVKPINDA
FT                   LLTEFPKEKRYLVYDKKFVKNPEAWSAEYALPYRRLRFIRLAYLLATSKHLFIDNYIGE
FT                   YSVAPIRQGTKRIQLWHAAGTLKKFGLTSSRSLMVPKHVLRRFKRVYQRYGDFIVPGEA
FT                   CAKQFMAPHDLHRTVFKTLGVPRTDYWFNEQHQTVKKQLSDIYVKPKRRILLYAPTYRE
FT                   YNGMEGQTVRQLEQLTDQGWTILVKLHPTVRSMFTHQKAHVHFVTDEYSINDYLLITDV
FT                   LVTDYSSIPFESCLLGVPTVLYTPDIDTYRQIPGIIDSYPDPLPVTCTDQFEIMLNWIN
FT                   SDVSLQESRMAMEQFKTIWYTEQPGQATRRIVDHYYRKVR"
FT   gene            630543..631250
FT                   /locus_tag="Exig_0595"
FT   CDS_pept        630543..631250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0595"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: gka:GK0788 transcriptional regulator (FNR/CRP
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60076"
FT                   /db_xref="GOA:B1YJP6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP6"
FT                   /protein_id="ACB60076.1"
FT                   /translation="MLACGTTEANTFVLSAETRMILEDFMTEVTFKKDSIVCWEGELND
FT                   KLFYVKQGGVKLSKLTKKGSPLMMFLYFKGDLFGEFDVGEAFPSSYSIETMEDSILGVI
FT                   SKSKLEELMKQDGVFALEIMRWQALMRKQSETKLRDLLLFGKQGALASTLLRLIAMHGK
FT                   QVGEDYVISKRPSDSELGQLIGAPRETVNRMFSQWKKDKVISSTTTKIIVHDANYLRDL
FT                   CHCEGCPVGVCRI"
FT   gene            631568..631681
FT                   /locus_tag="Exig_0596"
FT   CDS_pept        631568..631681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60077"
FT                   /db_xref="GOA:B1YJP7"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP7"
FT                   /protein_id="ACB60077.1"
FT                   /translation="MSSKPEPNLSGTIVAVFIVASVIIGMWGSIFLLFSSR"
FT   gene            631694..632164
FT                   /locus_tag="Exig_0597"
FT   CDS_pept        631694..632164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0597"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   gka:GK1547 cytochrome c oxidase (b(o/a)3-type) chain II"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60078"
FT                   /db_xref="GOA:B1YJP8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP8"
FT                   /protein_id="ACB60078.1"
FT                   /translation="MHIHRLEKIWLVFGCVMLAVFLVIIGISAFASGNQPPSDATLIDP
FT                   TQVDQTKPFDKPGLKKIDDNRYEAVMVSQAFQFTPQDMVIKKGATVDFLVTSKDVVHGF
FT                   EIVKTNVNMMVVPGHINSIEYTFKKAGDYLIVCNEYCGSGHHMMSTKIKVVE"
FT   sig_peptide     631694..631789
FT                   /locus_tag="Exig_0597"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.744 at
FT                   residue 32"
FT   gene            632165..633856
FT                   /locus_tag="Exig_0598"
FT   CDS_pept        632165..633856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0598"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   gtn:GTNG_1394 subunit I of b(o/a)3-type cytochrome c
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB60079"
FT                   /db_xref="GOA:B1YJP9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1YJP9"
FT                   /protein_id="ACB60079.1"
FT                   /translation="MNAISKKLKEFEMERGLPATAIGLKEAKLAFAHVSFSLVALLIGG
FT                   LCGLLQTLVRTGVIPEIAGIGYYELLTAHGLMLAIVFTTLFIFGLLFSFLGQSFGRFEE
FT                   FPRRLGWVGFWFMMLGVVLVTWMVLAGEASVLYTFYAPLKAHPVFYIGLVIFVVGTWIS
FT                   SGAMFRMYADYKREHKGVHPPLQAYMSIMTVLLWVVATLGVAATILFQLLPLSLGWTDK
FT                   VGIELSRTLFWYFGHPLVYFWLLPAYIVWYTVIPKIVGGKVFSDALARMSFLLFLLFSF
FT                   PVGFHHQLLEPGISAFWKYIQVVLTFLVIIPSLMTAFSMFATFELAGRRQGASGLFGWI
FT                   KKMPYRDVRFLAPFIGMLFFIPAGAGGVINASHQLNIVVHNTLWVTGHFHITVGAAVAL
FT                   TFFGTAYWLVPLLRGRTLTKQINRIGLVQTMLWTIGMLFMSTAMHISGLLGNPRRTGPA
FT                   AYFKDSLVADWIPYHVAMAIGGTILFLSILLFLFAMFQLAFRAPKGTEEFPVAETEEAA
FT                   MQTPLFFENWKLWIFVTFALIAFAYTVPIWHMIENAPPGAPGWKLW"
FT   gene            complement(633962..634591)
FT                   /locus_tag="Exig_0599"
FT   CDS_