(data stored in ACNUC7421 zone)

EMBL: CP001023

ID   CP001023; SV 1; circular; genomic DNA; STD; PRO; 4885 BP.
XX
AC   CP001023; AADW02000000-AADW02000051;
XX
PR   Project:PRJNA10649;
XX
DT   04-APR-2008 (Rel. 95, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Exiguobacterium sibiricum 255-15 plasmid pEXIG01, complete sequence.
XX
KW   .
XX
OS   Exiguobacterium sibiricum 255-15
OC   Bacteria; Firmicutes; Bacilli; Bacillales;
OC   Bacillales Family XII. Incertae Sedis; Exiguobacterium.
OG   Plasmid pEXIG01
XX
RN   [1]
RP   1-4885
RX   DOI; 10.1007/s00792-005-0497-5.
RX   PUBMED; 16489412.
RA   Rodrigues D.F., Goris J., Vishnivetskaya T., Gilichinsky D.,
RA   Thomashow M.F., Tiedje J.M.;
RT   "Characterization of Exiguobacterium isolates from the Siberian permafrost.
RT   Description of Exiguobacterium sibiricum sp. nov";
RL   Extremophiles 10(4):285-294(2006).
XX
RN   [2]
RP   1-4885
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   "Complete sequence of plasmid1 of Exiguobacterium sibiricum 255-15";
RL   Unpublished.
XX
RN   [3]
RP   1-4885
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (02-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 4e4883787966ee28fda6b990c5a98981.
DR   BioSample; SAMN00120225.
DR   StrainInfo; 689778; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662203
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4885
FT                   /organism="Exiguobacterium sibiricum 255-15"
FT                   /plasmid="pEXIG01"
FT                   /strain="255-15"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:262543"
FT   gene            240..707
FT                   /locus_tag="Exig_3051"
FT   CDS_pept        240..707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62496"
FT                   /db_xref="GOA:B1YMR9"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMR9"
FT                   /protein_id="ACB62496.1"
FT                   /translation="MKNMDLTILDVIEFNKQMKFLDVAKTHAPVGREKLREAMKLAGAT
FT                   FDQQTKRWHIQEGHPNEKKRVLDFVQSSRITKPNQEKAQDPLRVDPVTGQSQLDDGYFE
FT                   IETKPEKIIRKKVSLDLDVTLHKRLKHTALEKDVKLYELIEGILRNYIEKK"
FT   gene            complement(758..1009)
FT                   /locus_tag="Exig_3052"
FT   CDS_pept        complement(758..1009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62497"
FT                   /db_xref="GOA:B1YMS0"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS0"
FT                   /protein_id="ACB62497.1"
FT                   /translation="MKNAKNILIANSIVLIIILIAQLISPSIGSYLLDSKIEFLDENST
FT                   YWIAKLIETSSVQGFCLLVGLLNISLIAVSVNHLLKQK"
FT   gene            complement(1030..1737)
FT                   /locus_tag="Exig_3053"
FT   CDS_pept        complement(1030..1737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62498"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS1"
FT                   /protein_id="ACB62498.1"
FT                   /translation="MKKYKFLFPALLMTTFISSNVIHAEEPSIDPDLIEEVDSIGVNED
FT                   TSELVEGIDYDIEEATVYSEESSDLENSNFESSAPLQSSSNNDRITPSMVLMPGPEYKF
FT                   SGVKYIKETIGKSILWKTSGVPGVTIGLDFTKSRNASVSTTYGASYHDISQSLSFTIGK
FT                   SYSVSSSGSYKVPKSRGGKAIKRTEVTGQPIYKKYSVKVSKRNDILFRYDYKGLLYAYK
FT                   PIGVHIKYKHYYK"
FT   sig_peptide     complement(1663..1737)
FT                   /locus_tag="Exig_3053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(2550..2891)
FT                   /locus_tag="Exig_3054"
FT   CDS_pept        complement(2550..2891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62499"
FT                   /db_xref="GOA:B1YMS2"
FT                   /db_xref="InterPro:IPR021486"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS2"
FT                   /protein_id="ACB62499.1"
FT                   /translation="MKNKTIIYFMVILFLGIGLIGAWGYKTLYYDEKQSTSENIDGFLK
FT                   ENNYMQNVSTKEIVMDTTTDEYFAKVTFKDEPNNEYEIYQTGSNHFKIVGYKDGVQITN
FT                   KKEGKYIKR"
FT   sig_peptide     complement(2817..2891)
FT                   /locus_tag="Exig_3054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.505 at
FT                   residue 25"
FT   gene            2961..3755
FT                   /locus_tag="Exig_3055"
FT   CDS_pept        2961..3755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_2290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62500"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS3"
FT                   /protein_id="ACB62500.1"
FT                   /translation="MIKKSFGIATLVLSLALTSPNLSYAEDLSQSKNDLSKSTYSNFIG
FT                   EGVVSETVSYNSWVDINTNDSFEELEEEFPVPDRLMEVDPSNEKDKSYSIPSVSYSIMA
FT                   ATSSKGPVLKKGDILVSNATSSYGLTGHAGIAISSSQVLHISGAGAHPKVISSKTWQDR
FT                   YGIVKGQKEGSNIKTNVYRIKSTTNASKAANWAVKNYKGKKYDYIITPTISSKNPTYCS
FT                   KIVWQAYRSIKAVNYPAGDIPTPYGLPKYFKKAQNLKGMGYL"
FT   sig_peptide     2961..3038
FT                   /locus_tag="Exig_3055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
XX
SQ   Sequence 4885 BP; 1564 A; 863 C; 947 G; 1511 T; 0 other;
     cgccagcaag cgaagtggag gcgtaaacgc cggaacgaag tgcggtagat caggaaagcg        60
     aaaatcttaa acaggcatcc agagagaaag aagaaaggat tgtttatatc aattaccgaa       120
     cgttctagag aagcgaaact cgaagaaaga acgcaggtgt ctagccctat catccagaaa       180
     attaagaggg taaaaaggaa ggttaatagt tggttatttg ttaaggagga tttgaaggaa       240
     tgaagaatat ggacttaacg attctggatg tcattgaatt taacaaacaa atgaagttcc       300
     tcgatgtagc aaaaacgcat gctccagtag gacgtgagaa gcttcgtgag gcgatgaaac       360
     ttgctggagc gacgtttgat caacaaacca agcgatggca tattcaagaa ggtcatccga       420
     atgagaagaa acgggtgttg gattttgttc aatcgagtcg tatcactaaa ccgaatcaag       480
     agaaagcgca agatcctttg cgagtggacc ctgtgacggg acaatctcaa ttggatgatg       540
     gttatttcga gattgagacg aagccggaaa agattattcg taaaaaagta tcgcttgatc       600
     ttgatgtgac tttacataag cgtttgaaac acaccgctct tgagaaagat gtgaagcttt       660
     atgagttaat tgaagggatt ttacgtaact atatagagaa gaaatgaatt gaaaaggcta       720
     cttcgtctct tgataagacg gagtagcctt tttcaattca tttctgtttt aaaaggtggt       780
     ttactgacac tgctattaaa ctaatgttta ataaaccaac taagagacaa aatccttgca       840
     cagaacttgt ttcaatcaat ttcgcaatcc agtatgtaga gttttcatct aaaaactcta       900
     tttttgaatc tagcaaataa cttccgatag atggtgaaat caattgggct attaagatta       960
     ttattaaaac aatcgaatta gcgattaaga tgtttttagc gtttttcata atagattgtt      1020
     tatctcctgt tacttgtagt agtgtttata ttttatatga acaccaatcg gtttgtaagc      1080
     atataataac cctttatagt catatcggaa aagaatatca tttctttttg aaactttcac      1140
     agaatatttt ttatagatcg gttgccccgt tacttctgta cgttttatcg ctttcccacc      1200
     gcgactcttt ggcactttat aactaccact agaacttact gagtaacttt ttccaattgt      1260
     gaaactcaaa ctttgagaaa tgtcatgata agatgcccca tatgtagtcg aaactgaagc      1320
     gtttcttgat ttagtgaagt ctaatccaat cgtcacacca ggtactccac tagttttcca      1380
     tagtatagat tttccaattg tttctttgat atacttcaca cctgaaaatt tatattctgg      1440
     acctggcatc aaaaccattg aaggagtaat tctgtcgtta ttactacttg actgaagtgg      1500
     agcagaactt tcgaagttac tgttttctag atctgaagat tcttcagaat aaacagttgc      1560
     ttcttcaata tcatagtcaa tgccttcaac taattccgaa gtgtcttcgt ttacaccgat      1620
     agagtcaacc tcttcaatta aatcaggatc gattgatggt tcttctgcat gaatgacgtt      1680
     tgaagaaatg aaagtagtca tgagtagtgc tgggaaaaga aacttatact ttttcaatat      1740
     tagtgcctcc ttctataaat tgttaatatg taatcgtgaa taaccataac attaccattt      1800
     ttaaatgtaa aacatttggt aaatgaaatg ctgccgattt tttgttcgaa aactagcaaa      1860
     aaaccgtaag gttgcgtgaa atgacaattc ctcgcaatct tacgactggt agaccaacac      1920
     tttcaaaaaa agagacgaga aggatgtgtt ttcacaaact ttttgtctct tttttgcatg      1980
     gtgttttttt agtgaatcgt tttatttaag tgttctcttt tgtgtattta attctttttt      2040
     tgttgctgca gatctatctg gtgaatcagt tttgagaggt atatcgagtc cggaaaatga      2100
     tttttaaaat cacaaaactt gaaaagaaag aggcaaatta aaatacacct taaaaccaaa      2160
     aatgcacaaa acagtgaaaa agagcataag gggaaactgc tatcactaag cgtgctaggc      2220
     taggcaaagc ctagtgtttc cctgatatca tcaaaatcgc gaaaaggtca caccccgtgc      2280
     cagtgaaaac gccattttgg cacggggtgt gcctctgttt ttcactaaat attttgtgtt      2340
     cccaatgaaa ataatatcaa gtggagcgcc ttctttttta tttaagaggt attttcaagc      2400
     tttgtatttt ctagccactt tgtggaggca atacagcttg tcggggattt ccccgacccc      2460
     ctttctttaa aaattaatgc cataaaaaaa gacattctct aatagaaatg tctttgacaa      2520
     tacaataatg tctatatttt tattctggac tatctcttaa tatatttgcc ttcttttttg      2580
     tttgtaattt ggaccccgtc tttataacca acaattttaa aatgattcga tcctgtttga      2640
     tagatttcat attcattatt aggttcgtct ttaaaagtta ctttggcgaa atactcatca      2700
     gttgttgtgt ccataacaat ttcttttgtt gaaacatttt gcatgtaatt attttctttt      2760
     aaaaatccat ctatattctc actagtagat tgtttttcat cataataaag agttttataa      2820
     ccccatgctc caattaagcc gatccctaaa aaaagtataa ccataaaata tataatagtc      2880
     ttgtttttca taaattatcc ctaccaatcg tttatttttt acattataat caatttatac      2940
     taaaaaatgg atgttttaat ttgattaaga aaagttttgg tattgctact ttggttttat      3000
     ctttagcatt aacatcccct aacttatcat acgctgaaga tctaagccaa tcgaaaaatg      3060
     acttatctaa aagtacgtac agcaatttta ttggtgaagg tgtggttagc gaaactgtat      3120
     cttacaattc atgggtggac atcaatacta atgattcttt tgaggaatta gaagaagaat      3180
     ttcctgtccc tgatagatta atggaagttg atccatcaaa cgaaaaagat aagagttaca      3240
     gtattccctc agtatcatat tcaataatgg ccgcaacttc ttctaaagga ccggttttaa      3300
     aaaaaggaga tattttagtt agcaatgcta catcttctta tggtttgacg gggcatgctg      3360
     gaattgcaat cagttctagc caagttcttc atatctctgg tgctggtgcc caccctaagg      3420
     tcatttcatc taaaacctgg caagatcgat atggaatagt gaaaggacaa aaagaaggct      3480
     caaatataaa aacgaatgtt tatcgtataa aaagtacgac gaatgcctct aaagcagcta      3540
     attgggctgt gaaaaattat aaaggtaaaa aatatgatta cattatcacc cctacaattt      3600
     cttctaaaaa tccaacatac tgttcgaaaa ttgtttggca agcctacaga tctattaagg      3660
     ctgtaaatta tcctgcagga gatatcccta ctccgtatgg attaccaaaa tactttaaaa      3720
     aagctcaaaa tcttaaaggg atgggttatc tctaataaca tatgtatata aagaggactt      3780
     taaaatagta gttattttaa agtcctcttt actgtttaaa aaatattaag atctgaattg      3840
     tgttaaccaa aagaatagtc tttttatgaa ttatagctat tttgatattg tcataaaaat      3900
     gatgtaggcg tacaataagc agtaacaaaa tacggacgga acaacaaaaa acgccacttc      3960
     tcctatctac ttgtcgccaa acgagtagat gatcaacgaa gtgacgcttt tgaatagcga      4020
     gtgctcgaac acttgctatt gaatagttga aggcacattg gacgtgactt caacttagat      4080
     gcacttatca tactaaggaa acctttaaca ttcaaggttt tagtatagaa aaaggacatc      4140
     attcagtagc aagttttacg aaacacgcta ctgaatgatg tcctttttgt tttggtctta      4200
     cataaaaaga ggtctgcact cgctctttaa acgagtaggt tcatccagcc gacgcagtaa      4260
     aatggatcgg tcgtcatcgc agttccagca cgtggcgcga cgttagcagg ggaaggacgg      4320
     agagccctgt acatagccta agtcccgaag ggatacggta aaaatcgttg agaggttcag      4380
     acggggtcat atggtacgag accgtaggca gtcccacgac aaacggtggg gaatttccta      4440
     gtaggcggct gtatgattgc tgtgacacga cgtatgacgg ccaaaagccg tcatacagtg      4500
     ggttatatga cgagtcgccg aaaggcagca aggtagggcg tggaaacgcc ttgtgtgcgc      4560
     gagagcgcag cgagtcatat cgtaggggcg agactcccct acaatcttgg aacgcctaga      4620
     catacggata cctcgtccta cactggacgc agtgcaccga tgggcagatt taactctttc      4680
     cttttgcaag gggttagtct gcccatccag ccgttttcct cgcctgcctc ccgcagtatg      4740
     ccctcgctct tcaggttcta caagtctttt tatttaaaaa aagaatagaa agttcaggaa      4800
     agatgaagat caacgacggg ttcatgtgtc gtgcgaggca tgttgaagga gggagcgaag      4860
     cgattccatt caacatgccg cagtg                                            4885
//

If you have problems or comments...

PBIL Back to PBIL home page