(data stored in ACNUC7421 zone)

EMBL: CP001024

ID   CP001024; SV 1; circular; genomic DNA; STD; PRO; 1765 BP.
XX
AC   CP001024; AADW02000000-AADW02000051;
XX
PR   Project:PRJNA10649;
XX
DT   04-APR-2008 (Rel. 95, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Exiguobacterium sibiricum 255-15 plasmid pEXIG02, complete sequence.
XX
KW   .
XX
OS   Exiguobacterium sibiricum 255-15
OC   Bacteria; Firmicutes; Bacilli; Bacillales;
OC   Bacillales Family XII. Incertae Sedis; Exiguobacterium.
OG   Plasmid pEXIG02
XX
RN   [1]
RP   1-1765
RX   DOI; 10.1007/s00792-005-0497-5.
RX   PUBMED; 16489412.
RA   Rodrigues D.F., Goris J., Vishnivetskaya T., Gilichinsky D.,
RA   Thomashow M.F., Tiedje J.M.;
RT   "Characterization of Exiguobacterium isolates from the Siberian permafrost.
RT   Description of Exiguobacterium sibiricum sp. nov";
RL   Extremophiles 10(4):285-294(2006).
XX
RN   [2]
RP   1-1765
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   "Complete sequence of plasmid2 of Exiguobacterium sibiricum 255-15";
RL   Unpublished.
XX
RN   [3]
RP   1-1765
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Chertkov O., Monk C.,
RA   Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Mikhailova N., Vishnivetskaya T.,
RA   Rodrigues D.F., Gilichinsky D., Tiedje J., Richardson P.;
RT   ;
RL   Submitted (02-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 64ca6f5baa0f33291c52359214bbc6db.
DR   BioSample; SAMN00120225.
DR   EuropePMC; PMC2615787; 19019206.
DR   StrainInfo; 689778; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662203
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1765
FT                   /organism="Exiguobacterium sibiricum 255-15"
FT                   /plasmid="pEXIG02"
FT                   /strain="255-15"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:262543"
FT   gene            49..942
FT                   /locus_tag="Exig_3056"
FT   CDS_pept        49..942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhe:lhv_0265 putative replicative protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62501"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS4"
FT                   /protein_id="ACB62501.1"
FT                   /translation="MEHEKSSNISPSSTVRVTKMNHLVEVQHMERMNRTNHIQKLDKER
FT                   YLNLKTGEIGEFKQGEVRSDSLNSLRQTFKKLRYLINTNYVGAGNELFITLTYKENMTD
FT                   VKRLYSDFKKFMLKFRYKYEKQYGSIDYMTVVEPQERGAWHHHLLVRFNDMTGSKMYIP
FT                   NNDVAALWGHGFTNMHSLNGVDNIGAYLSAYLADVELTTDNVFLAFDDNVEVVSKVVDG
FT                   QEKKFIKGGRLHLYPSGMNLYRKSKGIKMPVREEMRYGDIKKVVGSEKPHYVKTLVVEQ
FT                   DDFKNTITYEQYNTKR"
FT   gene            1388..1615
FT                   /locus_tag="Exig_3057"
FT   CDS_pept        1388..1615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62502"
FT                   /db_xref="GOA:B1YMS5"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS5"
FT                   /protein_id="ACB62502.1"
FT                   /translation="MANENEMKRFNIRMPQDMFDRIEKTAHAKGVPVSAFINLKMDEIL
FT                   KQDEMAQSMNLLTDPVAFAKILEQYNGGKK"
FT   gene            1612..1758
FT                   /locus_tag="Exig_3058"
FT   CDS_pept        1612..1758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62503"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS6"
FT                   /protein_id="ACB62503.1"
FT                   /translation="MSTPVERLKETLDEFSDEHMMITVSRKDLEALIRSYENLKKELEK
FT                   RSE"
XX
SQ   Sequence 1765 BP; 565 A; 300 C; 430 G; 470 T; 0 other;
     tttattaact tgattttaat taaacattag cagaaaagcg gtgaggttat ggaacacgaa        60
     aaaagctcta atatttctcc ttcctctacg gtgcgagtaa ccaaaatgaa ccaccttgtg       120
     gaagtgcaac atatggagcg aatgaatcgt actaaccata ttcaaaagtt agacaaggaa       180
     cggtatctta atctcaagac tggtgagatt ggtgagttta aacaaggcga ggttagaagt       240
     gacagtctta actctttaag acagacgttt aagaagctcc gttatttgat taatactaac       300
     tatgtgggtg ctggtaatga gcttttcatt acccttacat acaaagagaa tatgaccgac       360
     gttaagcgtt tatatagtga ttttaagaag ttcatgctta agttccgtta taagtacgaa       420
     aaacagtatg gatcaattga ctacatgact gttgttgaac ctcaagagcg tggggcatgg       480
     catcaccatt tactcgttag attcaacgat atgaccggta gcaagatgta tattcctaat       540
     aatgatgttg cagcactgtg ggggcatggt ttcacgaata tgcattcttt aaacggtgtc       600
     gataatattg gtgcgtatct gtcggcttac cttgctgatg tggaattgac tactgataat       660
     gtgtttttag cttttgatga caatgtagag gttgtttcga aggttgttga tggtcaagag       720
     aagaagttta tcaagggtgg tcgcttgcat ctatatccga gtggcatgaa tctttaccgt       780
     aagtctaaag ggattaaaat gcctgttcgt gaagaaatga gatatgggga cataaaaaaa       840
     gtagtagggt ctgagaaacc ccactacgtc aagactttag tcgtcgagca ggacgacttc       900
     aaaaacacta tcacctacga acagtataac acaaagcgtt aacaactgaa tagcggaagg       960
     gagggctgcg aaccctcctt tttgcgtacc cggaaagcgt agcgaagacg gagcgcaaac      1020
     tgagacgcat gtccagttga gcaacggctc gcacgctact ggatacacaa ctggaaggta      1080
     cggcccccac ctactaacag gggggtagga aatacatgtg taagtgccgt agggcattgg      1140
     tgcttatgga ttcaggtcac ttttaaaact gtacacgtta gcgtttatgt cgcgaaagct      1200
     tattgatatt gagcagaccc ccataaacac tgaaaccagt ggctcccaga ggggcgaaga      1260
     ccctcggagg cgatgggttt gggggtttgg gggtcagagg ctcgatgtca ataagtcgtg      1320
     aaataaaaag cgttgacata gtaagtccta aaggtgtata ttatacacag aagggagttg      1380
     gataataatg gctaacgaaa atgagatgaa acgttttaat atcagaatgc cacaagatat      1440
     gtttgaccgt atcgagaaaa cggctcatgc aaagggtgtt ccagtttcgg catttatcaa      1500
     cttgaaaatg gatgaaattc tgaaacaaga cgaaatggcg caaagtatga atttgctgac      1560
     tgatccagtt gcctttgcaa aaattctaga acagtataac gggggaaaaa aatgagtaca      1620
     ccagttgaac ggctcaaaga aactctagac gagtttagtg atgaacatat gatgattact      1680
     gtaagccgaa aagatttaga agctctaatt cgttcgtatg agaatctgaa aaaagagttg      1740
     gaaaagcgtt cagaatgagt ttgtc                                            1765
//

If you have problems or comments...

PBIL Back to PBIL home page