(data stored in ACNUC7421 zone)

EMBL: CP001033

ID   CP001033; SV 1; circular; genomic DNA; STD; PRO; 2209198 BP.
XX
AC   CP001033;
XX
PR   Project:PRJNA29179;
XX
DT   13-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Streptococcus pneumoniae CGSP14, complete genome.
XX
KW   .
XX
OS   Streptococcus pneumoniae CGSP14
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2209198
RX   DOI; 10.1186/1471-2164-10-158.
RX   PUBMED; 19361343.
RA   Ding F., Tang P., Hsu M.H., Cui P., Hu S., Yu J., Chiu C.H.;
RT   "Genome evolution driven by host adaptations results in a more virulent and
RT   antimicrobial-resistant Streptococcus pneumoniae serotype 14";
RL   BMC Genomics 10:158-158(2009).
XX
RN   [2]
RP   1-2209198
RG   Molecular Infectious Diseases Research Center, Chang Gung Memorial
RG   Hospital, Chang Gung University College of Medicine and Beijing Institute
RG   of Genomics
RA   Ding F., Tang P., Hsu M.-H., Cui P., Hu S., Yu J., Chiu C.-H.;
RT   ;
RL   Submitted (02-APR-2008) to the INSDC.
RL   Department of Pediatrics, Chang Gung Children's Hospital, Chang Gung
RL   University College of Medicine, 5 Fu-Hsin Street, Kweishan 333, Taoyuan,
RL   Taiwan
XX
DR   MD5; 8042f1e5eb0d01a260f30c95d62eac15.
DR   BioSample; SAMN02603015.
DR   EnsemblGenomes-Gn; EBG00001135781.
DR   EnsemblGenomes-Gn; EBG00001135782.
DR   EnsemblGenomes-Gn; EBG00001135783.
DR   EnsemblGenomes-Gn; EBG00001135784.
DR   EnsemblGenomes-Gn; EBG00001135785.
DR   EnsemblGenomes-Gn; EBG00001135786.
DR   EnsemblGenomes-Gn; EBG00001135787.
DR   EnsemblGenomes-Gn; EBG00001135788.
DR   EnsemblGenomes-Gn; EBG00001135789.
DR   EnsemblGenomes-Gn; EBG00001135790.
DR   EnsemblGenomes-Gn; EBG00001135791.
DR   EnsemblGenomes-Gn; EBG00001135792.
DR   EnsemblGenomes-Gn; EBG00001135793.
DR   EnsemblGenomes-Gn; EBG00001135794.
DR   EnsemblGenomes-Gn; EBG00001135795.
DR   EnsemblGenomes-Gn; EBG00001135796.
DR   EnsemblGenomes-Gn; EBG00001135797.
DR   EnsemblGenomes-Gn; EBG00001135798.
DR   EnsemblGenomes-Gn; EBG00001135799.
DR   EnsemblGenomes-Gn; EBG00001135800.
DR   EnsemblGenomes-Gn; EBG00001135801.
DR   EnsemblGenomes-Gn; EBG00001135802.
DR   EnsemblGenomes-Gn; EBG00001135803.
DR   EnsemblGenomes-Gn; EBG00001135804.
DR   EnsemblGenomes-Gn; EBG00001135805.
DR   EnsemblGenomes-Gn; EBG00001135806.
DR   EnsemblGenomes-Gn; EBG00001135807.
DR   EnsemblGenomes-Gn; EBG00001135808.
DR   EnsemblGenomes-Gn; EBG00001135809.
DR   EnsemblGenomes-Gn; EBG00001135810.
DR   EnsemblGenomes-Gn; EBG00001135811.
DR   EnsemblGenomes-Gn; EBG00001135812.
DR   EnsemblGenomes-Gn; EBG00001135813.
DR   EnsemblGenomes-Gn; EBG00001135814.
DR   EnsemblGenomes-Gn; EBG00001135815.
DR   EnsemblGenomes-Gn; EBG00001135816.
DR   EnsemblGenomes-Gn; EBG00001135817.
DR   EnsemblGenomes-Gn; EBG00001135818.
DR   EnsemblGenomes-Gn; EBG00001135819.
DR   EnsemblGenomes-Gn; EBG00001135820.
DR   EnsemblGenomes-Gn; EBG00001135821.
DR   EnsemblGenomes-Gn; EBG00001135822.
DR   EnsemblGenomes-Gn; EBG00001135823.
DR   EnsemblGenomes-Gn; EBG00001135824.
DR   EnsemblGenomes-Gn; EBG00001135825.
DR   EnsemblGenomes-Gn; EBG00001135826.
DR   EnsemblGenomes-Gn; EBG00001135827.
DR   EnsemblGenomes-Gn; EBG00001135828.
DR   EnsemblGenomes-Gn; EBG00001135829.
DR   EnsemblGenomes-Gn; EBG00001135830.
DR   EnsemblGenomes-Gn; EBG00001135831.
DR   EnsemblGenomes-Gn; EBG00001135832.
DR   EnsemblGenomes-Gn; EBG00001135833.
DR   EnsemblGenomes-Gn; EBG00001135834.
DR   EnsemblGenomes-Gn; EBG00001135835.
DR   EnsemblGenomes-Gn; EBG00001135836.
DR   EnsemblGenomes-Gn; EBG00001135837.
DR   EnsemblGenomes-Gn; EBG00001135838.
DR   EnsemblGenomes-Gn; EBG00001135839.
DR   EnsemblGenomes-Gn; EBG00001135840.
DR   EnsemblGenomes-Gn; EBG00001135841.
DR   EnsemblGenomes-Gn; EBG00001135842.
DR   EnsemblGenomes-Gn; EBG00001135843.
DR   EnsemblGenomes-Gn; EBG00001135844.
DR   EnsemblGenomes-Gn; EBG00001135845.
DR   EnsemblGenomes-Gn; EBG00001135846.
DR   EnsemblGenomes-Gn; EBG00001135847.
DR   EnsemblGenomes-Gn; EBG00001135848.
DR   EnsemblGenomes-Gn; EBG00001135849.
DR   EnsemblGenomes-Gn; EBG00001135850.
DR   EnsemblGenomes-Gn; EBG00001135851.
DR   EnsemblGenomes-Gn; EBG00001135852.
DR   EnsemblGenomes-Gn; EBG00001135853.
DR   EnsemblGenomes-Gn; EBG00001135854.
DR   EnsemblGenomes-Gn; EBG00001135855.
DR   EnsemblGenomes-Gn; EBG00001135856.
DR   EnsemblGenomes-Gn; EBG00001135857.
DR   EnsemblGenomes-Gn; EBG00001135858.
DR   EnsemblGenomes-Gn; EBG00001135859.
DR   EnsemblGenomes-Gn; EBG00001135860.
DR   EnsemblGenomes-Gn; EBG00001135861.
DR   EnsemblGenomes-Gn; EBG00001135862.
DR   EnsemblGenomes-Gn; EBG00001135863.
DR   EnsemblGenomes-Gn; EBG00001135864.
DR   EnsemblGenomes-Gn; EBG00001135865.
DR   EnsemblGenomes-Gn; EBG00001135866.
DR   EnsemblGenomes-Gn; EBG00001135867.
DR   EnsemblGenomes-Gn; EBG00001135868.
DR   EnsemblGenomes-Gn; EBG00001135869.
DR   EnsemblGenomes-Gn; EBG00001135870.
DR   EnsemblGenomes-Gn; EBG00001135871.
DR   EnsemblGenomes-Gn; EBG00001135872.
DR   EnsemblGenomes-Gn; EBG00001135873.
DR   EnsemblGenomes-Gn; EBG00001135874.
DR   EnsemblGenomes-Gn; EBG00001135875.
DR   EnsemblGenomes-Gn; EBG00001135876.
DR   EnsemblGenomes-Gn; EBG00001135877.
DR   EnsemblGenomes-Gn; EBG00001135878.
DR   EnsemblGenomes-Gn; EBG00001135879.
DR   EnsemblGenomes-Gn; EBG00001135880.
DR   EnsemblGenomes-Gn; EBG00001135881.
DR   EnsemblGenomes-Gn; EBG00001135882.
DR   EnsemblGenomes-Gn; EBG00001135883.
DR   EnsemblGenomes-Gn; EBG00001135884.
DR   EnsemblGenomes-Gn; EBG00001135885.
DR   EnsemblGenomes-Gn; EBG00001135886.
DR   EnsemblGenomes-Gn; EBG00001135887.
DR   EnsemblGenomes-Gn; EBG00001135888.
DR   EnsemblGenomes-Gn; SPCG_s01.
DR   EnsemblGenomes-Gn; SPCG_s02.
DR   EnsemblGenomes-Gn; SPCG_s03.
DR   EnsemblGenomes-Gn; SPCG_s04.
DR   EnsemblGenomes-Gn; SPCG_s05.
DR   EnsemblGenomes-Gn; SPCG_s06.
DR   EnsemblGenomes-Gn; SPCG_s07.
DR   EnsemblGenomes-Gn; SPCG_s08.
DR   EnsemblGenomes-Gn; SPCG_s09.
DR   EnsemblGenomes-Gn; SPCG_s10.
DR   EnsemblGenomes-Gn; SPCG_s11.
DR   EnsemblGenomes-Gn; SPCG_s12.
DR   EnsemblGenomes-Gn; SPCG_t01.
DR   EnsemblGenomes-Gn; SPCG_t02.
DR   EnsemblGenomes-Gn; SPCG_t03.
DR   EnsemblGenomes-Gn; SPCG_t04.
DR   EnsemblGenomes-Gn; SPCG_t05.
DR   EnsemblGenomes-Gn; SPCG_t06.
DR   EnsemblGenomes-Gn; SPCG_t07.
DR   EnsemblGenomes-Gn; SPCG_t08.
DR   EnsemblGenomes-Gn; SPCG_t09.
DR   EnsemblGenomes-Gn; SPCG_t10.
DR   EnsemblGenomes-Gn; SPCG_t11.
DR   EnsemblGenomes-Gn; SPCG_t12.
DR   EnsemblGenomes-Gn; SPCG_t13.
DR   EnsemblGenomes-Gn; SPCG_t14.
DR   EnsemblGenomes-Gn; SPCG_t15.
DR   EnsemblGenomes-Gn; SPCG_t16.
DR   EnsemblGenomes-Gn; SPCG_t17.
DR   EnsemblGenomes-Gn; SPCG_t18.
DR   EnsemblGenomes-Gn; SPCG_t19.
DR   EnsemblGenomes-Gn; SPCG_t20.
DR   EnsemblGenomes-Gn; SPCG_t21.
DR   EnsemblGenomes-Gn; SPCG_t22.
DR   EnsemblGenomes-Gn; SPCG_t23.
DR   EnsemblGenomes-Gn; SPCG_t24.
DR   EnsemblGenomes-Gn; SPCG_t25.
DR   EnsemblGenomes-Gn; SPCG_t26.
DR   EnsemblGenomes-Gn; SPCG_t27.
DR   EnsemblGenomes-Gn; SPCG_t28.
DR   EnsemblGenomes-Gn; SPCG_t29.
DR   EnsemblGenomes-Gn; SPCG_t30.
DR   EnsemblGenomes-Gn; SPCG_t31.
DR   EnsemblGenomes-Gn; SPCG_t32.
DR   EnsemblGenomes-Gn; SPCG_t33.
DR   EnsemblGenomes-Gn; SPCG_t34.
DR   EnsemblGenomes-Gn; SPCG_t35.
DR   EnsemblGenomes-Gn; SPCG_t36.
DR   EnsemblGenomes-Gn; SPCG_t37.
DR   EnsemblGenomes-Gn; SPCG_t38.
DR   EnsemblGenomes-Gn; SPCG_t39.
DR   EnsemblGenomes-Gn; SPCG_t40.
DR   EnsemblGenomes-Gn; SPCG_t41.
DR   EnsemblGenomes-Gn; SPCG_t42.
DR   EnsemblGenomes-Gn; SPCG_t43.
DR   EnsemblGenomes-Gn; SPCG_t44.
DR   EnsemblGenomes-Gn; SPCG_t45.
DR   EnsemblGenomes-Gn; SPCG_t46.
DR   EnsemblGenomes-Gn; SPCG_t47.
DR   EnsemblGenomes-Gn; SPCG_t48.
DR   EnsemblGenomes-Gn; SPCG_t49.
DR   EnsemblGenomes-Gn; SPCG_t50.
DR   EnsemblGenomes-Gn; SPCG_t51.
DR   EnsemblGenomes-Gn; SPCG_t52.
DR   EnsemblGenomes-Gn; SPCG_t53.
DR   EnsemblGenomes-Gn; SPCG_t54.
DR   EnsemblGenomes-Gn; SPCG_t55.
DR   EnsemblGenomes-Gn; SPCG_t56.
DR   EnsemblGenomes-Gn; SPCG_t57.
DR   EnsemblGenomes-Gn; SPCG_t58.
DR   EnsemblGenomes-Tr; EBT00001727029.
DR   EnsemblGenomes-Tr; EBT00001727030.
DR   EnsemblGenomes-Tr; EBT00001727031.
DR   EnsemblGenomes-Tr; EBT00001727032.
DR   EnsemblGenomes-Tr; EBT00001727033.
DR   EnsemblGenomes-Tr; EBT00001727034.
DR   EnsemblGenomes-Tr; EBT00001727035.
DR   EnsemblGenomes-Tr; EBT00001727036.
DR   EnsemblGenomes-Tr; EBT00001727037.
DR   EnsemblGenomes-Tr; EBT00001727038.
DR   EnsemblGenomes-Tr; EBT00001727039.
DR   EnsemblGenomes-Tr; EBT00001727040.
DR   EnsemblGenomes-Tr; EBT00001727041.
DR   EnsemblGenomes-Tr; EBT00001727042.
DR   EnsemblGenomes-Tr; EBT00001727043.
DR   EnsemblGenomes-Tr; EBT00001727044.
DR   EnsemblGenomes-Tr; EBT00001727045.
DR   EnsemblGenomes-Tr; EBT00001727046.
DR   EnsemblGenomes-Tr; EBT00001727047.
DR   EnsemblGenomes-Tr; EBT00001727048.
DR   EnsemblGenomes-Tr; EBT00001727049.
DR   EnsemblGenomes-Tr; EBT00001727050.
DR   EnsemblGenomes-Tr; EBT00001727051.
DR   EnsemblGenomes-Tr; EBT00001727052.
DR   EnsemblGenomes-Tr; EBT00001727053.
DR   EnsemblGenomes-Tr; EBT00001727054.
DR   EnsemblGenomes-Tr; EBT00001727055.
DR   EnsemblGenomes-Tr; EBT00001727056.
DR   EnsemblGenomes-Tr; EBT00001727057.
DR   EnsemblGenomes-Tr; EBT00001727058.
DR   EnsemblGenomes-Tr; EBT00001727059.
DR   EnsemblGenomes-Tr; EBT00001727060.
DR   EnsemblGenomes-Tr; EBT00001727061.
DR   EnsemblGenomes-Tr; EBT00001727062.
DR   EnsemblGenomes-Tr; EBT00001727063.
DR   EnsemblGenomes-Tr; EBT00001727064.
DR   EnsemblGenomes-Tr; EBT00001727065.
DR   EnsemblGenomes-Tr; EBT00001727066.
DR   EnsemblGenomes-Tr; EBT00001727067.
DR   EnsemblGenomes-Tr; EBT00001727068.
DR   EnsemblGenomes-Tr; EBT00001727069.
DR   EnsemblGenomes-Tr; EBT00001727070.
DR   EnsemblGenomes-Tr; EBT00001727071.
DR   EnsemblGenomes-Tr; EBT00001727072.
DR   EnsemblGenomes-Tr; EBT00001727073.
DR   EnsemblGenomes-Tr; EBT00001727074.
DR   EnsemblGenomes-Tr; EBT00001727075.
DR   EnsemblGenomes-Tr; EBT00001727076.
DR   EnsemblGenomes-Tr; EBT00001727077.
DR   EnsemblGenomes-Tr; EBT00001727078.
DR   EnsemblGenomes-Tr; EBT00001727079.
DR   EnsemblGenomes-Tr; EBT00001727080.
DR   EnsemblGenomes-Tr; EBT00001727081.
DR   EnsemblGenomes-Tr; EBT00001727082.
DR   EnsemblGenomes-Tr; EBT00001727083.
DR   EnsemblGenomes-Tr; EBT00001727084.
DR   EnsemblGenomes-Tr; EBT00001727085.
DR   EnsemblGenomes-Tr; EBT00001727086.
DR   EnsemblGenomes-Tr; EBT00001727087.
DR   EnsemblGenomes-Tr; EBT00001727088.
DR   EnsemblGenomes-Tr; EBT00001727089.
DR   EnsemblGenomes-Tr; EBT00001727090.
DR   EnsemblGenomes-Tr; EBT00001727091.
DR   EnsemblGenomes-Tr; EBT00001727092.
DR   EnsemblGenomes-Tr; EBT00001727093.
DR   EnsemblGenomes-Tr; EBT00001727094.
DR   EnsemblGenomes-Tr; EBT00001727095.
DR   EnsemblGenomes-Tr; EBT00001727096.
DR   EnsemblGenomes-Tr; EBT00001727097.
DR   EnsemblGenomes-Tr; EBT00001727098.
DR   EnsemblGenomes-Tr; EBT00001727099.
DR   EnsemblGenomes-Tr; EBT00001727100.
DR   EnsemblGenomes-Tr; EBT00001727101.
DR   EnsemblGenomes-Tr; EBT00001727102.
DR   EnsemblGenomes-Tr; EBT00001727103.
DR   EnsemblGenomes-Tr; EBT00001727104.
DR   EnsemblGenomes-Tr; EBT00001727105.
DR   EnsemblGenomes-Tr; EBT00001727106.
DR   EnsemblGenomes-Tr; EBT00001727107.
DR   EnsemblGenomes-Tr; EBT00001727108.
DR   EnsemblGenomes-Tr; EBT00001727109.
DR   EnsemblGenomes-Tr; EBT00001727110.
DR   EnsemblGenomes-Tr; EBT00001727111.
DR   EnsemblGenomes-Tr; EBT00001727112.
DR   EnsemblGenomes-Tr; EBT00001727113.
DR   EnsemblGenomes-Tr; EBT00001727114.
DR   EnsemblGenomes-Tr; EBT00001727115.
DR   EnsemblGenomes-Tr; EBT00001727116.
DR   EnsemblGenomes-Tr; EBT00001727117.
DR   EnsemblGenomes-Tr; EBT00001727118.
DR   EnsemblGenomes-Tr; EBT00001727119.
DR   EnsemblGenomes-Tr; EBT00001727120.
DR   EnsemblGenomes-Tr; EBT00001727121.
DR   EnsemblGenomes-Tr; EBT00001727122.
DR   EnsemblGenomes-Tr; EBT00001727123.
DR   EnsemblGenomes-Tr; EBT00001727124.
DR   EnsemblGenomes-Tr; EBT00001727125.
DR   EnsemblGenomes-Tr; EBT00001727126.
DR   EnsemblGenomes-Tr; EBT00001727127.
DR   EnsemblGenomes-Tr; EBT00001727128.
DR   EnsemblGenomes-Tr; EBT00001727129.
DR   EnsemblGenomes-Tr; EBT00001727130.
DR   EnsemblGenomes-Tr; EBT00001727131.
DR   EnsemblGenomes-Tr; EBT00001727132.
DR   EnsemblGenomes-Tr; EBT00001727133.
DR   EnsemblGenomes-Tr; EBT00001727134.
DR   EnsemblGenomes-Tr; EBT00001727135.
DR   EnsemblGenomes-Tr; EBT00001727136.
DR   EnsemblGenomes-Tr; SPCG_s01-1.
DR   EnsemblGenomes-Tr; SPCG_s02-1.
DR   EnsemblGenomes-Tr; SPCG_s03-1.
DR   EnsemblGenomes-Tr; SPCG_s04-1.
DR   EnsemblGenomes-Tr; SPCG_s05-1.
DR   EnsemblGenomes-Tr; SPCG_s06-1.
DR   EnsemblGenomes-Tr; SPCG_s07-1.
DR   EnsemblGenomes-Tr; SPCG_s08-1.
DR   EnsemblGenomes-Tr; SPCG_s09-1.
DR   EnsemblGenomes-Tr; SPCG_s10-1.
DR   EnsemblGenomes-Tr; SPCG_s11-1.
DR   EnsemblGenomes-Tr; SPCG_s12-1.
DR   EnsemblGenomes-Tr; SPCG_t01-1.
DR   EnsemblGenomes-Tr; SPCG_t02-1.
DR   EnsemblGenomes-Tr; SPCG_t03-1.
DR   EnsemblGenomes-Tr; SPCG_t04-1.
DR   EnsemblGenomes-Tr; SPCG_t05-1.
DR   EnsemblGenomes-Tr; SPCG_t06-1.
DR   EnsemblGenomes-Tr; SPCG_t07-1.
DR   EnsemblGenomes-Tr; SPCG_t08-1.
DR   EnsemblGenomes-Tr; SPCG_t09-1.
DR   EnsemblGenomes-Tr; SPCG_t10-1.
DR   EnsemblGenomes-Tr; SPCG_t11-1.
DR   EnsemblGenomes-Tr; SPCG_t12-1.
DR   EnsemblGenomes-Tr; SPCG_t13-1.
DR   EnsemblGenomes-Tr; SPCG_t14-1.
DR   EnsemblGenomes-Tr; SPCG_t15-1.
DR   EnsemblGenomes-Tr; SPCG_t16-1.
DR   EnsemblGenomes-Tr; SPCG_t17-1.
DR   EnsemblGenomes-Tr; SPCG_t18-1.
DR   EnsemblGenomes-Tr; SPCG_t19-1.
DR   EnsemblGenomes-Tr; SPCG_t20-1.
DR   EnsemblGenomes-Tr; SPCG_t21-1.
DR   EnsemblGenomes-Tr; SPCG_t22-1.
DR   EnsemblGenomes-Tr; SPCG_t23-1.
DR   EnsemblGenomes-Tr; SPCG_t24-1.
DR   EnsemblGenomes-Tr; SPCG_t25-1.
DR   EnsemblGenomes-Tr; SPCG_t26-1.
DR   EnsemblGenomes-Tr; SPCG_t27-1.
DR   EnsemblGenomes-Tr; SPCG_t28-1.
DR   EnsemblGenomes-Tr; SPCG_t29-1.
DR   EnsemblGenomes-Tr; SPCG_t30-1.
DR   EnsemblGenomes-Tr; SPCG_t31-1.
DR   EnsemblGenomes-Tr; SPCG_t32-1.
DR   EnsemblGenomes-Tr; SPCG_t33-1.
DR   EnsemblGenomes-Tr; SPCG_t34-1.
DR   EnsemblGenomes-Tr; SPCG_t35-1.
DR   EnsemblGenomes-Tr; SPCG_t36-1.
DR   EnsemblGenomes-Tr; SPCG_t37-1.
DR   EnsemblGenomes-Tr; SPCG_t38-1.
DR   EnsemblGenomes-Tr; SPCG_t39-1.
DR   EnsemblGenomes-Tr; SPCG_t40-1.
DR   EnsemblGenomes-Tr; SPCG_t41-1.
DR   EnsemblGenomes-Tr; SPCG_t42-1.
DR   EnsemblGenomes-Tr; SPCG_t43-1.
DR   EnsemblGenomes-Tr; SPCG_t44-1.
DR   EnsemblGenomes-Tr; SPCG_t45-1.
DR   EnsemblGenomes-Tr; SPCG_t46-1.
DR   EnsemblGenomes-Tr; SPCG_t47-1.
DR   EnsemblGenomes-Tr; SPCG_t48-1.
DR   EnsemblGenomes-Tr; SPCG_t49-1.
DR   EnsemblGenomes-Tr; SPCG_t50-1.
DR   EnsemblGenomes-Tr; SPCG_t51-1.
DR   EnsemblGenomes-Tr; SPCG_t52-1.
DR   EnsemblGenomes-Tr; SPCG_t53-1.
DR   EnsemblGenomes-Tr; SPCG_t54-1.
DR   EnsemblGenomes-Tr; SPCG_t55-1.
DR   EnsemblGenomes-Tr; SPCG_t56-1.
DR   EnsemblGenomes-Tr; SPCG_t57-1.
DR   EnsemblGenomes-Tr; SPCG_t58-1.
DR   EuropePMC; PMC2678160; 19361343.
DR   EuropePMC; PMC2907686; 19656368.
DR   EuropePMC; PMC3043496; 21147955.
DR   EuropePMC; PMC3067147; 21263055.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC4202715; 25368607.
DR   EuropePMC; PMC5073339; 27767072.
DR   EuropePMC; PMC6328646; 30643873.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001033.
DR   SILVA-SSU; CP001033.
XX
CC   Source DNA is available from Department of Pediatrics, Chang Gung
CC   Children's Hospital, Taiwan. Contact: C.-H. Chiu
CC   (chchiu@adm.cgmh.org.tw).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2209198
FT                   /organism="Streptococcus pneumoniae CGSP14"
FT                   /strain="CGSP14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:516950"
FT   gene            197..1558
FT                   /gene="dnaA"
FT                   /locus_tag="SPCG_0001"
FT   CDS_pept        197..1558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SPCG_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89253"
FT                   /db_xref="GOA:B2IQY9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IQY9"
FT                   /protein_id="ACB89253.1"
FT                   /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFLP
FT                   RSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYDYSPK
FT                   LVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLGKTH
FT                   LLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLIDDIQS
FT                   LSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQTITPP
FT                   DFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVKKIKDIT
FT                   IDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVLARQVAMY
FT                   LSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKKKIK"
FT   gene            1717..2853
FT                   /gene="dnaN"
FT                   /locus_tag="SPCG_0002"
FT   CDS_pept        1717..2853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPCG_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89254"
FT                   /db_xref="GOA:B2IQZ0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ0"
FT                   /protein_id="ACB89254.1"
FT                   /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTIKIDVTNEGITL
FT                   IGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQI
FT                   VLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILT
FT                   GVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETV
FT                   EIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLL
FT                   SSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKA
FT                   LNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
FT   gene            2864..3112
FT                   /locus_tag="SPCG_0003"
FT   CDS_pept        2864..3112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89255"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ1"
FT                   /protein_id="ACB89255.1"
FT                   /translation="MSLARLFYDIIEKEKESSMYQVGNFVEMKKPHACTIKSTGKKANR
FT                   WEITRVGADIKIKCSNCEHVVMMGRYDFERKMNKIID"
FT   gene            3187..4311
FT                   /locus_tag="SPCG_0004"
FT   CDS_pept        3187..4311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0004"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89256"
FT                   /db_xref="GOA:B2IQZ2"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ2"
FT                   /protein_id="ACB89256.1"
FT                   /translation="MRNMALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVG
FT                   MVEVPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIV
FT                   HVVRAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKD
FT                   KESVAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVVS
FT                   EPDSIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDKLT
FT                   RAAYHLLGLGTYFTAGEKEVRAWTFKRGMKAPQAAGIIHSDFEKGFIRAVTMSYEDLVK
FT                   YGSEKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   gene            4382..4951
FT                   /gene="pth"
FT                   /locus_tag="SPCG_0005"
FT   CDS_pept        4382..4951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SPCG_0005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89257"
FT                   /db_xref="GOA:B2IQZ3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IQZ3"
FT                   /protein_id="ACB89257.1"
FT                   /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQ
FT                   ADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRL
FT                   RAKGSAGGHNGIKSIIQHIGTHVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQS
FT                   VDKVDDSVNYYLQEKNFEKTMQRYNG"
FT   gene            4952..8461
FT                   /gene="mfd"
FT                   /locus_tag="SPCG_0006"
FT   CDS_pept        4952..8461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SPCG_0006"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89258"
FT                   /db_xref="GOA:B2IQZ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ4"
FT                   /protein_id="ACB89258.1"
FT                   /translation="MVTLLDLFSENDQIKKWHQSLTDKKRQLILGLSTSTKALAIASSL
FT                   EKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRVEA
FT                   LRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENGYRK
FT                   VTQVQTQGEFSLRGDILDIFEMSQLEPCRIEFFGDEIDGIRSFEVETQLSKENKIELTI
FT                   FPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRKFLSLC
FT                   YDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDMQYFSDI
FT                   EQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIERYKKMDYT
FT                   IILQSSNSMGSKTLEDMLEEYQIKLDSRDKTSICKESVNLIEGNLRHGFHFVDEKILLI
FT                   TEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGIETIEIKGIH
FT                   RDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAKQKVKNQVEDI
FT                   ADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEIKRDMQASQPMD
FT                   RLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFKERFQNFAVNVDV
FT                   LSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMIIDEEQRFGVKHKET
FT                   LKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLEKNDSVIRD
FT                   AVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGRMSEVQLENTLLDFIE
FT                   GQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRP
FT                   EKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLGKSQSGFIDSVGFELYSQ
FT                   LLEEAIAKRNGNANANTRTKGNAELVLQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVN
FT                   YEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRVERKDNKITIQFEKVTQRLF
FT                   LAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEILEGLLIFGESLLEIKEFKEE
FT                   NSI"
FT   gene            8519..8785
FT                   /locus_tag="SPCG_0007"
FT   CDS_pept        8519..8785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0007"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89259"
FT                   /db_xref="GOA:B2IQZ5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ5"
FT                   /protein_id="ACB89259.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVND
FT                   QVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
FT   gene            8778..9146
FT                   /locus_tag="SPCG_0008"
FT   CDS_pept        8778..9146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89260"
FT                   /db_xref="GOA:B2IQZ6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ6"
FT                   /protein_id="ACB89260.1"
FT                   /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLF
FT                   ILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKY
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            9197..10534
FT                   /locus_tag="SPCG_0009"
FT   CDS_pept        9197..10534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89261"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ7"
FT                   /protein_id="ACB89261.1"
FT                   /translation="MKSWKNWLIKINYCVYKKKRKGRMRKFLIILLLPSFLTISKVVST
FT                   EKEVVYTSKEIYYLSQSDFGIYFREKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQI
FT                   TEWRLNKQGIPVFKLSNHQFIAADKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEV
FT                   KSSLSAYSQVSIDKTMFVEGREFLHIDQAGWVAKESTSEEDNRMSKVQEMLSEKYQKDS
FT                   FSIYVKQLTTGKEAGINQDEKMYAASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVND
FT                   FPGSYKPEGSGSLPKKEDNKEYSLKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKM
FT                   SAIMGDDWDPKEKLISSKMAGKFMEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHK
FT                   IGDADEFKHDTGVVYADSPFILSIFTKNSDYDTISKIAKDVYEVLK"
FT   gene            10531..11808
FT                   /locus_tag="SPCG_0010"
FT   CDS_pept        10531..11808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0010"
FT                   /product="mesJ/ycf62 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89262"
FT                   /db_xref="GOA:B2IQZ8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IQZ8"
FT                   /protein_id="ACB89262.1"
FT                   /translation="MREQDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQKE
FT                   LEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDFFQ
FT                   EVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFLHFQ
FT                   KKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYDLAIA
FT                   ELSNNIDVENLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKSQYRHP
FT                   IKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEGELIQQI
FT                   PVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFGEIVSILG
FT                   IATNNLSKKTKNDIMNTVLYIEKIDR"
FT   gene            11812..12354
FT                   /gene="hgt"
FT                   /locus_tag="SPCG_0011"
FT   CDS_pept        11812..12354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgt"
FT                   /locus_tag="SPCG_0011"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89263"
FT                   /db_xref="GOA:B2IQZ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQZ9"
FT                   /protein_id="ACB89263.1"
FT                   /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKGS
FT                   IPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDIIDT
FT                   GQTLKNLRDMFKEREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDYKEN
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            12370..14328
FT                   /gene="ftsH"
FT                   /locus_tag="SPCG_0012"
FT   CDS_pept        12370..14328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SPCG_0012"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89264"
FT                   /db_xref="GOA:B2IR00"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR00"
FT                   /protein_id="ACB89264.1"
FT                   /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYTE
FT                   LVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTILP
FT                   ADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGGGNG
FT                   RNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPA
FT                   IIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGRVAEEIIFNV
FT                   QTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMFGAQNPQKSISEQTAYEID
FT                   EEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYETGKMPEAVEEE
FT                   SHALSYDEVKSKMNDEK"
FT   gene            14450..14929
FT                   /gene="comX1"
FT                   /locus_tag="SPCG_0013"
FT   CDS_pept        14450..14929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX1"
FT                   /locus_tag="SPCG_0013"
FT                   /product="transcriptional regulator ComX1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89265"
FT                   /db_xref="GOA:B2IMI0"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMI0"
FT                   /protein_id="ACB89265.1"
FT                   /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISRE
FT                   EGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGELSHRISEGGLWLD
FT                   DYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
FT   gene            15023..15094
FT                   /locus_tag="SPCG_t01"
FT                   /note="tRNA-Glu-1"
FT   tRNA            15023..15094
FT                   /locus_tag="SPCG_t01"
FT                   /product="tRNA-Glu"
FT   gene            15392..16803
FT                   /locus_tag="SPCG_s01"
FT   rRNA            15392..16803
FT                   /locus_tag="SPCG_s01"
FT                   /product="16S ribosomal RNA"
FT   gene            16942..17014
FT                   /locus_tag="SPCG_t02"
FT                   /note="tRNA-Ala-1"
FT   tRNA            16942..17014
FT                   /locus_tag="SPCG_t02"
FT                   /product="tRNA-Ala"
FT   gene            17139..20035
FT                   /locus_tag="SPCG_s02"
FT   rRNA            17139..20035
FT                   /locus_tag="SPCG_s02"
FT                   /product="23S ribosomal RNA"
FT   gene            20105..20252
FT                   /locus_tag="SPCG_s03"
FT   rRNA            20105..20252
FT                   /locus_tag="SPCG_s03"
FT                   /product="5S ribosomal RNA"
FT   gene            20233..20306
FT                   /locus_tag="SPCG_t03"
FT                   /note="tRNA-Asn-1"
FT   tRNA            20233..20306
FT                   /locus_tag="SPCG_t03"
FT                   /product="tRNA-Asn"
FT   gene            20396..20743
FT                   /locus_tag="SPCG_0014"
FT   CDS_pept        20396..20743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0014"
FT                   /product="IS630-Spn1, transposase Orf1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89266"
FT                   /db_xref="GOA:B2IR02"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR02"
FT                   /protein_id="ACB89266.1"
FT                   /translation="MWYNLFMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWL
FT                   KLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAM
FT                   GYTRKKEPHLL"
FT   gene            21451..21588
FT                   /locus_tag="SPCG_0015"
FT   CDS_pept        21451..21588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89267"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR03"
FT                   /protein_id="ACB89267.1"
FT                   /translation="MKGVDDFLFIFEEGFKQGGKARADRDYSGVSSLRNSSKVYLEFLY
FT                   "
FT   gene            complement(21494..21598)
FT                   /locus_tag="SPCG_0016"
FT   CDS_pept        complement(21494..21598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89268"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR04"
FT                   /protein_id="ACB89268.1"
FT                   /translation="MHLTNKEILDKLLSYSEDLKHHYNLYQLLLFHPV"
FT   gene            complement(21822..22028)
FT                   /locus_tag="SPCG_0017"
FT   CDS_pept        complement(21822..22028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89269"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR05"
FT                   /protein_id="ACB89269.1"
FT                   /translation="MRVAETSIVKKNHQIPCIINQKIAQKLIKKTSMTDIDHQLSISTS
FT                   TVIRKINDFHFEHDFSRLPEIMS"
FT   gene            22338..22580
FT                   /locus_tag="SPCG_0018"
FT   CDS_pept        22338..22580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89270"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR06"
FT                   /protein_id="ACB89270.1"
FT                   /translation="MIMLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLV
FT                   RYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC"
FT   gene            22769..24097
FT                   /gene="purA"
FT                   /locus_tag="SPCG_0019"
FT   CDS_pept        22769..24097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SPCG_0019"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89271"
FT                   /db_xref="GOA:B2IR07"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR07"
FT                   /protein_id="ACB89271.1"
FT                   /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVIA
FT                   RYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHEEG
FT                   VTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIAD
FT                   LLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTSVILN
FT                   DALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVVGVCKA
FT                   YTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNL
FT                   SLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSEDITGVRN
FT                   LEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWF"
FT   gene            24298..24765
FT                   /locus_tag="SPCG_0020"
FT   CDS_pept        24298..24765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0020"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89272"
FT                   /db_xref="GOA:B2IR08"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR08"
FT                   /protein_id="ACB89272.1"
FT                   /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGH
FT                   NAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVY
FT                   GAKNQKFGAAGSLYDILTDERLNHRVEVEIGILEDKCAAIMQDFFRNRRKK"
FT   gene            24951..25394
FT                   /gene="dut"
FT                   /locus_tag="SPCG_0021"
FT   CDS_pept        24951..25394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="SPCG_0021"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89273"
FT                   /db_xref="GOA:B2IR09"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR09"
FT                   /protein_id="ACB89273.1"
FT                   /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEIV
FT                   LVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFAQMKN
FT                   ITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
FT   gene            25354..25911
FT                   /locus_tag="SPCG_0022"
FT   CDS_pept        25354..25911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89274"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR10"
FT                   /protein_id="ACB89274.1"
FT                   /translation="MAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGFGIDLAPL
FT                   SEMRRQQVQKLSKTPLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQVYK
FT                   TGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAHRML
FT                   MRQFVPNEKIDFCQVIECELEI"
FT   gene            26024..27286
FT                   /gene="radA"
FT                   /locus_tag="SPCG_0023"
FT   CDS_pept        26024..27286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SPCG_0023"
FT                   /product="DNA repair: sensitivity to gamma and UV
FT                   radiation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89275"
FT                   /db_xref="GOA:B2IR11"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR11"
FT                   /protein_id="ACB89275.1"
FT                   /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFN
FT                   RVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYISGEESAQQIKLRAERL
FT                   GDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAE
FT                   LMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFG
FT                   STNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPT
FT                   MFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVA
FT                   IASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITL
FT                   PKEIQVIGVTTIQEVLKKVFA"
FT   gene            27290..27856
FT                   /locus_tag="SPCG_0024"
FT   CDS_pept        27290..27856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89276"
FT                   /db_xref="GOA:B2IR12"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR12"
FT                   /protein_id="ACB89276.1"
FT                   /translation="MTNSLKNDKIGEIFDYQIFKEGIVSYFEQFMQANQAYVALHGQLN
FT                   LPLKPKTRVAIVTCMDSRLHVAQALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGT
FT                   REIVVLHHTDCGAQTFENEPFQEYLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESP
FT                   LIPDDVIISGAIYNVDTGSMTVVEL"
FT   gene            27877..28221
FT                   /locus_tag="SPCG_0025"
FT   CDS_pept        27877..28221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89277"
FT                   /db_xref="GOA:B2IR13"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR13"
FT                   /protein_id="ACB89277.1"
FT                   /translation="MYEEKQYFIFILLLCIGLQYETIYYTDGSRSGAEYGLMGVSIFLA
FT                   LFYMIPALYFLFRIGKKWELPKKVLILSLLGGMFLSGWLSSFANTYIHDFMNCTPKVRQ
FT                   KKSNFWGVLL"
FT   gene            28203..28754
FT                   /locus_tag="SPCG_0026"
FT   CDS_pept        28203..28754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89278"
FT                   /db_xref="GOA:B2IR14"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR14"
FT                   /protein_id="ACB89278.1"
FT                   /translation="MGCFIMKLSYEDKVQIYELRKQGQSFKQLSKRFGVDVSGLKYMVK
FT                   LIDRYGIEIVKKGKNRHYSSKLKQEMMDKALLEGCSQRSISLDYALPNQGMLSFWPAQY
FT                   KKNGYTIVEKTRGRPAKMGRKRKKTWEEMTELERLQEENERLRTEVAYLKKLKELEERD
FT                   EALERERQRQLEKWFQEDFD"
FT   gene            28730..29569
FT                   /locus_tag="SPCG_0027"
FT   CDS_pept        28730..29569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0027"
FT                   /product="IS3-Spn1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89279"
FT                   /db_xref="GOA:B2IR15"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR15"
FT                   /protein_id="ACB89279.1"
FT                   /translation="MVSGGFRLDFLLETARLARSTYYYQLKQLDGVDKDKEIKTEIQGI
FT                   DNEHKGNYGYRRIHLELRNRGFVVNHKKVQRLMRILGLTARIRRKRKYSSYQGEIGKKA
FT                   ENLIQRQFEASRPMEKCYTDVTEFAIPNSTQKLYLSPVLDGFNSEIIAYHLSTSPNLEQ
FT                   VKSMLEQAFTEKYYENTILHSDQGWQYQHDSYHRFLESKGIQASMSRKGNSPDNSMMES
FT                   FFGILKSEMFYGYEKNFRSLENLEQAIVDYIDYYNNKRIKVKLKGLSSVQYRTKSFG"
FT   gene            29575..30135
FT                   /locus_tag="SPCG_0028"
FT   CDS_pept        29575..30135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0028"
FT                   /product="predicted repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89280"
FT                   /db_xref="GOA:B2IR16"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR16"
FT                   /protein_id="ACB89280.1"
FT                   /translation="MSNFLGSVHLLGVLFPDSTFLNAFESAIVAPLVEESLKLLPLVFV
FT                   LALIPVRKLKSLFLLGIASGLGFQMIEDIGYIHTDLPEGFDFTISRILERIISGIASHW
FT                   TFSGLAVVGVYLLYRAYKGQKVGKKQGLIFLGLALGTHFLFNSPFVELETELPLAIPVV
FT                   TAIALYGFYHAYCFVEKHNELMT"
FT   gene            30229..31248
FT                   /gene="prsA"
FT                   /locus_tag="SPCG_0029"
FT   CDS_pept        30229..31248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="SPCG_0029"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89281"
FT                   /db_xref="GOA:B2IR17"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR17"
FT                   /protein_id="ACB89281.1"
FT                   /translation="MENLVKSTSYTYIPEEIMSFSDLKLFALSSNKELAERVAQEIGIE
FT                   LGKSSVRQFSDGEIQVNIEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESV
FT                   NVVMPYYGYARQDRKARAREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDH
FT                   LMGAPLIADYFERRGMVGSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNT
FT                   SEVMNIIGKVEGKTCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDN
FT                   IQKSAIKKLVVLDTIYLPEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
FT   gene            31366..31719
FT                   /locus_tag="SPCG_0030"
FT   CDS_pept        31366..31719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89282"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR18"
FT                   /protein_id="ACB89282.1"
FT                   /translation="MTVRHPGISPTNDLVAKKIFSNPEITCQFIRDMLDLPAQNVTILE
FT                   GSNIHVLLSMPYSVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQ
FT                   NLEKIRQREGDTH"
FT   gene            31938..32120
FT                   /locus_tag="SPCG_0031"
FT   CDS_pept        31938..32120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0031"
FT                   /product="competence-induced protein Ccs16"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89283"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR19"
FT                   /protein_id="ACB89283.1"
FT                   /translation="MEFFGNKPFTQQPQRAITQANQLLDYKSWSEEDRKMFSQLHMREE
FT                   QVLLAQDYAKVLNKD"
FT   gene            32865..35534
FT                   /gene="polA"
FT                   /locus_tag="SPCG_0032"
FT   CDS_pept        32865..35534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SPCG_0032"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89284"
FT                   /db_xref="GOA:B2IR20"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR20"
FT                   /protein_id="ACB89284.1"
FT                   /translation="MVFFDSFLYNGCMDKKKLLLIDGSSVAFRAFFALYQQLDRFKNVA
FT                   GLHTNAIYGFQLMLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQ
FT                   FPFIRELLDHMGIRHYDLAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTV
FT                   VEISKKGVSEFEAFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLL
FT                   LEHGSLEGIYENIDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGP
FT                   DVENLGKFYDEMGFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGEN
FT                   YHTDNLVGFAWSCGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDL
FT                   QAPAFDIRLAKYLLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHL
FT                   ACKLAVLVETEPILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAE
FT                   NELVIEKLTQEIYELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLER
FT                   LAPIAPIVKKILDYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNL
FT                   QNIPARLEQGRLIRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIH
FT                   TSTAMRVFGIERPDDVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTYF
FT                   ERFPGIKNYMDEVVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQGS
FT                   AADILKIAMIQLDKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAIQL
FT                   SVPLIADENEGATWYEAK"
FT   gene            35619..36056
FT                   /locus_tag="SPCG_0033"
FT   CDS_pept        35619..36056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89285"
FT                   /db_xref="GOA:B2IR21"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR21"
FT                   /protein_id="ACB89285.1"
FT                   /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQA
FT                   RGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKI
FT                   FWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
FT   gene            complement(35958..36563)
FT                   /locus_tag="SPCG_0034"
FT   CDS_pept        complement(35958..36563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89286"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR22"
FT                   /protein_id="ACB89286.1"
FT                   /translation="MPSSSPALVCRPLSAFSNTLRKSLQTTSTSPCRRYMLLTSSVLSA
FT                   TSKRCFELTSSVLSATSKRCFELTSSVLSATSKRCFELTSSVLSATSKRCFELTSSVLS
FT                   ATSKRCFELTSSVLSATSKRCFELTSSVLSTTSKQCFEQPAASFLVCSLIFIEYNTKGS
FT                   PSATFFLCFLNQASMFSLDTAIHHDIITSTITQNLFRF"
FT   gene            complement(36511..37533)
FT                   /locus_tag="SPCG_0035"
FT   CDS_pept        complement(36511..37533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0035"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89287"
FT                   /db_xref="GOA:B2IR23"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR23"
FT                   /protein_id="ACB89287.1"
FT                   /translation="MEVFMSFLSKNGAGILVCLLISIVSWYLGGFFPVIGAPVFAIFMG
FT                   MLLHPFLSSYKQLDVGLTFSSKKLLQYAVILLGFGLNISQVFAVGQSSLPVILSTISIA
FT                   LIVAYLFQRFFALDTKLATLIGVGSSICGGSAIAATAPVIHAKEKEVAQAISVIFFFNV
FT                   LAALIFPTLGTWLHLSSDGFALFAGTAVNDTSSVTATASAWDSLYQTNTLESATIVKLT
FT                   RTLAIIPITLFLSYWQSREQKNKQGLQLKKVFPLFILHFILASLLTTLLTSLGVSSSFF
FT                   TPLKQLSKFLIIMGMSAIGLKTNLVAMVKSSGKSIVLGAVCWIAIILTSLGMQTLIGIF
FT                   "
FT   gene            37670..38839
FT                   /locus_tag="SPCG_0036"
FT   CDS_pept        37670..38839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89288"
FT                   /db_xref="GOA:B2IR24"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR24"
FT                   /protein_id="ACB89288.1"
FT                   /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTTP
FT                   DHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATEAL
FT                   SATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAILEQ
FT                   GDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEVFVVCDEVYSELTYTGEAHVSLG
FT                   TMLRDQAIIINGLSKSHAMTGWRLGLIFAPATFTAQLIKSHQYLVTAANTMAQHAAVEA
FT                   LTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQDSFAFLK
FT                   DFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
FT   gene            complement(38770..39486)
FT                   /locus_tag="SPCG_0037"
FT   CDS_pept        complement(38770..39486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89290"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR25"
FT                   /protein_id="ACB89290.1"
FT                   /translation="MLDSRLERNGLQSLKINSLKLIEQIGDIGIEMTTSLILMIMLWTE
FT                   AGSIFERKVKSLTNPMAEDTLIKIEADSKSSQNLNFKNIGQNLIIQACFHQLQSLLQKS
FT                   KQGSILLIVLQTSICKSCHIGRIGHDKEVTINLGKSHDLMIVFDVTESVIIDSQEKSCQ
FT                   HQGLNNRRQLRLTSVFDKKHAFANLLCKNFDELVILTKIAIVKHQALTRDRLNHASLMY
FT                   SSSRFMASLIVSMLAA"
FT   gene            38836..39606
FT                   /gene="recO"
FT                   /locus_tag="SPCG_0038"
FT   CDS_pept        38836..39606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SPCG_0038"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89289"
FT                   /db_xref="GOA:B2IR26"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IR26"
FT                   /protein_id="ACB89289.1"
FT                   /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSK
FT                   LAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQ
FT                   DNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAF
FT                   DFSFKYGACLCPEHYHEDKRRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQF
FT                   MDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
FT   gene            39603..40595
FT                   /gene="plsX"
FT                   /locus_tag="SPCG_0039"
FT   CDS_pept        39603..40595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SPCG_0039"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89291"
FT                   /db_xref="GOA:B2IR27"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IR27"
FT                   /protein_id="ACB89291.1"
FT                   /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIKQ
FT                   YLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTGAL
FT                   LAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSFYAK
FT                   NVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVADVVV
FT                   ADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLNYSDVG
FT                   GAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
FT   gene            40601..40834
FT                   /gene="acpP"
FT                   /locus_tag="SPCG_0040"
FT   CDS_pept        40601..40834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SPCG_0040"
FT                   /product="acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89292"
FT                   /db_xref="GOA:B2IR28"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR28"
FT                   /protein_id="ACB89292.1"
FT                   /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEFI
FT                   LTLEDEFSIEISDEEIDQLQSVGDVVKIIQGK"
FT   gene            40877..40969
FT                   /locus_tag="SPCG_0041"
FT   CDS_pept        40877..40969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0041"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89293"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR29"
FT                   /protein_id="ACB89293.1"
FT                   /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTST"
FT   gene            41079..41171
FT                   /locus_tag="SPCG_0042"
FT   CDS_pept        41079..41171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0042"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89294"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR30"
FT                   /protein_id="ACB89294.1"
FT                   /translation="MFSTTYRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            41373..41603
FT                   /locus_tag="SPCG_0043"
FT   CDS_pept        41373..41603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0043"
FT                   /product="bacteriocin BlpU"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89295"
FT                   /db_xref="GOA:B2IR31"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR31"
FT                   /protein_id="ACB89295.1"
FT                   /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQL
FT                   GIKTRTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            42291..44471
FT                   /gene="comA"
FT                   /locus_tag="SPCG_0044"
FT   CDS_pept        42291..44471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="SPCG_0044"
FT                   /product="competence factor transporting
FT                   ATP-binding/permease protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89296"
FT                   /db_xref="GOA:B2IR32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR32"
FT                   /protein_id="ACB89296.1"
FT                   /translation="MSIREKEMNMKFGKRHYRPQVDQMDCGVASLAMIFGYYGSYYFLA
FT                   HLRELAKTTMDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLL
FT                   HYYVVTGQDKDSIHIADPDPGVKLTKLPRERFEEEWTGVTLFMAPSPDYKPYKEQKNGL
FT                   LSFIPILVKQRGLIANIVLATLLVIGINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLV
FT                   IVYILQQILSYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDA
FT                   NSIIDALASTILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEK
FT                   MNRDTMEANAVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQ
FT                   QKALKKVAHLLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQ
FT                   TAQVANNRLNEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVP
FT                   QGSKVAFVGISGSGKTTLAKMMVNFYDPSQGEISLGGVNLNQIDKKALRQYINYLPQQP
FT                   YVFNGTILENLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISGGQ
FT                   RQRIALARALLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAERTE
FT                   KVVVLDQGKIVEEGKHADLLAQGGFYAHLVNS"
FT   gene            44484..45833
FT                   /gene="comB"
FT                   /locus_tag="SPCG_0045"
FT   CDS_pept        44484..45833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="SPCG_0045"
FT                   /product="competence factor transport protein ComB"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89297"
FT                   /db_xref="GOA:B2IR33"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR33"
FT                   /protein_id="ACB89297.1"
FT                   /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKEM
FT                   SLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESYAS
FT                   QLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQNETI
FT                   ASQNAAASQTQAEIGNLISQTEAKIRDYQTAKSAIETGASLAGQNLAYSLYQSYKSQGE
FT                   ENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQHLAKV
FT                   GQELTLLAQKILEAESGKKVQGNLLDKGKVTASEDGVLHLNPETSDSSMVAEGALLAQL
FT                   YPSLEREGKAKLTAYLSSKYVARIKVGDSVRYTTTHDAGNQLFLDSTITSIDATATKTE
FT                   KGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
FT   gene            45961..46710
FT                   /gene="purC"
FT                   /locus_tag="SPCG_0046"
FT   CDS_pept        45961..46710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SPCG_0046"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89298"
FT                   /db_xref="GOA:B2IR34"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR34"
FT                   /protein_id="ACB89298.1"
FT                   /translation="MVKCAQVIRKANFKMSKQLIYSGKAKDIYTTEDENLIISTYKDQA
FT                   TAFNGVKKEQIAGKGVLNNQISSFIFEKLNVAGVATHFVEKLSDTEQLNKKVKIIPLEV
FT                   VLRNYTAGSFSKRFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAY
FT                   LKEETRRINELLKVWFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHM
FT                   DKDVFRRGLGELTDVYEIVWEKLQELK"
FT   gene            46909..50637
FT                   /gene="purL"
FT                   /locus_tag="SPCG_0047"
FT   CDS_pept        46909..50637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="SPCG_0047"
FT                   /product="phosphoribosylformylglycinamidine synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89299"
FT                   /db_xref="GOA:B2IR35"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR35"
FT                   /protein_id="ACB89299.1"
FT                   /translation="MMDKRIFVEKKADFQVKSESLVRELQHNLGLSSLKSIRIVQVYDV
FT                   FDLAEDLFAPAEKHIFSEQGTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQEA
FT                   LLLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFSES
FT                   DKTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVLDTY
FT                   WSDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMATIFG
FT                   RYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAAT
FT                   CIGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGYSSYGNQ
FT                   IGLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGKTGRDGVG
FT                   GATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDFGAGGVCVA
FT                   IGELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDTFVAECNKENIDA
FT                   VVVATVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKLPEERQTSAET
FT                   LESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEASVQKLPVQHGV
FT                   THTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWSKARFSYQEYFERMDKQ
FT                   AERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTADSRKVL
FT                   SPEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEASQADHKVTSASAVKYGGVVESL
FT                   ALATFGNYIGAEVTLPELKTALTAQLGGFVFTSPEEIAGVEKIGQTKADFTLTVNGVKL
FT                   DGHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKEKVEKPVVYIPVFPGTN
FT                   SEYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDKTNILFFAGGFSAADEPD
FT                   GSAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVKSGLLPYGNFEDANSTSPT
FT                   LFYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVSHGEGKFVVTAEEFAELRDN
FT                   GQIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQIIGKMGHSERYEDGLFQNIPG
FT                   NKDQHLFASAVKHFTGK"
FT   gene            50730..52172
FT                   /gene="purF"
FT                   /locus_tag="SPCG_0048"
FT   CDS_pept        50730..52172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SPCG_0048"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89300"
FT                   /db_xref="GOA:B2IR36"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR36"
FT                   /protein_id="ACB89300.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGIL
FT                   SNDQGQLKRHRDMGLLSEVFRNPANLDKLTGAGAIGHVRYATAGEASVDNIQPFLFRFH
FT                   DMQFGLAHNGNLTNAASLKKELEQRGAIFSATSDSEILAHLIRRSHNPSLMGKIKEALS
FT                   LVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWIRDLK
FT                   PGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGAQLARE
FT                   FKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAYPCFYGID
FT                   IQTRQELIAANHTVEETRQIIGADSLTYLSIDSLIESIGIETDAPNGGLCVAYFDGDYP
FT                   TPLYDYEEDYRRSLEEKTSFYK"
FT   gene            52209..53231
FT                   /gene="purM"
FT                   /locus_tag="SPCG_0049"
FT   CDS_pept        52209..53231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SPCG_0049"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89301"
FT                   /db_xref="GOA:B2IR37"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IR37"
FT                   /protein_id="ACB89301.1"
FT                   /translation="MANKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFGG
FT                   MFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYVATGKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVVEGDVLLGLASSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLKEVLL
FT                   EPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVLPIFKA
FT                   LEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKENESVIIK
FT                   "
FT   gene            53228..53773
FT                   /gene="purN"
FT                   /locus_tag="SPCG_0050"
FT   CDS_pept        53228..53773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SPCG_0050"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89302"
FT                   /db_xref="GOA:B2IR38"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR38"
FT                   /protein_id="ACB89302.1"
FT                   /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLGV
FT                   LSYAFELKEFESKTDYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIHPA
FT                   YLPEFPGAHGIEDAWNAGVGQSGVTIHWVDSGVDTGHVIKQVRVPRLADDTIDRFEARI
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            53857..54366
FT                   /gene="vanZ"
FT                   /locus_tag="SPCG_0051"
FT   CDS_pept        53857..54366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanZ"
FT                   /locus_tag="SPCG_0051"
FT                   /product="vanZ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89303"
FT                   /db_xref="GOA:B2IR39"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR39"
FT                   /protein_id="ACB89303.1"
FT                   /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYINW
FT                   IPFSEPLIVDGKIVFAEMLFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFECLQ
FT                   YILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLVLLL
FT                   LHLIGV"
FT   gene            54370..55938
FT                   /gene="purH"
FT                   /locus_tag="SPCG_0052"
FT   CDS_pept        54370..55938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SPCG_0052"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89304"
FT                   /db_xref="GOA:B2IR40"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR40"
FT                   /protein_id="ACB89304.1"
FT                   /translation="MIKKENIMTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVA
FT                   LDNAGVDTIAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDL
FT                   VVVNLYPFKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDE
FT                   LAANGETSYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQPMRYG
FT                   ENPQQDADFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDSPTVVALK
FT                   HMNPCGIGQADDIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPS
FT                   YTDEALAILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQV
FT                   VTKRQPTETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQAK
FT                   DRLDGAVLASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFTGV
FT                   RHFRH"
FT   gene            56060..57322
FT                   /gene="purD"
FT                   /locus_tag="SPCG_0053"
FT   CDS_pept        56060..57322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SPCG_0053"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89305"
FT                   /db_xref="GOA:B2IR41"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR41"
FT                   /protein_id="ACB89305.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLELV
FT                   NISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEWSK
FT                   DFAKEIMVKYGVPTATYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVADTVEQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGVIKEGRPYLGVLYAGLILTADGPK
FT                   VIEFNARFGDPETQIILPRLTSDFAQNITDILDSKGPNIMWTDKGVTLGVVVASKGYPL
FT                   DYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEAQASIYQE
FT                   LYQQKIEGLFYRTDIGSKAIK"
FT   gene            57579..57695
FT                   /locus_tag="SPCG_0054"
FT   CDS_pept        57579..57695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89306"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR42"
FT                   /protein_id="ACB89306.1"
FT                   /translation="MKERLDDNPIVQGNWKTLGFQFRHETPLVAAAVPHKLR"
FT   gene            57692..58213
FT                   /gene="purE"
FT                   /locus_tag="SPCG_0055"
FT   CDS_pept        57692..58213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SPCG_0055"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89307"
FT                   /db_xref="GOA:B2IR43"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2IR43"
FT                   /protein_id="ACB89307.1"
FT                   /translation="MIVEKEEKGEEMKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEK
FT                   KVVSAHRTPDLMFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRAL
FT                   SGVDSLYSIVQMPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALTNFAEEQGK
FT                   IAEESSNELI"
FT   gene            58161..59291
FT                   /gene="purK"
FT                   /locus_tag="SPCG_0056"
FT   CDS_pept        58161..59291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SPCG_0056"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89308"
FT                   /db_xref="GOA:B2IRD7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRD7"
FT                   /protein_id="ACB89308.1"
FT                   /translation="MLKNKEKSQRSRQMSSSKTIGIIGGGQLGQMMAISAIYMGHKVIA
FT                   LDPAADCPASRVAEIIVAPYNDVDALRQLADRCDVLTYESENVDADGLDAVIKDGQLPQ
FT                   GTDLLRISQNRIFEKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGH
FT                   GQKVIRSEVDLEAAYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNN
FT                   ILSKTIVPARISESLVDKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEIAPRPHNS
FT                   GHYSIEACDFSQFDTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEKYVAENPSAHL
FT                   HMYGKIEAKHNRKMGHVTLLSDVPDIVDDLGEGIDF"
FT   gene            59301..59528
FT                   /locus_tag="SPCG_0057"
FT   CDS_pept        59301..59528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89309"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRD8"
FT                   /protein_id="ACB89309.1"
FT                   /translation="MIQIIVNTIFEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPEN
FT                   YLAIYDVPLDTDLNTLDHYPSVFIGKEEFE"
FT   gene            59591..60889
FT                   /gene="purB"
FT                   /locus_tag="SPCG_0058"
FT   CDS_pept        59591..60889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SPCG_0058"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89310"
FT                   /db_xref="GOA:B2IRD9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRD9"
FT                   /protein_id="ACB89310.1"
FT                   /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKEDV
FT                   ALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPLLEADSEV
FT                   TSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
FT   gene            complement(60944..64969)
FT                   /gene="strH"
FT                   /locus_tag="SPCG_0059"
FT   CDS_pept        complement(60944..64969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strH"
FT                   /locus_tag="SPCG_0059"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89311"
FT                   /db_xref="GOA:B2IRE0"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE0"
FT                   /protein_id="ACB89311.1"
FT                   /translation="MTLVNIRNKIKALIYIIAINITMQSGGFAMKHEKQQRFSIRKYAV
FT                   GAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSENRTEETPKAELQPEAP
FT                   KTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEKETANKKAEEASPKK
FT                   EEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPETEAGKERAATVNEKLAKKKIVSID
FT                   AGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRA
FT                   IEKGTNDYYDDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQ
FT                   NPNFSYFGKESARTVNLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAK
FT                   GWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGS
FT                   FDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGL
FT                   NGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAA
FT                   DYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQET
FT                   VNNLTLTPEAQKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELGYSDVH
FT                   LLLGNDGLRFLLNDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVTELIE
FT                   YAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNFVKA
FT                   LIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAKER
FT                   ELQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGDW
FT                   YYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYK
FT                   EEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNL
FT                   NRNKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVI
FT                   KKENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAP
FT                   VTHKGDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFY
FT                   SVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQP
FT                   APSTAPAEESKALPQDPAPVVIEKKLPETGTHDSAGLVVAGLMATLAAYGLTKRKED"
FT   gene            complement(65196..65954)
FT                   /locus_tag="SPCG_0060"
FT   CDS_pept        complement(65196..65954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0060"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89312"
FT                   /db_xref="GOA:B2IRE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE1"
FT                   /protein_id="ACB89312.1"
FT                   /translation="MVKFSMEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTE
FT                   AELISMYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDD
FT                   KVTVLSIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPN
FT                   LEYYSSIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKL
FT                   ESTGQVLEYSETYKRSDYYKIEFISCDRDH"
FT   gene            66260..68047
FT                   /gene="bgaC"
FT                   /locus_tag="SPCG_0061"
FT   CDS_pept        66260..68047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaC"
FT                   /locus_tag="SPCG_0061"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89313"
FT                   /db_xref="GOA:B2IRE2"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE2"
FT                   /protein_id="ACB89313.1"
FT                   /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALG
FT                   FNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQNLGLYAIVRPSPFICAEWEFGGL
FT                   PAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGED
FT                   KAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQ
FT                   EFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGT
FT                   NFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLY
FT                   KESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEE
FT                   RLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHK
FT                   FLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEE
FT                   PKDTYLDLSEFGKGVAFVNRQNLGRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYK
FT                   EEIHLTRKPTLKHIKGENL"
FT   gene            68044..68520
FT                   /locus_tag="SPCG_0062"
FT   CDS_pept        68044..68520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0062"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89314"
FT                   /db_xref="GOA:B2IRE3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE3"
FT                   /protein_id="ACB89314.1"
FT                   /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKS
FT                   GLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNV
FT                   GNMSQTPETRSITRSINVVDKDVEAFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
FT   gene            68548..69453
FT                   /locus_tag="SPCG_0063"
FT   CDS_pept        68548..69453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0063"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89315"
FT                   /db_xref="GOA:B2IRE4"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE4"
FT                   /protein_id="ACB89315.1"
FT                   /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLVMGDV
FT                   TTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPVAA
FT                   LLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALAFGG
FT                   AFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLTAMLT
FT                   VLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHFKNSQK
FT                   VAVAAPSTPSESGEIEDDEF"
FT   gene            69425..70255
FT                   /locus_tag="SPCG_0064"
FT   CDS_pept        69425..70255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0064"
FT                   /product="PTS system, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89316"
FT                   /db_xref="GOA:B2IRE5"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE5"
FT                   /protein_id="ACB89316.1"
FT                   /translation="MGKSKMTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLY
FT                   MILPQLRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNG
FT                   IKTGLMGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQL
FT                   EFAYKEGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQ
FT                   DILNQIFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
FT   gene            70262..70666
FT                   /locus_tag="SPCG_0065"
FT   CDS_pept        70262..70666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0065"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89317"
FT                   /db_xref="GOA:B2IRE6"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE6"
FT                   /protein_id="ACB89317.1"
FT                   /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEEF
FT                   TAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINASLT
FT                   GADADYKSRAAESIVKVNDLLAGFDDDEDE"
FT   gene            70964..72124
FT                   /gene="agaS"
FT                   /locus_tag="SPCG_0066"
FT   CDS_pept        70964..72124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaS"
FT                   /locus_tag="SPCG_0066"
FT                   /product="sugar isomerase domain protein AgaS"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89318"
FT                   /db_xref="GOA:B2IRE7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE7"
FT                   /protein_id="ACB89318.1"
FT                   /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAAF
FT                   LQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPATYL
FT                   KKDVATILVSFARSGNSPESVATVDLAKSLVDELYQVTITCATDGKLALQAHGDDRNLL
FT                   LLQPAVSNDAGFAMTSSFTSMMLTALLVFDPTEFAVKSERFEVVSSLARKVLDKAEDVK
FT                   ELVDLDFNRVIYLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSLINDNT
FT                   VVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCGGVLNDI
FT                   YRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEY"
FT   gene            72246..73283
FT                   /gene="galM"
FT                   /locus_tag="SPCG_0067"
FT   CDS_pept        72246..73283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="SPCG_0067"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89319"
FT                   /db_xref="GOA:B2IRE8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE8"
FT                   /protein_id="ACB89319.1"
FT                   /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAP
FT                   DKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNC
FT                   NHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYK
FT                   VTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVV
FT                   KHIYNGALLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPC
FT                   FVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRY
FT                   ELVVK"
FT   gene            73490..74344
FT                   /locus_tag="SPCG_0068"
FT   CDS_pept        73490..74344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89320"
FT                   /db_xref="GOA:B2IRE9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRE9"
FT                   /protein_id="ACB89320.1"
FT                   /translation="MTYEYKSHIYLAETVLNVKDLASQTTFYQQVIGLEILSQTETESI
FT                   LGLGGKVLVQLIQAQESGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGADH
FT                   GYSEAIYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEALAAQDIYELGERVEPFIL
FT                   AEGTRMGHIHLSVKDSRKSSQFYQKVLGLENKFSVPGASWIAAGDYHHHLAVNEWGGKG
FT                   LASRKQGLPGLAYYVIEVAHKEELLTIAQRAQEVDVPIKWMTSSQLEITDSDGIVTRIR
FT                   LAR"
FT   gene            74494..74751
FT                   /locus_tag="SPCG_0069"
FT   CDS_pept        74494..74751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89321"
FT                   /db_xref="GOA:B2IRF0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF0"
FT                   /protein_id="ACB89321.1"
FT                   /translation="MTNSKYITCLKRSEGQLCGIQKMIEGDRDCADIVTQLTAVKSSVE
FT                   RVIEMIITENLTECINQPLDDSEAQKERLEKAIRYLIKRK"
FT   gene            complement(75209..75505)
FT                   /locus_tag="SPCG_0070"
FT   CDS_pept        complement(75209..75505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0070"
FT                   /product="rhodanese-like domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89322"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF1"
FT                   /protein_id="ACB89322.1"
FT                   /translation="METSISMADFYGKYQNENLELIDVREAHEFQAGHAPGAKNLPLST
FT                   LEQGYKELKPDHEYYVICQGGVRSASTCQFLSSQGLTVTNVEGGMNAWPGQVE"
FT   gene            complement(75495..75614)
FT                   /locus_tag="SPCG_0071"
FT   CDS_pept        complement(75495..75614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89323"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF2"
FT                   /protein_id="ACB89323.1"
FT                   /translation="MRSYIAEPILKQAGFTVQNLDGAYSLYKMANPEGVEYGN"
FT   gene            75726..76490
FT                   /locus_tag="SPCG_0072"
FT   CDS_pept        75726..76490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0072"
FT                   /product="phosphorylase, Pnp/Udp family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89324"
FT                   /db_xref="GOA:B2IRF3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF3"
FT                   /protein_id="ACB89324.1"
FT                   /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEID
FT                   RYAREVGANCVGEFVSATKTYPVYVVNYKDEEICLVQAPVGSAPAAQFMDWLIGYGVEQ
FT                   IISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPSRYMEMQPEAIAAIERVLDDRG
FT                   IPYEEVMTWSTDGFYRETAEKVAYRKDEDCAVVEMECSALAAVAQLRGVLWGELLFTAD
FT                   SLADLNQYDSRDWGSEAFNKALELSLASVHHL"
FT   gene            76746..76886
FT                   /locus_tag="SPCG_0073"
FT   CDS_pept        76746..76886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89325"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF4"
FT                   /protein_id="ACB89325.1"
FT                   /translation="MLLTSSVLSTTSKQCFEQPVTSFLIDALVLIAYNQKEKFSPEKHI
FT                   E"
FT   gene            77055..78434
FT                   /gene="trkH"
FT                   /locus_tag="SPCG_0074"
FT   CDS_pept        77055..78434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="SPCG_0074"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89326"
FT                   /db_xref="GOA:B2IRF5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF5"
FT                   /protein_id="ACB89326.1"
FT                   /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQV
FT                   ESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGVFY
FT                   IQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQLGW
FT                   GRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVWFDLA
FT                   GHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVLVSFFQ
FT                   TVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVFARSELL
FT                   GLPHANVARRTIASRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLVFETISAL
FT                   STVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIHYMKADISI
FT                   G"
FT   gene            78427..79113
FT                   /gene="trkA"
FT                   /locus_tag="SPCG_0075"
FT   CDS_pept        78427..79113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="SPCG_0075"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89327"
FT                   /db_xref="GOA:B2IRF6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF6"
FT                   /protein_id="ACB89327.1"
FT                   /translation="MVKKGKSMSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAER
FT                   INQFEPVLARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTV
FT                   IAKVKSQTAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIP
FT                   QSWAGQSLSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDT
FT                   LVALNS"
FT   gene            79248..79451
FT                   /locus_tag="SPCG_0076"
FT   CDS_pept        79248..79451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89328"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF7"
FT                   /protein_id="ACB89328.1"
FT                   /translation="MKIKDQTRKLATGCSKHCFEVVDRTDEVSSKHCFEVVDRTDEVSS
FT                   KHCFEVADRTDEVSNIYTARRR"
FT   gene            79513..80052
FT                   /locus_tag="SPCG_0077"
FT   CDS_pept        79513..80052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89329"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF8"
FT                   /protein_id="ACB89329.1"
FT                   /translation="MKLLSIAISSYNAAAYLHYCVESLVIGGEQVGILIINDGSQDQTQ
FT                   EIAECLASKYPNIVRAIYQENKCHGGAVNRGLAEASGRYFKVVDSDDWVDPRAYLKILE
FT                   TLQELESKGQEVDVFVTNFVYEKEGQSRKKSMSYDSVLPVRQIFGWDQVGNFSKGQYTM
FT                   MHSLIYRTDLLRASQF"
FT   gene            complement(79930..80499)
FT                   /locus_tag="SPCG_0079"
FT   CDS_pept        complement(79930..80499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89331"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRF9"
FT                   /protein_id="ACB89331.1"
FT                   /translation="MIDDIGQFAIWQDRMFGQTAQHGLTNSLKDFWIFLLNIGPQLAFF
FT                   CQMLRCSRSVEQGTGNHRRDFNMIQQIFSHFGMTHLGQIKLVYQESIDLELLVNALNHH
FT                   LLIDRLVLTPNQITIEIDRQIVHGLDLLKGRKDKEIIDIKSMFRQLELASTQQICPINQ
FT                   RVHHGILAFGEISDLVPAKNLPNRQD"
FT   gene            80119..80529
FT                   /locus_tag="SPCG_0078"
FT   CDS_pept        80119..80529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89330"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG0"
FT                   /protein_id="ACB89330.1"
FT                   /translation="MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLIDQLDL
FT                   SQVSHPKMREYLLNHIEITTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAIRK
FT                   TMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN"
FT   gene            80721..84131
FT                   /locus_tag="SPCG_0080"
FT   CDS_pept        80721..84131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0080"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89332"
FT                   /db_xref="GOA:B2IRG1"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021021"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG1"
FT                   /protein_id="ACB89332.1"
FT                   /translation="MASGFFVLVGQPSSVRADGLNPTPGQVLPEETSGTKEGDLSEKPG
FT                   DTVLTQAKPEGVTGNTNSLPTPTERTEVSEETSPSSLDTLFEKDEEAQKNPELTDVLKE
FT                   TVDTADVDGTQASPAETTPEQVKGGVKENTKDSIDVPAAYLEKAEGKGPFTAGVNQVIP
FT                   YELFAGDGMLTRLLLKASDNAPWSDNGTAKNPALPPLEGLTKGKYFYEVDLNGNTVGKQ
FT                   GQALIDQLRANGTQTYKATVKVYGNKDGKADLTNLVATKNVDININGLVAKETVEKAVK
FT                   DNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNG
FT                   EAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGN
FT                   KDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTA
FT                   GVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQLA
FT                   LDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTININGLIS
FT                   KETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKAS
FT                   DKAPWSDNGDAKNPALSPLGENVKTKGQYFYQLALDGNVAGKEKQALIDQFRANGTQTY
FT                   SATVNVYGNKDGKPDLDNIVATKKVTININGLISKETVQKAVADNVKDSIDVPAAYLEK
FT                   AKGEGPFTAGVNHVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKT
FT                   KGQYFYQLALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKV
FT                   TININGLISKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVNHVIPYELFAGDGM
FT                   LTRLLLKASDKAPWSDNGEAKNPALSPLGENVKTKGQYFYQVALDGNVAGKEKQALIDQ
FT                   FRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTIKINVKETSDTANGSLSPSNSGSG
FT                   VTPMNHNHATGTTDSMPADTMTSSTNTMAGENMAASANKMSDTMMSEDKAMLPNTGETQ
FT                   TSMASIGFLGLALAGLLGGLGLKNKKEEN"
FT   gene            84298..84996
FT                   /locus_tag="SPCG_0081"
FT   CDS_pept        84298..84996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0081"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89333"
FT                   /db_xref="GOA:B2IRG2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG2"
FT                   /protein_id="ACB89333.1"
FT                   /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKKK
FT                   PIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIAKP
FT                   FSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFELLWI
FT                   LASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTVWGLG
FT                   YKIEKPRGQT"
FT   gene            84993..86045
FT                   /locus_tag="SPCG_0082"
FT   CDS_pept        84993..86045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0082"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89334"
FT                   /db_xref="GOA:B2IRG3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG3"
FT                   /protein_id="ACB89334.1"
FT                   /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTIV
FT                   ASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSH
FT                   DLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLATIG
FT                   RQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHL
FT                   QVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVTKLEKGQLSISVTDEGQGI
FT                   APEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLV
FT                   LNLSGSENKA"
FT   gene            86240..86851
FT                   /gene="rpsD"
FT                   /locus_tag="SPCG_0083"
FT   CDS_pept        86240..86851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="SPCG_0083"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89335"
FT                   /db_xref="GOA:B2IRG4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IRG4"
FT                   /protein_id="ACB89335.1"
FT                   /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKLS
FT                   EYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRLGL
FT                   ATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATLGRP
FT                   AFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
FT   gene            complement(87072..87167)
FT                   /locus_tag="SPCG_0084"
FT   CDS_pept        complement(87072..87167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89336"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG5"
FT                   /protein_id="ACB89336.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYHKRLQIVL"
FT   gene            87238..87507
FT                   /locus_tag="SPCG_0085"
FT   CDS_pept        87238..87507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89337"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG6"
FT                   /protein_id="ACB89337.1"
FT                   /translation="MRSLTGVSNPTTDSARLVLAEAKKAFADDSLTEQGLRDILQTVKD
FT                   AIASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
FT   gene            87587..87682
FT                   /locus_tag="SPCG_0086"
FT   CDS_pept        87587..87682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89338"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG7"
FT                   /protein_id="ACB89338.1"
FT                   /translation="MFLADEKGSEHTEAEVIDNLKEVIAKLKANA"
FT   gene            87971..88930
FT                   /locus_tag="SPCG_0087"
FT   CDS_pept        87971..88930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0087"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89339"
FT                   /db_xref="GOA:B2IRG8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG8"
FT                   /protein_id="ACB89339.1"
FT                   /translation="MDIKIKREEIMKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFG
FT                   NVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLV
FT                   VSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLG
FT                   LKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRI
FT                   RNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQT
FT                   ADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
FT   gene            88893..89867
FT                   /locus_tag="SPCG_0088"
FT   CDS_pept        88893..89867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0088"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89340"
FT                   /db_xref="GOA:B2IRG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRG9"
FT                   /protein_id="ACB89340.1"
FT                   /translation="MQDESIQTQLCSRKEENMAKKKIKKEKIDNVGIHSFSKKADIFFS
FT                   IISGLIALSCILPFVFVIIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQAL
FT                   FISVFVTVVGTLTNVFITTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTR
FT                   VLQLGDTVWALIVPMLLSPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPL
FT                   SLPGIATITLLTALGFWNDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQL
FT                   GVALPKETGRMAMVVVATLPIAILYPFFQRYFVKGLTIGGVKE"
FT   gene            89908..91446
FT                   /locus_tag="SPCG_0089"
FT   CDS_pept        89908..91446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0089"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89341"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH0"
FT                   /protein_id="ACB89341.1"
FT                   /translation="MREVKIITLFISLKIKKGVFIMKNWKKYAFASASVVALAAGLAAC
FT                   GNLTGNSKKAADSGDKPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGD
FT                   YGKKMSVITSSGENYDIAFADNYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNT
FT                   VNGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVP
FT                   FAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYI
FT                   PKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQ
FT                   VANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYK
FT                   GNTHMGGWNTGNNWILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAI
FT                   ANTMQQFDTAINTGTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
FT   gene            91718..92704
FT                   /locus_tag="SPCG_0090"
FT   CDS_pept        91718..92704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89342"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IRH1"
FT                   /protein_id="ACB89342.1"
FT                   /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEG
FT                   INGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEENEQAFKKMFVRYKKEIVHLGLEDN
FT                   DFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRE
FT                   LPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQ
FT                   GELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENE
FT                   DKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
FT   gene            92886..93839
FT                   /locus_tag="SPCG_0091"
FT   CDS_pept        92886..93839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89343"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH2"
FT                   /protein_id="ACB89343.1"
FT                   /translation="MKRFSKSIKFVFVSFRKIRYTVCKRFQRSPVMAKTFFIPNKQSIL
FT                   GEQEILNAKSILALLDGLESHSYDVVYLRQPLNRLEYIECAIVGQSQFLFKVSYADGQK
FT                   AYRVDLPDLLTKTDWQIIKSFLDALLAYTGTDIEGLDGFDFEAYFQASIQAYLADPVAR
FT                   FTICQGIFNPIFFSRENLKSFLEADGLAQFEARVRAVQETDAYFARVSFYQDGEGKVYG
FT                   VYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQITGDGSKPEDYESIARLDYA
FT                   KFLEVLPPSFYHQLDANQIEIQPILGQDFKTLAQEK"
FT   gene            complement(93911..94975)
FT                   /locus_tag="SPCG_0092"
FT   CDS_pept        complement(93911..94975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89344"
FT                   /db_xref="GOA:B2IRH3"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH3"
FT                   /protein_id="ACB89344.1"
FT                   /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEERITDLDTPIEKN
FT                   TQLEEEVSQAEVELESQQEEKIEAPEDSEARTEIEEKKASNSTEEEPDLSKETEKVTIA
FT                   EESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPT
FT                   SKLETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSI
FT                   VSILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAF
FT                   FDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAE
FT                   VALIGDYLRILAFL"
FT   gene            complement(95038..96000)
FT                   /locus_tag="SPCG_0093"
FT   CDS_pept        complement(95038..96000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89345"
FT                   /db_xref="GOA:B2IRH4"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH4"
FT                   /protein_id="ACB89345.1"
FT                   /translation="MFVWYNLFLKKEREVISMRKWTKGFLIFGVVTTVIGFILLFVGIQ
FT                   SDGIKSLLSMSKEPVYDSRTEKLTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSL
FT                   SAHHDLITNQNDRTLSLTDKKLSETPFLSSGIGGILHIASSYSSRFEEVILQLPKGRTL
FT                   KGINISANRGQTTIINASLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDS
FT                   QLESTENHFHAENIQVHGKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKP
FT                   ESRGTELSNPYKTEKTDVKDQLIARSDDNIDLISTPSRR"
FT   gene            complement(95942..96535)
FT                   /locus_tag="SPCG_0094"
FT   CDS_pept        complement(95942..96535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89346"
FT                   /db_xref="GOA:B2IRH5"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH5"
FT                   /protein_id="ACB89346.1"
FT                   /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGIEGEEELI
FT                   ASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTL
FT                   FAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSL
FT                   VLLGISYVTRFFGLLIVRLVQFVLKKGKRGNQHA"
FT   gene            complement(96522..96848)
FT                   /locus_tag="SPCG_0095"
FT   CDS_pept        complement(96522..96848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89347"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH6"
FT                   /protein_id="ACB89347.1"
FT                   /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYP
FT                   ILKKLEGNSFLTTYSRECQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIR
FT                   HDKN"
FT   gene            complement(96987..98153)
FT                   /locus_tag="SPCG_0096"
FT   CDS_pept        complement(96987..98153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0096"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89348"
FT                   /db_xref="GOA:B2IRH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH7"
FT                   /protein_id="ACB89348.1"
FT                   /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLG
FT                   VLTSLPLLMFTLFSPFSTRLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVG
FT                   ASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILL
FT                   LTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMT
FT                   WLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVV
FT                   GISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGY
FT                   ILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
FT   gene            98211..99368
FT                   /locus_tag="SPCG_0097"
FT   CDS_pept        98211..99368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0097"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89349"
FT                   /db_xref="GOA:B2IRH8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH8"
FT                   /protein_id="ACB89349.1"
FT                   /translation="MSSKVSGFQDKNGKVLKIMIEWWKEKFRRVVVTQNVESLLVSIVI
FT                   SAYNEEKYLPGLIEDLKNQTYPKENIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLY
FT                   NNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTETFVMNNVAIIQQGEFVCGGPRPTIV
FT                   EGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGR
FT                   TEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLHQKYSNGLWIGLTSHVQFKCLS
FT                   LFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPF
FT                   LLFSIHFAYGFGTIVGLIRGFKWKKEYKGTIIYLDKISQINQNML"
FT   gene            99410..101260
FT                   /locus_tag="SPCG_0098"
FT   CDS_pept        99410..101260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0098"
FT                   /product="capsular polysaccharide biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89350"
FT                   /db_xref="GOA:B2IRH9"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRH9"
FT                   /protein_id="ACB89350.1"
FT                   /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFY
FT                   GLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLSYS
FT                   ICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDG
FT                   GALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVA
FT                   IPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRL
FT                   DESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRK
FT                   FQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTY
FT                   NVAKAVDEAKVSKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNV
FT                   LGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDM
FT                   GKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVG
FT                   KVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
FT   gene            complement(101346..101603)
FT                   /locus_tag="SPCG_0099"
FT   CDS_pept        complement(101346..101603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89351"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI0"
FT                   /protein_id="ACB89351.1"
FT                   /translation="MKIKEQTRKLAAGCSKHCFEVADRTDEVSSKHCFKVVDGTDEVSS
FT                   KHCFEVVDRTDEVSSKHCFEVVDRTDEVSNHIRQGDVDVV"
FT   gene            complement(101653..102285)
FT                   /locus_tag="SPCG_0100"
FT   CDS_pept        complement(101653..102285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0100"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89352"
FT                   /db_xref="GOA:B2IRI1"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI1"
FT                   /protein_id="ACB89352.1"
FT                   /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRG
FT                   FMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYI
FT                   TTTKDTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIIIGDT
FT                   KFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
FT   gene            complement(102307..103179)
FT                   /locus_tag="SPCG_0101"
FT   CDS_pept        complement(102307..103179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0101"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89353"
FT                   /db_xref="GOA:B2IRI2"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI2"
FT                   /protein_id="ACB89353.1"
FT                   /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMER
FT                   NLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHN
FT                   AKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGA
FT                   EGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVK
FT                   RNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGR
FT                   RLQKEIFGE"
FT   gene            complement(103188..103859)
FT                   /locus_tag="SPCG_0102"
FT   CDS_pept        complement(103188..103859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0102"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89354"
FT                   /db_xref="GOA:B2IRI3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI3"
FT                   /protein_id="ACB89354.1"
FT                   /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTE
FT                   VEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSN
FT                   APHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGM
FT                   IALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFF
FT                   K"
FT   gene            104101..104688
FT                   /locus_tag="SPCG_0103"
FT   CDS_pept        104101..104688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0103"
FT                   /product="lysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89355"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI4"
FT                   /protein_id="ACB89355.1"
FT                   /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSE
FT                   IAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSA
FT                   PVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYS
FT                   AENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
FT   gene            complement(104740..105060)
FT                   /locus_tag="SPCG_0104"
FT   CDS_pept        complement(104740..105060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89356"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI5"
FT                   /protein_id="ACB89356.1"
FT                   /translation="MQRLEVYKNYQHLYDLRIAILLNLSTLYLYNQDKNMCKQICYTLL
FT                   EDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETSMLSHLKKEVEIYYQAK
FT                   ER"
FT   gene            105486..105773
FT                   /locus_tag="SPCG_0105"
FT   CDS_pept        105486..105773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0105"
FT                   /product="bacteriocin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89357"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI6"
FT                   /protein_id="ACB89357.1"
FT                   /translation="MRKLVKIGVASLMVCGILATTNALAVWVEGGQWNYGVGWTGTFGY
FT                   SDYLHSTRYHTATVRHGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE"
FT   gene            105792..107933
FT                   /locus_tag="SPCG_0106"
FT   CDS_pept        105792..107933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89358"
FT                   /db_xref="GOA:B2IRI7"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI7"
FT                   /protein_id="ACB89358.1"
FT                   /translation="MERENCSGGTFMKKISNFCMLLLLLCTTFFVFNVNYTREVVRIQE
FT                   MGKTVDSLDLYLKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPY
FT                   QEFGISSLDFTTDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRY
FT                   TITSTQEMDKDRIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLV
FT                   LVTVYQPMMEMKRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPK
FT                   DLFPMLWLSHFLLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTI
FT                   LLTALLIGVGRSLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYF
FT                   YRFYQDLVEKTQAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLP
FT                   DTGIKKVILMPASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSF
FT                   FPYSDKRKENLSNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEK
FT                   LSDGNYLKFSSIQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRD
FT                   IITKKFMGWKLVDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVLG
FT                   LASRMEKRSLVELLKGGIL"
FT   gene            107930..108571
FT                   /locus_tag="SPCG_0107"
FT   CDS_pept        107930..108571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0107"
FT                   /product="amino acid ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89359"
FT                   /db_xref="GOA:B2IRI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI8"
FT                   /protein_id="ACB89359.1"
FT                   /translation="MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLN
FT                   LLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLAL
FT                   KYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADE
FT                   PTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
FT   gene            108676..109584
FT                   /locus_tag="SPCG_0108"
FT   CDS_pept        108676..109584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0108"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89360"
FT                   /db_xref="GOA:B2IRI9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRI9"
FT                   /protein_id="ACB89360.1"
FT                   /translation="MFQIENFFNLGLTKDEYRSIIYTIKKNKHKGGFVMNKMKKVLMTM
FT                   FGLVMLPLLFACSNNQSAGIEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIEL
FT                   AKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKN
FT                   KLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKS
FT                   GQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQK
FT                   LKESGELDKLIEDAFKASIEK"
FT   gene            109550..110020
FT                   /locus_tag="SPCG_0109"
FT   CDS_pept        109550..110020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0109"
FT                   /product="argininosuccinate synthase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89361"
FT                   /db_xref="GOA:B2IRJ0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ0"
FT                   /protein_id="ACB89361.1"
FT                   /translation="MRMPLKRPLKNRKKEKNMSKEKVILAYSGGLDTSVAITWLKKDYD
FT                   VVAVCMDVGEGKDLDFIHDKALKVGAVESYVIDVKDEFATDYVLVALQSHAYYEQKYPL
FT                   VSALSRPLISKKLVEIAHQIGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
FT   gene            complement(110309..111208)
FT                   /locus_tag="SPCG_0110"
FT   CDS_pept        complement(110309..111208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89362"
FT                   /db_xref="GOA:B2IRJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ1"
FT                   /protein_id="ACB89362.1"
FT                   /translation="MFVNFFHEKEKIMRYDFGKVYKEIRESKGLTQEEVCGGVLSRTSL
FT                   SKIESGKTTPKYENMEFLLRQINMSFEEFEYICQLYQPSQRTEIMQTYLNMRSIIGTSD
FT                   LVNLFQKCQDYLKTHHDLPIEEIRDMLEVVIYIRQHGAGELSDHAEQVVKKLWRKIEKQ
FT                   DTWYESDLKILNTILFSFPIEYLHLITGKILQRLEVYKNYQHLYDLRIAILLNLSTLYL
FT                   YNQDKNMCKQICYTLLEDAKNKKSYDRLAICYVRIGICTDDSKLIQKGFSLLELTEETS
FT                   MLSHLKKEVEIYYQAKER"
FT   gene            111626..111976
FT                   /locus_tag="SPCG_0111"
FT   CDS_pept        111626..111976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0111"
FT                   /product="transporter, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89363"
FT                   /db_xref="GOA:B2IRJ2"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ2"
FT                   /protein_id="ACB89363.1"
FT                   /translation="MSISMLKKYPCTMQHDQSDCAAAVVSTVLLSYKKELSIMKIREII
FT                   GTDMYGTTVSGIVSGLNKLNFTVKAVRVALEDLTPKLTFPAILQVKNDLGQNHFVVLHS
FT                   IKEKINGTRITK"
FT   gene            111954..112325
FT                   /locus_tag="SPCG_0112"
FT   CDS_pept        111954..112325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89364"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ3"
FT                   /protein_id="ACB89364.1"
FT                   /translation="MELVLPNNYVVIDEEEMMYLDGGAIYIPRWAITGAITGAAYAALA
FT                   AAGGGGLQLVLASYGLRSALVAGIVKGLGVLGIHIGNAFANTVIRSIASAGIGAGADWI
FT                   FTNIIDGWDGRRDNQLRIG"
FT   gene            112919..113044
FT                   /locus_tag="SPCG_0113"
FT   CDS_pept        112919..113044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89365"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ4"
FT                   /protein_id="ACB89365.1"
FT                   /translation="MATITNALNIAATVAEVFSLGGAIAYGLDIVDGKFDGYLWA"
FT   gene            113427..114485
FT                   /locus_tag="SPCG_0114"
FT   CDS_pept        113427..114485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89366"
FT                   /db_xref="GOA:B2IRJ5"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ5"
FT                   /protein_id="ACB89366.1"
FT                   /translation="MKDDQKYLLAGLYSLLVAIFYFPLIDSKGIFVSILMAVLLLYLIY
FT                   FIATVIHIVIIKFIRKKSFKYLVLYPFTYDGSWRFQPINLLYFPEMVRDVIPINLVQEY
FT                   CQGQPYGLLKKMLKRIRLSREIALLLATIIVYFFTHRILPLSVFTFMFSYILLFVQSYL
FT                   GSNTAWIGNRRLIIDDEFEKILLSKSYVKEISSARYSEYLTCEYKNLTPIILIAIFENL
FT                   LDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYDNEALR
FT                   DLSKQYLNKNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCVPSQYDRFFYKDR
FT                   PYIFSRKSPIKG"
FT   gene            114800..115777
FT                   /locus_tag="SPCG_0115"
FT   CDS_pept        114800..115777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89367"
FT                   /db_xref="GOA:B2IRJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ6"
FT                   /protein_id="ACB89367.1"
FT                   /translation="MKNKRYFFDTILIILLLISTIFCVSPVFIKLDILGTPSHAILTFV
FT                   LAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLMGFSPG
FT                   IAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKSLLLPLIPFSIIIALVQKLY
FT                   RIENQQLFLLKSKVLTILESKRDCEFNLQDYHEIWKLQSKSELPCVALSYISLIKPYLS
FT                   ESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLNKILEVRPD
FT                   FVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYIGIKHVSIRR"
FT   gene            116135..116509
FT                   /locus_tag="SPCG_0116"
FT   CDS_pept        116135..116509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89368"
FT                   /db_xref="GOA:B2IRJ7"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ7"
FT                   /protein_id="ACB89368.1"
FT                   /translation="MELVLPNNYVVLEQEEMMYLDGGFSIPRWPVATAINIAFNGVLGV
FT                   GAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGDAI
FT                   TTIWANNDVNRRDPNLNALW"
FT   gene            116717..117619
FT                   /locus_tag="SPCG_0117"
FT   CDS_pept        116717..117619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89369"
FT                   /db_xref="GOA:B2IRJ8"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ8"
FT                   /protein_id="ACB89369.1"
FT                   /translation="MIRKPIIFLLMLPIWGLWIELHLLVSNLQLNLEIPFDFVVSTSLT
FT                   FFVLILSKIVLDILYALKDLYKKEALITIFPFIFIGRKKVNVRFSPYFSFHRKSLSPDD
FT                   LRSRIIWSFILEIAIILVFILKIPFAIIMLTTIFFWTIMDINHLVFNKTEFLFNQNKWQ
FT                   KEDSFESDLTKTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILKKIEDSH
FT                   NTLLCTGLVELLLYEISISNNNNWQEKVDKIRIQLIRINQLDFFYYTSWLRQNFDFCMN
FT                   REYHKMKSRKLLLSNKKIV"
FT   gene            117642..118007
FT                   /locus_tag="SPCG_0118"
FT   CDS_pept        117642..118007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89370"
FT                   /db_xref="GOA:B2IRJ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRJ9"
FT                   /protein_id="ACB89370.1"
FT                   /translation="MKQFQLRRRKQMELVLPNNYVVIDEEEMMYFDGGAYLSKRACQGI
FT                   CAALAMSSGTFIALAGAAVLTKKLINYIKVGGLGGWLIGAAAGKIAYYIGYGVLNRGCD
FT                   INGNPYPWDGFISATVR"
FT   gene            117974..118732
FT                   /locus_tag="SPCG_0119"
FT   CDS_pept        117974..118732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89371"
FT                   /db_xref="GOA:B2IRK0"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK0"
FT                   /protein_id="ACB89371.1"
FT                   /translation="MGWIHICNSKMSNVDKIRKIHIIVCWVYIFLSFRAIINDTEYFLL
FT                   IFLAFIYSIVSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFI
FT                   TELIIFHLIGKDFDIKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVD
FT                   NHVLTLIFLIKICVDTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKA
FT                   GYLFSVLLLFSNFSVPFIKEKEFELFKNSK"
FT   gene            120255..122084
FT                   /gene="pspA"
FT                   /locus_tag="SPCG_0120"
FT   CDS_pept        120255..122084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="SPCG_0120"
FT                   /product="pneumococcal surface protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89372"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK1"
FT                   /protein_id="ACB89372.1"
FT                   /translation="MNKKKMILTSLASVAILGAGFVASQPTVVRAEEAPVASQSKAEKD
FT                   YDAAMEKYKAAEEDLKKAEAAQRKYDEDQKKTEEKAKETEEASKRQQAANLKYQLKLRE
FT                   YLKYIQEKNKEKIAKAEKEMNEAKQEEDKEKANLNKVLAKVIPSDRELEKTRQEAEKAK
FT                   KNIPELKKKVEEAKQKVDAAKQKVDAEHAKEVAPQAKIAELENQVHRLEQDLKDINESD
FT                   SEDYVKEGLRAPLQSELDTKKAKLLKLEELSGKIEELDAEIAELEVQLKDAEGNNNVEA
FT                   YFKEGLEKTTAEKKAELEKAEADLKKAVDEPETPAPAPAPAPAPTPEAPAPAPAPAPAP
FT                   KPAPAPKPAPAPKPAPAPKPAPAPKPAPAPAPKPEKPAEKPAPAPKPETPKTGWKQENG
FT                   MWYFYNTDGSMATGWLQNNGSWYYLNANGAMATGWAKVNGLWYYLNSNGAMATGWLQYN
FT                   DSWYYLNTNGAMATGWLEYNGSWYYLNANGAMATGWLEYNGSWYYLNSNGAMATGWLQY
FT                   NGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKANQWF
FT                   KVSDKWYYVNGLGALAVNTTVDGYTVNENGEWV"
FT   gene            122431..123606
FT                   /gene="trmU"
FT                   /locus_tag="SPCG_0121"
FT   CDS_pept        122431..123606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="SPCG_0121"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89373"
FT                   /db_xref="GOA:B2IRK2"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IRK2"
FT                   /protein_id="ACB89373.1"
FT                   /translation="MKHTRPSIVNKRIDGRLTMSDNSKTRVVVGMSGGVDSSVTALLLK
FT                   EQGYDVIGIFMKNWDDTDENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEY
FT                   FLAEYRAGRTPNPDVMCNKEIKFKAFLDYAMTLGADYVATGHYARVVRDEDGTVHMLRG
FT                   VDNGKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRKLAEEAGLSTAKKKDSTGICFIGE
FT                   KNFKNFLSNYLPAQPGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVV
FT                   GKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTV
FT                   HVKGDKAEVIFTEPQRAITPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
FT   gene            123720..124202
FT                   /locus_tag="SPCG_0122"
FT   CDS_pept        123720..124202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0122"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89374"
FT                   /db_xref="GOA:B2IRK3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK3"
FT                   /protein_id="ACB89374.1"
FT                   /translation="MCRLRERTRMTQQDFRTKVDNTVFGVRATALILQNRKLLVTKDKG
FT                   KYYTIGGAIQVNEKTEDAVVREVKEELGVKSQAGQLAFVVENRFEVDGVSYHNIEFHYL
FT                   VDLLEDAPLTMQEDEKRQPCEWIDLDKLEDIQLVPAFLKTALPDWEGQLRHIHLEE"
FT   gene            124212..126125
FT                   /gene="gidA"
FT                   /locus_tag="SPCG_0123"
FT   CDS_pept        124212..126125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SPCG_0123"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89375"
FT                   /db_xref="GOA:B2IRK4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK4"
FT                   /protein_id="ACB89375.1"
FT                   /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEMLA
FT                   FMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQADKE
FT                   LYSKEMRKTVENQDNLTLRQTMIDEILVEDGKIVGVRTATHQEYAAKAVIVTTGTALRG
FT                   EIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTEIQPG
FT                   DEAPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVGPRYCP
FT                   SIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGLENAEMM
FT                   RTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGINAALKIQ
FT                   GKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMRLTEMGREI
FT                   GLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMDFKPLTDAVTAKEFLR
FT                   RPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMKRMEEKRIPAN
FT                   IDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEGKNRSISKTLQK
FT                   SK"
FT   gene            complement(126478..128157)
FT                   /locus_tag="SPCG_0124"
FT   CDS_pept        complement(126478..128157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0124"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89376"
FT                   /db_xref="GOA:B2IRK5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK5"
FT                   /protein_id="ACB89376.1"
FT                   /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPE
FT                   DDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLALAL
FT                   IRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKIVCT
FT                   GDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMKIIQG
FT                   IEGRIIFASFASNIFRLQQATEAAIKTGRKIAVFGRSMEKAIVNGIDLGYIKAPKGTFI
FT                   EPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSPIPGNTT
FT                   SVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLCLIKPKYFMPVHGEYRMQKV
FT                   HAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGEIGAAVLKD
FT                   RRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRILFNAIRIAL
FT                   KNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
FT   gene            complement(128159..128392)
FT                   /locus_tag="SPCG_0125"
FT   CDS_pept        complement(128159..128392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89377"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IRK6"
FT                   /protein_id="ACB89377.1"
FT                   /translation="MIYKVFYQETKERSPRRETTRALYLDIDASSELEGRITARQLVEE
FT                   NRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
FT   gene            128672..128779
FT                   /locus_tag="SPCG_0126"
FT   CDS_pept        128672..128779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89378"
FT                   /db_xref="GOA:B2IRK7"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK7"
FT                   /protein_id="ACB89378.1"
FT                   /translation="MYNLFAFAIGVRLLAFIVFVACVYEGNLLFAKLER"
FT   gene            complement(128802..128963)
FT                   /locus_tag="SPCG_0127"
FT   CDS_pept        complement(128802..128963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0127"
FT                   /product="competence-induced protein Ccs1, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89379"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK8"
FT                   /protein_id="ACB89379.1"
FT                   /translation="MGWNFRVVNLLSLHPQTKNPSISRASKHLIQSKIQTKRHRSRGGE
FT                   KASRESQR"
FT   gene            complement(129210..129362)
FT                   /locus_tag="SPCG_0128"
FT   CDS_pept        complement(129210..129362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89380"
FT                   /db_xref="GOA:B2IRK9"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRK9"
FT                   /protein_id="ACB89380.1"
FT                   /translation="MMKNLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRKK
FT                   FGKSC"
FT   gene            complement(129364..129549)
FT                   /locus_tag="SPCG_0129"
FT   CDS_pept        complement(129364..129549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89381"
FT                   /db_xref="GOA:B2IRL0"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL0"
FT                   /protein_id="ACB89381.1"
FT                   /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGT
FT                   ALIGSGLAAGYFLGGD"
FT   gene            129727..130410
FT                   /locus_tag="SPCG_0130"
FT   CDS_pept        129727..130410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89382"
FT                   /db_xref="GOA:B2IRL1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL1"
FT                   /protein_id="ACB89382.1"
FT                   /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDF
FT                   LMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTLNIELVGMSSLLALVPHQQ
FT                   EGLFVPLMDARRNNVYAGFYENSKPVMAEAHLPFERVIELIKGASQVTFVGEVGPFVEQ
FT                   IQKHLPRTDYKETLPNAANLALWAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESVES
FT                   YIKRL"
FT   gene            130407..130844
FT                   /gene="rimI"
FT                   /locus_tag="SPCG_0131"
FT   CDS_pept        130407..130844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="SPCG_0131"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89383"
FT                   /db_xref="GOA:B2IRL2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL2"
FT                   /protein_id="ACB89383.1"
FT                   /translation="MIEIKRIQQRPDLAQAIYAVMIAVYPINPWTLEQIQADLSQDQTW
FT                   YALAYDGAEVIGFLAVQENLFEAEVLQIAVKGAYQGQGIASALFAQLPTDKEIFLEVRQ
FT                   SNQRAQAFYKKEKMAVIAERKAYYHDPVEDAIIMKREIDEG"
FT   gene            130834..131844
FT                   /gene="gcp"
FT                   /locus_tag="SPCG_0132"
FT   CDS_pept        130834..131844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="SPCG_0132"
FT                   /product="glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89384"
FT                   /db_xref="GOA:B2IRL3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IRL3"
FT                   /protein_id="ACB89384.1"
FT                   /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGGV
FT                   VPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFAWA
FT                   HGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDELAHQGQDIYDFPRAMIKEDNLEFSFSGLKSAFINL
FT                   HHNAEQKGESLSTEDLCASFQAAVLDILMAKTKKALEKYPVKTLVVAGGVAANKGLRER
FT                   LAAEVTDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWNLNAKPSLAFDTME"
FT   gene            complement(131884..132270)
FT                   /locus_tag="SPCG_0133"
FT   CDS_pept        complement(131884..132270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0133"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89385"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL4"
FT                   /protein_id="ACB89385.1"
FT                   /translation="MHLTHREVRDKLLSYSEGLQVHYELYQLLLFHFQEKNADHFFGLI
FT                   EQELPTVHPLFQTVFWTFLRDRDKIINALKLPYSNAKLEATNNLIKVIKRKAFGFRNFN
FT                   NFKKRILMTLNIKKESTNFVLSRL"
FT   gene            complement(132477..133325)
FT                   /locus_tag="SPCG_0134"
FT   CDS_pept        complement(132477..133325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0134"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89386"
FT                   /db_xref="GOA:B2IRL5"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL5"
FT                   /protein_id="ACB89386.1"
FT                   /translation="MECFGSIISVVGNPTPGIIGSFLVEKKPHMTYNEKRLTNSLERVH
FT                   MEQLKNTTDLLGLEDKNIKILSVLKYQTHLVVQAKLDSPAPPCPHCQGKMIKYDFQKAS
FT                   KIPLLDCQGLPTVLHLKKRRFQCKNCLKVVVSQTSIVKKNCQISNMVRQKIAQLLLEKQ
FT                   SMTEIAHRLAVSTSTVIRKLREFKFETDWTKLPKVMSWDEYSFKKSKMSFIAQDFESKS
FT                   ILAILDGRTHAVIRNHFQRYQREVRELVEVITMDMYSPYYRLAKQLFPKAKIVLDRFHI
FT                   V"
FT   gene            134450..135013
FT                   /locus_tag="SPCG_0135"
FT   CDS_pept        134450..135013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89387"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL6"
FT                   /protein_id="ACB89387.1"
FT                   /translation="MVTMQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDP
FT                   HIIGLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNIL
FT                   KLLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWT
FT                   YSMGDAFICVSETMKKRLESIIKK"
FT   gene            135141..135602
FT                   /gene="epsG"
FT                   /locus_tag="SPCG_0136"
FT   CDS_pept        135141..135602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsG"
FT                   /locus_tag="SPCG_0136"
FT                   /product="glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89388"
FT                   /db_xref="GOA:B2IRL7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL7"
FT                   /protein_id="ACB89388.1"
FT                   /translation="MDPEKRPDRFLEFAEKLFLVREDVIFIMAGNGSMWAALKEKICHL
FT                   KCRDNFRLLGEIYPATIVYQISDLLYIPSDTEGIPMCVLESMSQGTPVLASNVGGLSEI
FT                   IEHRVDGFLFEKEDVEGVCACANFLLNDSEYLKYIGENSKSKIRKHESI"
FT   gene            135626..136579
FT                   /locus_tag="SPCG_0137"
FT   CDS_pept        135626..136579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0137"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89389"
FT                   /db_xref="GOA:B2IRL8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL8"
FT                   /protein_id="ACB89389.1"
FT                   /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIIDD
FT                   NYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDEYM
FT                   PDRILKLMACFKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIAGTS
FT                   FWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENGITGV
FT                   TQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKVIKKAR
FT                   EEKIFNEFLFLKYMLLYHFGFFYCIYDNYVQLKFRK"
FT   gene            136589..138205
FT                   /locus_tag="SPCG_0138"
FT   CDS_pept        136589..138205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0138"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89390"
FT                   /db_xref="GOA:B2IRL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRL9"
FT                   /protein_id="ACB89390.1"
FT                   /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMNL
FT                   ERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKS
FT                   SGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIML
FT                   LVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLK
FT                   MVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTGVIFTA
FT                   LGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNICYKYGDK
FT                   EILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNM
FT                   VSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNILDYYVGDD
FT                   GRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDREDLTVIIVTH
FT                   APHPELKQYFTKIYQFPKDFI"
FT   gene            138129..139070
FT                   /locus_tag="SPCG_0139"
FT   CDS_pept        138129..139070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89391"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM0"
FT                   /protein_id="ACB89391.1"
FT                   /translation="MLPMLRIRNLNNILLRYINFQRILFKNIGEGNMRFYCEAYEVITE
FT                   EKKVYFNDIELEVKYSSVEELFIICEKLLDKKKVSFFYVDEKPLRYLLFDYIFLLVLAK
FT                   KNIPILDGVSNKQVDPTLLHHFSLEIEKNFIDFCYKNMDLILKTQSISLCHREELIIVD
FT                   VSDDSKFGVFYKRFRTLVDKNNGKYVCVYNFSRVSDILQNWKNYCNRKFSVTFTESQFE
FT                   LFKLLYNQKNFKTISLLFGKKIVAGGIIYYSDLTNIEYFCIFWWDSMFGKDSIGKYVYV
FT                   EEISRCHFLDRNYSFCYGLQDYKSKLIKYFLE"
FT   gene            139099..140637
FT                   /locus_tag="SPCG_0140"
FT   CDS_pept        139099..140637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89392"
FT                   /db_xref="GOA:B2IRM1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM1"
FT                   /protein_id="ACB89392.1"
FT                   /translation="MENTLLNITGSFDMETRNLISYSLTDIFETDKIRIELLGEIYYKN
FT                   IKLELHEFAGLYKIYGISLIKNITGMFLIIIFDTKTKELKIFQDITTSYFNLYYTVYGG
FT                   VFYYSTSLKKVMKLSHVPVTLNNKKIQEFMRNGFILDSNTLVTEINKLEYFSYISVNNT
FT                   LRICGIDYNDSNNFTKEQVLKNWDSMLRESILRVYSEAGEANITLSSGFDSNYILYTLA
FT                   NYTNSSINAFCIGGEKGINEIPEVTKIAKFYGINLLVDTVMSQDLEYFPDIVWRLEGSL
FT                   FECGVILQYYLGRLLFQKGNTSILCGESADEIMTFKYHSVNYNQFCNDKQKSVYFSYSD
FT                   YPFYVTNSIVLKKNSLLLHSFGIHPRYPYKMSEIVEMSKKISDLNDKKEFHKKNCELRF
FT                   QDSVLDNINSVPGTTHLFSCLNIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNG
FT                   LIQNIEENLEDDIERILKYLYICLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL"
FT   gene            140643..141398
FT                   /locus_tag="SPCG_0141"
FT   CDS_pept        140643..141398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89393"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM2"
FT                   /protein_id="ACB89393.1"
FT                   /translation="MVMSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSG
FT                   YPLSQQLQPSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNG
FT                   NFLYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALEF
FT                   MRYKVIYYEDFPYVSDSSMVSYMGKTKELKMYQEELDEKHYIDRISSILCYESQILIIW
FT                   KSVEKLLNNIKELYLRNGAAYSIRFWIKK"
FT   gene            141411..142583
FT                   /gene="ugd"
FT                   /locus_tag="SPCG_0142"
FT   CDS_pept        141411..142583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="SPCG_0142"
FT                   /product="UDP-glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89394"
FT                   /db_xref="GOA:B2IRM3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM3"
FT                   /protein_id="ACB89394.1"
FT                   /translation="MNIAVIGLGHVGLAYALLFASKYKVVAYDIDSVKINNLKKGILPS
FT                   KNEELMKFFCENNLNITFFDTFSEIKNNIDYYIIALPTDYDEKIGSFNTYEIEQTVSKI
FT                   LRVKPNGKIILKSTVPIGFSNKLKRLFDTKNIIFVPEFLREGCSIYDNLYPSRIVVGDE
FT                   TVEGRKIAELFLSISTHSTANIKNVMLVSPTEAEAIKLFSNTFLALRVAFFNELDSFAE
FT                   RRSLNAEVVIKGVCLDPRIGNFYNNPSFGFGGYCLPKDTKQLKKEFIEINAPVIEAIDI
FT                   SNTNRKQFIVKQILERKPKIVGIYKLGMKYNSDNYKESAILSIINELLIVGIKILVYEP
FT                   NLNVSIDNVIFEKNFELFTKQSDLIVANRWDRGLEAYKDKVYTRGIWIRD"
FT   gene            142954..143841
FT                   /gene="mutR"
FT                   /locus_tag="SPCG_0143"
FT   CDS_pept        142954..143841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="SPCG_0143"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89395"
FT                   /db_xref="GOA:B2IRM4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM4"
FT                   /protein_id="ACB89395.1"
FT                   /translation="MQKLGGGRMIEKMELGEFYKELRLARKLKQSDVACAGLTASQLSK
FT                   FELGQSMLSADKLILAIQGINVTFDEFGHKLNNYQESPHMQIGRKIVDRFAHQDIAGLE
FT                   QLLEEVEQGQMAETYRRLNAIVIKNALHSLDKSYPLAEEDSEFLTTYLYAIESWTWFEL
FT                   YLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKSGFLNIISELMERKLFSYI
FT                   PIFEAELESMLRPYDVFEKVLWQFLKKMSIFLQTKGNNQKEIENFIQSLQVLENPQLTS
FT                   LFELRLQQYKALID"
FT   gene            144111..144236
FT                   /locus_tag="SPCG_0144"
FT   CDS_pept        144111..144236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0144"
FT                   /product="hypothetical protein, putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89396"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM5"
FT                   /protein_id="ACB89396.1"
FT                   /translation="MEEESFIMENTEFSLELDVTEVATEQDYVSSGVTSTGCCKN"
FT   gene            144296..147211
FT                   /locus_tag="SPCG_0145"
FT   CDS_pept        144296..147211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0145"
FT                   /product="lantibiotic biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89397"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM6"
FT                   /protein_id="ACB89397.1"
FT                   /translation="MFKIKDNYIYRQCVNDSILIEKLNENNLEIFFDSKIFQEMLMVAN
FT                   PRFFNELTKEKIYQNSTFRNYAKRSLTRATPFGLFSSVGVGSFSKVSYPQQIRENYSKK
FT                   VSVSGEWISSLCMMLENEDSVLLQLHLQWNQKVLELSDKYQLNNINYWGVSEQSRDILI
FT                   KKTALLEFIKKLTYKSEVSVLDLVQEIQTKSPNLETQKIIDYLRNLIISEFLFTNLRKV
FT                   VINHNCLDNLIYILSSINEQTKLTTDLLQLKSCIEKYSKSELGEGILQYAEICEKMSHI
FT                   FNEEKQRYLKVDLVNSYDSLLPKDLKKTLEDFVNFISRINLGKDYRNKELISYTEKFVE
FT                   KYGEYVEVPIKQLLDSKLGLGIPKQNLEPYSILSSVAEQTFLSYLSKEIFKAVKNNKKE
FT                   IDISNIPPELLYPNLDRFAVNQFELYCEMKNFGEQPVISIVPNTGSDMIGKSIGRFASY
FT                   FLNSNIELDSRVDNVELIEFPSDNKNLNVMSSHHGHSKKLLLSYEDDFDIDSLELDFLV
FT                   VGVERVNEHYKLYFRDLRTDLIVNFVTTSMLNHKSIGVFSHLARFLLTVSLEWQDNPFS
FT                   LFRVIENLDFLPYIPRIKYKNIILSEEKWILSDVDKKDMSTISQWKKFFDVPSLLYFHK
FT                   DDERLLIDLKNSLDVQWILKQNVDKLHFTRFDKIDGKNCEFIFGFENPRNSVYPHSVSE
FT                   KTVRRIENDFYKDYVKTFSSDWIYFKLYGINSSTMPELRENLLIFTDELLAEKLVSDFH
FT                   FVNYNDGGDGSIRLRFKIMNEDDFEKLRYRIIHWIDFLLNHYFCKDVSFNLYEREVERY
FT                   GGIGFLTVCERIFSIDSYLVLKLFSKKVLKVDDYLSVLHSIFIYIRLLGISPKQLLKLM
FT                   KDTFTQNIYRKSFKKVFPNNAKVIKEFKQYFEDQSKFDIFNEVFKSFSPIEKHFEYKND
FT                   MIHSLLHMHMNRIGIFSLNEKEYLYFVRYILEVLNNYEKYN"
FT   gene            147195..148472
FT                   /locus_tag="SPCG_0146"
FT   CDS_pept        147195..148472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0146"
FT                   /product="lantibiotic biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89398"
FT                   /db_xref="GOA:B2IRN1"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRN1"
FT                   /protein_id="ACB89398.1"
FT                   /translation="MRNIIKKYDEIINKVDSLVLDNNIIDLLQRSCYTENRSYLSEYPS
FT                   IIIYLSYRLANCDDNEHSKLLYNRVNYYLHELLKSIKLNSRNNISMCYGFSGYVYALKL
FT                   LPKRSKEYSKLLETLETILVSLTRDRLSEIKKSNKVKEEYIDVIQGVSSVGKYFLSKDK
FT                   LTSNQELLLKGVLNYLAGVINNKPTIYPEYMPNEKLKRKFPNGYINLGVAHGILGPLYV
FT                   LALGFKKFNMPEYLISLKKGLSYYEKTFQTNKIGKIIGWNGRVSAEVESEKFEYNLSWC
FT                   YGSLGMARVLYNISKIIDIPKLQELATDVFHSSIYYLNSSEILNNAICHGRSGIMLLFN
FT                   LMYLDTGESQFKAISDNLFKEIVNKATDSEYIFVERDIYFRGVNYDEVIEYIDFGLLNG
FT                   VSGIVLALMAQRTGNASPLAEMFFMQ"
FT   gene            148501..149757
FT                   /locus_tag="SPCG_0147"
FT   CDS_pept        148501..149757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0147"
FT                   /product="lantibiotic efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89399"
FT                   /db_xref="GOA:B2IRN2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRN2"
FT                   /protein_id="ACB89399.1"
FT                   /translation="MKKILNNKLYMKVLVSDLISNFGDTLYFIALMTYVTEIKSSNLAI
FT                   SIVNISETIPILFTIFFGIIADRTLNKVGMIIKTLWIRTILYLLVAVVMNFKESILVVI
FT                   LASIVNLISDTLGQFENGLFYPISNRIVKKSDREETMAFRQTATSTMNIVNQSLGAFLI
FT                   TFLSFFHLALINSLTFAISLLITLAIKSQINNFYIDKTPSTKVSKVDFKATFSDIISNL
FT                   KLSLKHLFSLTNMKTVLLVIPILNGSLAIIIPLAVVNLSKSSALTIISSATTISVLGIS
FT                   TVSGGILGGTLILISKKFKNLSIENLLKMNLMTILLSFIAFYYQNIYFIVLTLFLSSVF
FT                   VSALNPKIGAIIFNNLDETKLATIFGGMVTYFQLGDVVSRLLFSTLVIYLSYTYIAVIY
FT                   MILVLIVAIYTFRRVQTTS"
FT   gene            149836..150513
FT                   /locus_tag="SPCG_0148"
FT   CDS_pept        149836..150513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89400"
FT                   /db_xref="GOA:B2IRN3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRN3"
FT                   /protein_id="ACB89400.1"
FT                   /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMAALSDNMYYVFQ
FT                   VLLVLILGTIATIAFVKSEHWKECGRFQFRWSYLGVFLLSFFLLFVWANLTTYIFPRTQ
FT                   NGSTVVEVATNLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVKRYYLDVLVSA
FT                   AIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIVTLLV
FT                   FGY"
FT   gene            150525..151190
FT                   /locus_tag="SPCG_0149"
FT   CDS_pept        150525..151190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89401"
FT                   /db_xref="GOA:B2IRN4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRN4"
FT                   /protein_id="ACB89401.1"
FT                   /translation="MKKIISHRYFIIVFLLVIADQKFSALVLRSDLVTGLSDFAYYLSD
FT                   MMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVVWNFVTFFLFPPTR
FT                   NEISYQHAAPTFTGATAFLMYFFYPVIVGPIFEEIIHRGLVMTALEKGKKWGLDVLGSA
FT                   VLFGVSHISNHGWVLTDFFVYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLLMLL"
FT   gene            151259..152488
FT                   /locus_tag="SPCG_0150"
FT   CDS_pept        151259..152488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89402"
FT                   /db_xref="GOA:B2IRM7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM7"
FT                   /protein_id="ACB89402.1"
FT                   /translation="MMKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLA
FT                   ILLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFTKFLLYSIVSLSLSGQSFSLLL
FT                   VTFICLLNLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGV
FT                   LLGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTISYQEGLSVKSFCQHLLQSSK
FT                   LIWNMNKVLLVLFIISTSQAVINVTVPISTLFLRNQPFLNLQTGQSLALLATLELSALI
FT                   LGSLMSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGILSPRL
FT                   QELVFKQIPEESMGAVQSSIGAITVVLPSLFTIALVTIATSFGTLAVSFVLLLFLLVAF
FT                   VMLLNIRESI"
FT   gene            152943..153557
FT                   /locus_tag="SPCG_0151"
FT   CDS_pept        152943..153557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89403"
FT                   /db_xref="GOA:B2IRM8"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM8"
FT                   /protein_id="ACB89403.1"
FT                   /translation="MPTALGYVSIGLACGIIGVPYVTLVEMGLMSLFVYAGSAQFAMLA
FT                   LIVVQAPVTAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETYGVLMGE
FT                   LAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFALILSSVVTGKVGSLP
FT                   QIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAVLRLVF"
FT   gene            153661..154491
FT                   /locus_tag="SPCG_0152"
FT   CDS_pept        153661..154491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0152"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89404"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRM9"
FT                   /protein_id="ACB89404.1"
FT                   /translation="MKKIVKYSSLAALGLVAAGVLAACSGGAKKEGQAASKKEIIVATN
FT                   SSPKPFNYEENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNN
FT                   ISYTKERAEKYLYAAPIAQNPNVLVVKKDESSIKSLDDIGGKSTEVVQATTSAKQLEAY
FT                   NAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDYLKVIELPS
FT                   DQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK"
FT   gene            154645..155499
FT                   /locus_tag="SPCG_0153"
FT   CDS_pept        154645..155499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0153"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89405"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRN0"
FT                   /protein_id="ACB89405.1"
FT                   /translation="MKIKKWLGLAALATVAGLALAACGNSEKKADNATTIKIATVNRSG
FT                   SEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVDLNAFQHYNFLNNWNKENG
FT                   KDLVAIADTYISPIRLYSGLNGSDNKYTKVEDIPANGEIAVPNDATNESRALYLLQSAG
FT                   LIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYK
FT                   KALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEETSDGLDQ
FT                   PVW"
FT   gene            155596..156969
FT                   /locus_tag="SPCG_0154"
FT   CDS_pept        155596..156969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89406"
FT                   /db_xref="GOA:B2IRX6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRX6"
FT                   /protein_id="ACB89406.1"
FT                   /translation="MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEV
FT                   ANYLGEIFKRVGAEVEIDETYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTE
FT                   DPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTD
FT                   LDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYG
FT                   GVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIY
FT                   GLELPLLQEERMAFLKRFFFEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLE
FT                   PHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLP
FT                   TTAGTGPMHTVFDALEVPMVAFGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE"
FT   gene            156962..158023
FT                   /locus_tag="SPCG_0155"
FT   CDS_pept        156962..158023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0155"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89407"
FT                   /db_xref="GOA:B2IRX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRX7"
FT                   /protein_id="ACB89407.1"
FT                   /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYSG
FT                   AGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLMSQ
FT                   KTAEENVAFALKHSGLSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIARAL
FT                   ANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANRVAVM
FT                   QDGHLIEEGSVLEIFSDPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSLLVQLK
FT                   YAGASTDEPLLNELYKHYQVTANILYGNIEILDGTPVGELVVVLSGEKAALAGAQEAIR
FT                   QAGVQLKVLKGGQ"
FT   gene            158025..158717
FT                   /locus_tag="SPCG_0156"
FT   CDS_pept        158025..158717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0156"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89408"
FT                   /db_xref="GOA:B2IRX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRX8"
FT                   /protein_id="ACB89408.1"
FT                   /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGLLG
FT                   LVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAVLSPFSHLIVGTSIGPN
FT                   AAIVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLIRVT
FT                   TVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQFLGDF
FT                   LTKKLSHK"
FT   gene            158833..159606
FT                   /locus_tag="SPCG_0157"
FT   CDS_pept        158833..159606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0157"
FT                   /product="transcriptional activator, Rgg/GadR/MutR family
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89409"
FT                   /db_xref="GOA:B2IRX9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRX9"
FT                   /protein_id="ACB89409.1"
FT                   /translation="MWGVNMQNLGEVFKELRKSRNVSLQEATGGEFTYSMLSKFERGEA
FT                   DLSSMKLITALDNIHSDLNEFMYLVRGFSQKKVLAFQENLWDLYDREGIDSLHSLYEET
FT                   TQKYRSSGETSYLLQMIRIKSLLVFFDSEIRATDEELTFLYDYFFTIDIWGNYELELFS
FT                   TISTLFPLPLYFKYSREMLQKTDLLGSLPSNKVGIDTILMNGLFKAIEEKDKLKADYFI
FT                   FQIEKRELPESQAYLKIIYMIAKGYYDTIFNVKIA"
FT   gene            159788..159907
FT                   /locus_tag="SPCG_0158"
FT   CDS_pept        159788..159907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89410"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQE6"
FT                   /protein_id="ACB89410.1"
FT                   /translation="MRCLFFYPILKGSELMKTKNQESKGRSPLFKTIKHSFSQ"
FT   gene            159930..160244
FT                   /locus_tag="SPCG_0159"
FT   CDS_pept        159930..160244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89411"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQE7"
FT                   /protein_id="ACB89411.1"
FT                   /translation="MELKFVIPNMEKTFGNLEFAGEDKVVQRRINGRLTVLSRSYNLYS
FT                   DVQRADDIVVVLPAEAGEKHFGFEERVKLVNPRITAEGYKIGTRGFTNYLLHADDMIKE
FT                   "
FT   gene            160260..160646
FT                   /locus_tag="SPCG_0160"
FT   CDS_pept        160260..160646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89412"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQE8"
FT                   /protein_id="ACB89412.1"
FT                   /translation="MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERT
FT                   YDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADD
FT                   IVLTKDSSSFKAQPQAKKEPTQDK"
FT   gene            160675..162060
FT                   /locus_tag="SPCG_0161"
FT   CDS_pept        160675..162060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89413"
FT                   /db_xref="GOA:B2IQE9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQE9"
FT                   /protein_id="ACB89413.1"
FT                   /translation="MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINW
FT                   QDFNLSQADKIDIPYLIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENK
FT                   WYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEK
FT                   KLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLP
FT                   HMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLS
FT                   CIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVM
FT                   NKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDV
FT                   QKDFFLKRIKGRGYVDVGTSVISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVA
FT                   GVD"
FT   gene            162238..163443
FT                   /locus_tag="SPCG_0162"
FT   CDS_pept        162238..163443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0162"
FT                   /product="Tn916, transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89414"
FT                   /db_xref="GOA:B2IRY4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY4"
FT                   /protein_id="ACB89414.1"
FT                   /translation="MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIET
FT                   GKVKPSEDLQQSLWEALERFNPDAPLEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLH
FT                   EDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGCRQFESYLLAQQRSWYEFFMDV
FT                   LVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGELVRKEEKECM
FT                   GNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLV
FT                   YDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQ
FT                   RTLNWLSHQVAPTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITT
FT                   KK"
FT   gene            163486..163707
FT                   /locus_tag="SPCG_0163"
FT   CDS_pept        163486..163707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89415"
FT                   /db_xref="GOA:B2IRY5"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY5"
FT                   /protein_id="ACB89415.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKHEFSKLIGFLII
FT                   AIIAVGLVFNAAGVKDILLELFNRIIGA"
FT   gene            163824..164321
FT                   /locus_tag="SPCG_0164"
FT   CDS_pept        163824..164321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89416"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="InterPro:IPR041893"
FT                   /db_xref="InterPro:IPR041895"
FT                   /db_xref="InterPro:IPR041896"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY6"
FT                   /protein_id="ACB89416.1"
FT                   /translation="MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEE
FT                   YAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDI
FT                   IIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEI
FT                   VY"
FT   gene            164296..164802
FT                   /locus_tag="SPCG_0165"
FT   CDS_pept        164296..164802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89417"
FT                   /db_xref="GOA:B2IRY7"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY7"
FT                   /protein_id="ACB89417.1"
FT                   /translation="MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSY
FT                   TSIWSVEKVLYSINDFRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGI
FT                   PVAFTWFMSTKTFDGKKPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEF
FT                   YGISN"
FT   gene            164735..167233
FT                   /locus_tag="SPCG_0166"
FT   CDS_pept        164735..167233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89418"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY8"
FT                   /protein_id="ACB89418.1"
FT                   /translation="MAETSHKKPLQQLGVNFMAYPIKYIENNLVWNKDGECYAYYELVP
FT                   YNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIRSAQERSKNEVTGKLKAV
FT                   AYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSDFVYDVN
FT                   HKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYE
FT                   EYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGE
FT                   LDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNET
FT                   SSNVAEALESVNELETNLDQSKESMYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVK
FT                   LVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLD
FT                   TGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVLYGAQAVIVDP
FT                   KAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGI
FT                   SSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHL
FT                   LFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFI
FT                   HTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKN
FT                   NLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQCLISDLYGRVGVIQFH
FT                   PVFEELLHAFDTRPPVRKEV"
FT   gene            167236..169413
FT                   /locus_tag="SPCG_0167"
FT   CDS_pept        167236..169413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89419"
FT                   /db_xref="GOA:B2IRY9"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRY9"
FT                   /protein_id="ACB89419.1"
FT                   /translation="MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQA
FT                   AGLVDDTVNVANEYSRYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIW
FT                   TISLYVSNATGYLVQEAYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLI
FT                   LVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNAS
FT                   LSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLS
FT                   TSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGI
FT                   MIFSQVLFIIYAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSIS
FT                   TMLYTLSAGYPFFLIAFLQIVTFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLM
FT                   HAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRI
FT                   GQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKA
FT                   DRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNI
FT                   QTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKE
FT                   RPSTVQRVPLQNTRSRPPIKTATIKKVGKKP"
FT   gene            169410..170411
FT                   /locus_tag="SPCG_0168"
FT   CDS_pept        169410..170411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89420"
FT                   /db_xref="GOA:B2IRZ0"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRZ0"
FT                   /protein_id="ACB89420.1"
FT                   /translation="MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVN
FT                   VSAEVLAHKPMVEKYAKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLST
FT                   EESIKQGVKYFSELLASSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSK
FT                   EYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKY
FT                   EGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVF
FT                   FHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ"
FT   gene            170408..171343
FT                   /locus_tag="SPCG_0169"
FT   CDS_pept        170408..171343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89421"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRZ1"
FT                   /protein_id="ACB89421.1"
FT                   /translation="MRKEDLMMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVL
FT                   LGLSFSFAIFKHFTAIDTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSID
FT                   NRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLIT
FT                   EGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNE
FT                   INEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTV
FT                   EYIDQQTKATQVSQFDLVLEKNGSNWKIIE"
FT   gene            171618..171704
FT                   /locus_tag="SPCG_0170"
FT   CDS_pept        171618..171704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0170"
FT                   /product="tet(M) leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89422"
FT                   /db_xref="InterPro:IPR012992"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRZ2"
FT                   /protein_id="ACB89422.1"
FT                   /translation="MLCMPMVMHKNPSDKSIYHWDFYALLGF"
FT   gene            171705..173639
FT                   /locus_tag="SPCG_0171"
FT   CDS_pept        171705..173639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0171"
FT                   /product="tetracycline resistance protein TetM"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89423"
FT                   /db_xref="GOA:B2IRZ3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRZ3"
FT                   /protein_id="ACB89423.1"
FT                   /translation="MEENHMKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGT
FT                   TRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLI
FT                   SAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKV
FT                   ELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLY
FT                   HGSAKSNIGIDNLIEVITNKFYSSTHRGPSELCGKVFKIEYSEKRQRLAYIRLYSGVLH
FT                   LRDSVRISEKEKIKITEMYTSINGELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQ
FT                   RERIENPLPLLQTTVEPSKPQQREMLLDALLEISDSDPLLRYYVDSATHEIILSFLGKV
FT                   QMEVTCALLQEKYHVEIEIKEPTVIYMERPLKKAEYTIHIEVPPNPFWASIGLSVAQLP
FT                   LGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVST
FT                   PADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYTDAPKYCANIVDTQLK
FT                   NNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDK
FT                   VRYMFNKIT"
FT   gene            174564..175301
FT                   /locus_tag="SPCG_0172"
FT   CDS_pept        174564..175301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0172"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89424"
FT                   /db_xref="GOA:B2IRZ4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IRZ4"
FT                   /protein_id="ACB89424.1"
FT                   /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT
FT                   KLAKISKQVTSIELDSHLFNLSSEKLKLNIRVTLIHQDILQFQFPNKQRYKIVGNIPYH
FT                   LSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH
FT                   PKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNN
FT                   LSTITYEQVLSIFNSYLLFNGRK"
FT   gene            175656..176210
FT                   /locus_tag="SPCG_0173"
FT   CDS_pept        175656..176210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0173"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89425"
FT                   /db_xref="GOA:B2IQF6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQF6"
FT                   /protein_id="ACB89425.1"
FT                   /translation="MIFGYARVSTDDQNLSLQIDALTHYGIDKLFQEKVTGAKKDRPQL
FT                   EEMINLLREGDSVVIYKLDRISRSTKHLIELSELFEELSVNFISIQDNVDTSTSMGRFF
FT                   FRVMASLAELERDIIIERTNSGLKAARVRGKKGGRPSKGKLSIDLALKMYDSKEYSIRQ
FT                   ILDASKLSKTTFYRYLNKRNA"
FT   gene            176214..179132
FT                   /locus_tag="SPCG_0174"
FT   CDS_pept        176214..179132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0174"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89426"
FT                   /db_xref="GOA:B2IQF7"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQF7"
FT                   /protein_id="ACB89426.1"
FT                   /translation="MAMKRILTTSQREQLLSVDHLSEEDFKAYFSFSDYDLEVINQHRG
FT                   KVNKLGFAIQLCLARYPGCSLSNWPIKSTRLTSYVSRQLHLDAIDLNSYDHRNTRANHF
FT                   NEILEVFNYHRFGSANTQKQLIEYLIELALENDDSIYLMKKTIDFLTRKRIIFPSIATL
FT                   EDIISRCRDKAENNLFSILLCSLTDIQIEKLESLFQIYEETKITKLAWLKDIPGKANPE
FT                   SFMSICKKVEVIASMGLGTINVSHINRNRFLQLARLGENYDAYDFSRFELEKRYSLLIA
FT                   FLVNHHQYLIDQLIEINDRILASIKRKGTRDSQEQLKEKGKLATKKLEHYASLIDALHF
FT                   AKDNDSNPFDEIERIMPWEDLVQDGEEAKKITGNKNHGYLEMVRNKANYLRRYTPMLLR
FT                   TLSFKATPAANPVLMALTQLTDLHNSGKRKIPADTSTDFVSKKWKSLVRPEEGKIDRSY
FT                   YELVAFTELKNNIRSGDISVEGSMIHRNIDDYLVDLSACIDSETIPDTFEDYLKDREII
FT                   LDLQLQFYSTVDKRISRANLKKLEKVTPSEAEIYRKKLYSIIPKIRLSDLLIEVDSWTN
FT                   FSQEFSHDSTGKPPSEQERKIIFAALLGLGMNIGLEKMAQSTPGISYSQLANAKQWRFY
FT                   KEALTRAQSVLVNYQLKLPVADFWGEGKTTASDGMRVPVGVSALKSDVNPHYKSMEKGA
FT                   TMIRSINDRHTTHHIEVASTNTREPTHTLDGLLYHETDLDIEEHFTDTNGYSDQVFGMT
FT                   ALLGFDFEPRIRNIKKSQLFSIKSPSYYPNLSEDISGKINVKIIEENYDEIKRIAYSIQ
FT                   TGKVSSSLLLGKLGSYARKNRVALALRELGRIEKSIFMIDYITDSELRRRITHGLNKTE
FT                   AINALARELFFGRRGKFMERDIRRQLQSASALNVLINAISIWNAVYLQAAYNYLVKIDP
FT                   EVTKYMKHVSPINWEHITFLGEYKFDLLSIPKHLRELNIKNK"
FT   gene            complement(179188..179427)
FT                   /locus_tag="SPCG_0175"
FT   CDS_pept        complement(179188..179427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89427"
FT                   /db_xref="GOA:B2IQF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQF8"
FT                   /protein_id="ACB89427.1"
FT                   /translation="MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTNI
FT                   ENKGQHPSIQVLYDLVSLLHVSVDEFFLPGVPSA"
FT   gene            179923..180354
FT                   /locus_tag="SPCG_0176"
FT   CDS_pept        179923..180354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89428"
FT                   /db_xref="GOA:B2IQF9"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQF9"
FT                   /protein_id="ACB89428.1"
FT                   /translation="MRNMKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVS
FT                   FSDVGDYLVSQFATTDNYSTDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYF
FT                   MDMSDSEIADLLKLNRSTVYRHRTSGLALIKKFMEEFEE"
FT   gene            180351..180581
FT                   /locus_tag="SPCG_0177"
FT   CDS_pept        180351..180581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89429"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQG0"
FT                   /protein_id="ACB89429.1"
FT                   /translation="MKTQYPMIPFPLIVKATDGDTEAINQILHHYRGYITKRSLRLMKD
FT                   EYGNQSMVVDEVLRGRMETRLITKILSFEIK"
FT   gene            181042..181245
FT                   /locus_tag="SPCG_0178"
FT   CDS_pept        181042..181245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89430"
FT                   /db_xref="GOA:B2IQG1"
FT                   /db_xref="InterPro:IPR015122"
FT                   /db_xref="InterPro:IPR038148"
FT                   /db_xref="UniProtKB/TrEMBL:B2IQG1"
FT                   /protein_id="ACB89430.1"
FT                   /translation="MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIM
FT                   NGNRIQIKRKQFEKIIDTLDAI"
FT   gene            181327..182544
FT                   /locus_tag="SPCG_0179"
FT   CDS_pept        181327..182544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89431"
FT                   /db_xref="GOA:B2IS01"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS01"
FT                   /protein_id="ACB89431.1"
FT                   /translation="MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLV
FT                   ATDRVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTET
FT                   GRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAI
FT                   QDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKT
FT                   GLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQA
FT                   FKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHI
FT                   TPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQ
FT                   QERLVA"
FT   gene            182961..184277
FT                   /locus_tag="SPCG_0180"
FT   CDS_pept        182961..184277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89432"
FT                   /db_xref="GOA:B2IS02"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS02"
FT                   /protein_id="ACB89432.1"
FT                   /translation="MGSPAFFVRLVSIEYSLKYGESPVMKLFLKHHLFRILTLSRFLSS
FT                   SGAYIYNLVFIVYAASLPFKNIAVFMANMITILPFLFTFYVGIKADHTRNKAGTIIWVG
FT                   CVQSLLFLLIASVIHDQNFITFAFICMVNICSDILSDYTAGLRMPIIQHNISEDKLYEA
FT                   YSFTQFVSYLSNLGGQALGVWLLTASNQNFSFVAIVNAGFFLLSSLILFKNRRELTYLS
FT                   VTVENEPISLLQQVKAIYADMDNIFRQRESKSLFKIILVILVMNTLGGAVGGIYHFYLL
FT                   DHTIYHLSYAQALFLIECVSLGGAILGSLTPHDYFGKWSFSSLLSLNAILFVLLATANI
FT                   LDFSPLVGVVCLAFVMYLMSKSMPKLDTLLLSNLSADVLARSNNLLSMIFSLTLPLGMS
FT                   VFSFLALQDIRLCWWVFLVVSVIGLILSLEKRSFSGKKV"
FT   gene            184315..184518
FT                   /locus_tag="SPCG_0181"
FT   CDS_pept        184315..184518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89433"
FT                   /db_xref="GOA:B2IS03"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS03"
FT                   /protein_id="ACB89433.1"
FT                   /translation="MIRVTTVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDKTI
FT                   LATIIIILIIFKFILNENQRAK"
FT   gene            complement(184713..185375)
FT                   /locus_tag="SPCG_0182"
FT   CDS_pept        complement(184713..185375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89434"
FT                   /db_xref="GOA:B2IS04"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS04"
FT                   /protein_id="ACB89434.1"
FT                   /translation="MTSKSSHFLLIYHPAKPWLNENCESIIRRRFMKKSILTTLLFAVL
FT                   YFLSMGIGVLLGNLFDQTGNMFYAPAFTALVGGSAYMILVAKVPRFGAITTIGLVIALF
FT                   FLGTKHGAGAFLPGIICGLLADAVASLGKYKDQTKNFLSFILFAFSSTGPILLMWIAPK
FT                   AYMATLLARGKSQEYIDRIMVAPNPGTILLFVASVVIGALVGALIGQALSKKFAQKI"
FT   gene            185632..186213
FT                   /locus_tag="SPCG_0183"
FT   CDS_pept        185632..186213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89435"
FT                   /db_xref="GOA:B2IS05"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS05"
FT                   /protein_id="ACB89435.1"
FT                   /translation="MYSFTKCAIILSGGSIMKKKPIYLWVLLILSALISVPSLFGIVSP
FT                   LPSKEALRAAQKQVAGVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFL
FT                   VRKNLQYANYTYVGYVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIV
FT                   INVLFLALVFYKMWRQQKALAEEEETEELA"
FT   gene            186159..186761
FT                   /locus_tag="SPCG_0184"
FT   CDS_pept        186159..186761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89436"
FT                   /db_xref="GOA:B2IS06"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS06"
FT                   /protein_id="ACB89436.1"
FT                   /translation="MATTESLGRRRGNRRACLSIDKKELSRYNLGSCFLIIDKIMEVHM
FT                   KTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLVKEGKNFYEMDHPYVAF
FT                   LPTYLEGGNGVDNGDVEILMTPVGDFIAYGYNASKCSGVVGSGNRNFNNQYCLTAKQYS
FT                   QRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
FT   gene            complement(187054..188361)
FT                   /locus_tag="SPCG_0185"
FT   CDS_pept        complement(187054..188361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89437"
FT                   /db_xref="GOA:B2IS07"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS07"
FT                   /protein_id="ACB89437.1"
FT                   /translation="MHIQIILKIQKGVFIMSQAISLNQSTWASKLKAMGPGILMATAAV
FT                   GGSHIVSSTQAGGSYGWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLY
FT                   LWIFFILNVFSAMVNTAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYK
FT                   LLDGMVKWIMSALTIATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAP
FT                   IEISAINSLWSAEKRKTVNFNTEDALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVE
FT                   AASAKYISQFVGMYASVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQ
FT                   KEDNRKSLNIWMTITAIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRE
FT                   NKNLPSWLKHLAIAGLIFLFGFAIFFIYALAIGKAG"
FT   gene            complement(188626..189084)
FT                   /locus_tag="SPCG_0186"
FT   CDS_pept        complement(188626..189084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89438"
FT                   /db_xref="GOA:B2IS08"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS08"
FT                   /protein_id="ACB89438.1"
FT                   /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQVM
FT                   DQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLATL
FT                   AGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
FT   gene            complement(189081..189602)
FT                   /locus_tag="SPCG_0187"
FT   CDS_pept        complement(189081..189602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89439"
FT                   /db_xref="GOA:B2IS09"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS09"
FT                   /protein_id="ACB89439.1"
FT                   /translation="MKRFLKSINKGVQEVRLILYEKQGEKFMKVELQISETYEEEKLIV
FT                   QAPQETEKVQKVIEFAENLDQREKIKGKIDDQVYLVEIGKIQRFYIENRKVLAETASQT
FT                   YSIDLRLYQVLKLLPTNFIQISQSEIINIDSISHLKLTPNGLVEIFLKNESFTYSSRRY
FT                   LKTIKEKLEL"
FT   gene            189877..191826
FT                   /gene="hexB"
FT                   /locus_tag="SPCG_0188"
FT   CDS_pept        189877..191826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hexB"
FT                   /locus_tag="SPCG_0188"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89440"
FT                   /db_xref="GOA:B2IS10"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS10"
FT                   /protein_id="ACB89440.1"
FT                   /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQIII
FT                   EIEEAGLKKVQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPSIA
FT                   SVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKYMKS
FT                   QQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSAKKMI
FT                   EIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKLMVGRF
FT                   PLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMTLVSEAIANSLKEQTLIPDALENLA
FT                   KSTVRNREKVEQTILPLKENTLYYEKTEPSRPSQTEVADYQVELTDEGQDLTLFAKETL
FT                   DRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELEFFGQMHGT
FT                   YLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFPADDALRLKE
FT                   RMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTKEVSIKKYRAE
FT                   LAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHFTKSDMEKMFRR
FT                   IQENHTSLRELGKY"
FT   gene            complement(192151..192618)
FT                   /gene="ribE"
FT                   /locus_tag="SPCG_0189"
FT   CDS_pept        complement(192151..192618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="SPCG_0189"
FT                   /product="riboflavin synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89441"
FT                   /db_xref="GOA:B2IS11"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS11"
FT                   /protein_id="ACB89441.1"
FT                   /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVNE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQIS
FT                   LNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
FT   gene            complement(192619..193854)
FT                   /gene="ribA"
FT                   /locus_tag="SPCG_0190"
FT   CDS_pept        complement(192619..193854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="SPCG_0190"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89442"
FT                   /db_xref="GOA:B2IS12"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS12"
FT                   /protein_id="ACB89442.1"
FT                   /translation="MDFSRKDNQSMEYRKIQEALEALQKGRLVLVIDDKDRENEGDLIC
FT                   SAQAATTENVNFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKET
FT                   TTGISAEERGLTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLA
FT                   GLKECGLCCEIMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVN
FT                   MPTRYGNFKAISYIDKLNGEHHLALIMGNIENEANVLCRVHSECLTGDVLGSLRCDCGQ
FT                   QFDKAMKMIVENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLR
FT                   EYHIGAQMLKDLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKK
FT                   NRMGHILNMEEK"
FT   gene            complement(193844..194479)
FT                   /gene="ribC"
FT                   /locus_tag="SPCG_0191"
FT   CDS_pept        complement(193844..194479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="SPCG_0191"
FT                   /product="riboflavin synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89443"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS13"
FT                   /protein_id="ACB89443.1"
FT                   /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVNG
FT                   ICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHIDG
FT                   TGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVIPHT
FT                   LEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
FT   gene            complement(194464..195564)
FT                   /gene="ribD"
FT                   /locus_tag="SPCG_0192"
FT   CDS_pept        complement(194464..195564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SPCG_0192"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89444"
FT                   /db_xref="GOA:B2IS14"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS14"
FT                   /protein_id="ACB89444.1"
FT                   /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHEF
FT                   FGGPHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLDCN
FT                   PIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGKIAT
FT                   KTNQSKWITEEEARKHVHQLRHYVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRIICDTH
FT                   LRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSSLMQHL
FT                   GNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISLPNDAIR
FT                   LKPYAFSQIGNDYLIESEVIYPCSQE"
FT   gene            195970..196563
FT                   /gene="ruvA"
FT                   /locus_tag="SPCG_0193"
FT   CDS_pept        195970..196563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SPCG_0193"
FT                   /product="holliday junction DNA helicase motor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89445"
FT                   /db_xref="GOA:B2IS15"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS15"
FT                   /protein_id="ACB89445.1"
FT                   /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQ
FT                   IYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETK
FT                   NITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLAL
FT                   GYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
FT   gene            complement(196219..196776)
FT                   /locus_tag="SPCG_0194"
FT   CDS_pept        complement(196219..196776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89447"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS16"
FT                   /protein_id="ACB89447.1"
FT                   /translation="MNLIAMKGFSESLAFVEYRFPRQACLIGFHTQQLKQCLVIMEGLT
FT                   PLLIMIGDVERVGHLDPRTTFCHSLLLFDQHFKGRLDIVLSCICRSFKEFLDFLELCCL
FT                   VAQSQHGFHSFFQFLVFGTCLHCDLGRKAISCNYYLAFQVQHHLLGCFLANFRELGQVG
FT                   DVLGFNGLNQASIVISSDNSKS"
FT   gene            196573..197136
FT                   /gene="tag"
FT                   /locus_tag="SPCG_0195"
FT   CDS_pept        196573..197136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SPCG_0195"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89446"
FT                   /db_xref="GOA:B2IS17"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS17"
FT                   /protein_id="ACB89446.1"
FT                   /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQAG
FT                   LSWETVLNKRQAFREAFHSYQIHSVAEMTETELEAMLENPAIIRNRAKLFATRANAQAF
FT                   LQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTGPVA
FT                   VLSFLQAAGLVDDHENDCEWKGLK"
FT   gene            197133..197810
FT                   /locus_tag="SPCG_0196"
FT   CDS_pept        197133..197810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89448"
FT                   /db_xref="GOA:B2IS18"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS18"
FT                   /protein_id="ACB89448.1"
FT                   /translation="MMSNKNKEILIFAILYTVLFMFDGVKLLASLMPSAIANYLVYVVL
FT                   ALYGSFLFKDRLIQQWKEIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGLDG
FT                   QGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLPGLLSIILVGLV
FT                   FALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLLVHMLSNSLSLIILAIS
FT                   IVK"
FT   gene            complement(197965..198996)
FT                   /locus_tag="SPCG_0197"
FT   CDS_pept        complement(197965..198996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0197"
FT                   /product="mccC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89449"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS19"
FT                   /protein_id="ACB89449.1"
FT                   /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLGLNPIFLPHSL
FT                   KGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQKI
FT                   FLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRISEIR
FT                   PSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGRAQFEGKILGGCLESLYDIFDNSRY
FT                   ADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAIINGLLV
FT                   GKPMDETFHDDYKEALLDIIDSNIPIVYNLNVGHATPRAIVPFGVHAHVDAQEQVIRFD
FT                   YNK"
FT   gene            complement(199184..199279)
FT                   /locus_tag="SPCG_0198"
FT   CDS_pept        complement(199184..199279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89450"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS20"
FT                   /protein_id="ACB89450.1"
FT                   /translation="MQDQHAIKNKKTIKATAGAVAFSLTFLSYTQ"
FT   gene            complement(199251..199955)
FT                   /locus_tag="SPCG_0199"
FT   CDS_pept        complement(199251..199955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89451"
FT                   /db_xref="GOA:B2IS21"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS21"
FT                   /protein_id="ACB89451.1"
FT                   /translation="MVVRGVLMSQIDLQTLTKKNQEFVHIATQQFIKDGKTDAEIQTIF
FT                   EEVIPQILEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFI
FT                   TSLFALVSALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPDMDRSQRP
FT                   PFWKSVLVILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNI
FT                   RSASAGPTRYQE"
FT   gene            complement(199946..200890)
FT                   /locus_tag="SPCG_0200"
FT   CDS_pept        complement(199946..200890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0200"
FT                   /product="magnesium transporter, CorA family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89452"
FT                   /db_xref="GOA:B2IS22"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS22"
FT                   /protein_id="ACB89452.1"
FT                   /translation="MKQVFLSTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDIDI
FT                   ADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITTCL
FT                   EPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLHQST
FT                   RNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIETQQA
FT                   IEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNFKDNEI
FT                   PLNGEPNAFWLIVFIAFAMSVSLTIYLIHKKWL"
FT   gene            200989..203853
FT                   /gene="uvrA"
FT                   /locus_tag="SPCG_0201"
FT   CDS_pept        200989..203853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SPCG_0201"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89453"
FT                   /db_xref="GOA:B2IS23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS23"
FT                   /protein_id="ACB89453.1"
FT                   /translation="MVSNNGLERTTMQDKIVIHGARAHNFQYIDVEIPRDKLVVVTGLS
FT                   GSGKSSLAFDTLYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSK
FT                   NPRSTVGTTTEINDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPEGQRLQIL
FT                   APVIRKKKGQHKSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIK
FT                   EGIRSRLFDSIEAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNA
FT                   PFGSCSECDGLGIKLEVDTDLVVPDASKTLREGALAPWNPISSNYYPNMLEQAMKVFGV
FT                   AMDKPFEDLSEEDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETN
FT                   SDYTRTQMRLYMNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQ
FT                   LTLSENEAIIARPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSN
FT                   LSGVLYILDEPSIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPG
FT                   AGVFGGEIVAAGTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVIGARENNL
FT                   QNVTARFPLGKFIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHVD
FT                   RLIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEA
FT                   CSGDGIIKIEMHFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVEFFQ
FT                   HIPKIQRKLQTIKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYILDEPT
FT                   TGLHTEDIARLLKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGTIIVTG
FT                   TPEEVAANEASYTGHYLKGKLHHE"
FT   gene            203846..204907
FT                   /gene="pepP"
FT                   /locus_tag="SPCG_0202"
FT   CDS_pept        203846..204907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="SPCG_0202"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89454"
FT                   /db_xref="GOA:B2IS24"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS24"
FT                   /protein_id="ACB89454.1"
FT                   /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFISR
FT                   DRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMGLTRIGFEDEISVSYYHR
FT                   MQAAFAGLDLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTEIEI
FT                   ANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYDHYVS
FT                   DMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAGYGDYF
FT                   THGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDILITETGC
FT                   ELLTLAPKELIVI"
FT   gene            205039..205437
FT                   /gene="spxA"
FT                   /locus_tag="SPCG_0203"
FT   CDS_pept        205039..205437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxA"
FT                   /locus_tag="SPCG_0203"
FT                   /product="transcriptional regulator Spx"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89455"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS25"
FT                   /protein_id="ACB89455.1"
FT                   /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDI
FT                   LTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVG
FT                   YKEDDIRAFLPRSVRNVENAEARLRAAL"
FT   gene            205503..206072
FT                   /locus_tag="SPCG_0204"
FT   CDS_pept        205503..206072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89456"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS26"
FT                   /protein_id="ACB89456.1"
FT                   /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIENA
FT                   EKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLAIQQKRPVSDELKTYIDQHGVEET
FT                   QKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEHLKN
FT                   IGLENLLKNEPSKYISDRLANGATEQ"
FT   gene            206159..206425
FT                   /locus_tag="SPCG_0205"
FT   CDS_pept        206159..206425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89457"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS27"
FT                   /protein_id="ACB89457.1"
FT                   /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVGY
FT                   VLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
FT   gene            206429..206848
FT                   /locus_tag="SPCG_0206"
FT   CDS_pept        206429..206848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89458"
FT                   /db_xref="GOA:B2IS28"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS28"
FT                   /protein_id="ACB89458.1"
FT                   /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGLEIIQINEEQGQFGFDRV
FT                   KELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVAAE
FT                   RMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
FT   gene            206864..207169
FT                   /locus_tag="SPCG_0207"
FT   CDS_pept        206864..207169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89459"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS29"
FT                   /protein_id="ACB89459.1"
FT                   /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYVL
FT                   LVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
FT   gene            207471..208727
FT                   /gene="folC"
FT                   /locus_tag="SPCG_0208"
FT   CDS_pept        207471..208727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="SPCG_0208"
FT                   /product="dihydrofolate synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89460"
FT                   /db_xref="GOA:B2IS30"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS30"
FT                   /protein_id="ACB89460.1"
FT                   /translation="MCMFEVEEWLHSRIGLNFRSGLGRIQQAVDLLGNPEQSYPIIHVT
FT                   GTNGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLADQVKE
FT                   MEKTLLQTPDQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAVITS
FT                   IGLDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVNLYQAGQ
FT                   DFLMLNGDFSSSLLNLSQLNIGLEGVYQQENAALALQTFLLFMGEGKEAVDEQAVRKAL
FT                   EQTHWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGALKRKDYQGM
FT                   LGYLTEKLPQVELKVTGFDYQGALDERDVTGYDIVSSYREFISDFEERADAQDLLFVTG
FT                   SLYFISEVRGYLLDREQIN"
FT   gene            208724..209269
FT                   /locus_tag="SPCG_0209"
FT   CDS_pept        208724..209269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89461"
FT                   /db_xref="InterPro:IPR020961"
FT                   /db_xref="InterPro:IPR027279"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS31"
FT                   /protein_id="ACB89461.1"
FT                   /translation="MTPLFELVILGELLVRENFSKLVAERKFIMKLKRFTLSLASLASF
FT                   SLLVACSQRAQQVQQPVAQQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDIDGT
FT                   YTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTFDSANQRMIIGDDVKIYTVNGNQ
FT                   IVVDDMDRDPSDQIVLTK"
FT   gene            209415..210947
FT                   /gene="cls"
FT                   /locus_tag="SPCG_0210"
FT   CDS_pept        209415..210947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="SPCG_0210"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89462"
FT                   /db_xref="GOA:B2IS32"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS32"
FT                   /protein_id="ACB89462.1"
FT                   /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWITV
FT                   LILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKKLG
FT                   SMHFQEANSQLLKEKLKESDKVAYGVIKSLLSMDTNADIYDQTASTFFPSGEAMWKKMV
FT                   EDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTGDYAH
FT                   RLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHVERFGY
FT                   WKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPYGSGPKP
FT                   IFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRIITPYIPDK
FT                   KFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYRSLVHHYEN
FT                   AVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAPIL"
FT   gene            211187..212743
FT                   /locus_tag="SPCG_0211"
FT   CDS_pept        211187..212743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0211"
FT                   /product="competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89463"
FT                   /db_xref="GOA:B2IS33"
FT                   /db_xref="InterPro:IPR016978"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS33"
FT                   /protein_id="ACB89463.1"
FT                   /translation="MNRRNDMSVYGRVEEVHKENREPLKYQIEQESHHRESSRLPLVKI
FT                   LLWSTLVTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYV
FT                   SQGGFFFAIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATL
FT                   LALPFLFAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVLSLGLLVFN
FT                   LGHRRFAHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKI
FT                   LENMFFYGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHA
FT                   SYLMVVFPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLLS
FT                   VPFLMKFVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILSPL
FT                   HYTATEENRNKLLNDLKEKQPKVIVVNDKVVVWSEVETLLKENYQQVKTDYSEFKVYKI
FT                   K"
FT   gene            212857..215070
FT                   /locus_tag="SPCG_0212"
FT   CDS_pept        212857..215070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0212"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89464"
FT                   /db_xref="GOA:B2IS34"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS34"
FT                   /protein_id="ACB89464.1"
FT                   /translation="MRMIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALHKAADKVM
FT                   DVTPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRT
FT                   QRDFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQMLP
FT                   KHVANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTATA
FT                   QISQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKREDYAWKKTQ
FT                   KDIYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLGSEHR
FT                   TAIFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGSFKVPM
FT                   GCRSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERMNIAEDA
FT                   LVYRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIGLYEVATV
FT                   FFGNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDRFCRLDIDK
FT                   FGSIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYCEYPVLQQNP
FT                   KALEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGNSDPKTVDVVK
FT                   RTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
FT   gene            215082..215222
FT                   /locus_tag="SPCG_0213"
FT   CDS_pept        215082..215222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89465"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS35"
FT                   /protein_id="ACB89465.1"
FT                   /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNKK
FT                   K"
FT   gene            215266..215772
FT                   /locus_tag="SPCG_0214"
FT   CDS_pept        215266..215772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0214"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89466"
FT                   /db_xref="GOA:B2IS36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS36"
FT                   /protein_id="ACB89466.1"
FT                   /translation="MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLE
FT                   SNQEQEMGIWLPENRVPSIQFVLFGESGCALGFLNLRLRLNEGLLNYAGHIGYSIRPSE
FT                   RGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWI
FT                   EVANE"
FT   gene            215765..216355
FT                   /gene="nrdD"
FT                   /locus_tag="SPCG_0215"
FT   CDS_pept        215765..216355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="SPCG_0215"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89467"
FT                   /db_xref="GOA:B2IS37"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS37"
FT                   /protein_id="ACB89467.1"
FT                   /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMFH
FT                   CEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRI
FT                   RKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQ
FT                   RIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
FT   gene            216352..216969
FT                   /locus_tag="SPCG_0216"
FT   CDS_pept        216352..216969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89468"
FT                   /db_xref="GOA:B2IS38"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS38"
FT                   /protein_id="ACB89468.1"
FT                   /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALDS
FT                   TTVNLLETDPYITSGRYLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLTIE
FT                   EPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVRNRD
FT                   ASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
FT   gene            217236..217544
FT                   /gene="rpsJ"
FT                   /locus_tag="SPCG_0217"
FT   CDS_pept        217236..217544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SPCG_0217"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89469"
FT                   /db_xref="GOA:B2IS39"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS39"
FT                   /protein_id="ACB89469.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   gene            217760..218386
FT                   /gene="rplC"
FT                   /locus_tag="SPCG_0218"
FT   CDS_pept        217760..218386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SPCG_0218"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89470"
FT                   /db_xref="GOA:B2IS40"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS40"
FT                   /protein_id="ACB89470.1"
FT                   /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETDG
FT                   YNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAGRMG
FT                   GDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
FT   gene            218411..219034
FT                   /gene="rplD"
FT                   /locus_tag="SPCG_0219"
FT   CDS_pept        218411..219034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SPCG_0219"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89471"
FT                   /db_xref="GOA:B2IS41"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS41"
FT                   /protein_id="ACB89471.1"
FT                   /translation="MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFA
FT                   ALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
FT   gene            219034..219330
FT                   /gene="rplW"
FT                   /locus_tag="SPCG_0220"
FT   CDS_pept        219034..219330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SPCG_0220"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89472"
FT                   /db_xref="GOA:B2IS42"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS42"
FT                   /protein_id="ACB89472.1"
FT                   /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEAA
FT                   FEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
FT   gene            219348..220181
FT                   /gene="rplB"
FT                   /locus_tag="SPCG_0221"
FT   CDS_pept        219348..220181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SPCG_0221"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89473"
FT                   /db_xref="GOA:B2IS43"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS43"
FT                   /protein_id="ACB89473.1"
FT                   /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRNN
FT                   NGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGASAQ
FT                   VLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   gene            220273..220554
FT                   /gene="rpsS"
FT                   /locus_tag="SPCG_0222"
FT   CDS_pept        220273..220554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SPCG_0222"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89474"
FT                   /db_xref="GOA:B2IS44"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS44"
FT                   /protein_id="ACB89474.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
FT   gene            220566..220910
FT                   /gene="rplV"
FT                   /locus_tag="SPCG_0223"
FT   CDS_pept        220566..220910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SPCG_0223"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89475"
FT                   /db_xref="GOA:B2IS45"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS45"
FT                   /protein_id="ACB89475.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTPN
FT                   KAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRT
FT                   AHITVAVAEK"
FT   gene            220923..221576
FT                   /gene="rpsC"
FT                   /locus_tag="SPCG_0224"
FT   CDS_pept        220923..221576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SPCG_0224"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89476"
FT                   /db_xref="GOA:B2IS46"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS46"
FT                   /protein_id="ACB89476.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQKE
FT                   LADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   gene            221580..221993
FT                   /gene="rplP"
FT                   /locus_tag="SPCG_0225"
FT   CDS_pept        221580..221993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SPCG_0225"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89477"
FT                   /db_xref="GOA:B2IS47"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS47"
FT                   /protein_id="ACB89477.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   gene            222003..222209
FT                   /gene="rpmC"
FT                   /locus_tag="SPCG_0226"
FT   CDS_pept        222003..222209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SPCG_0226"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89478"
FT                   /db_xref="GOA:B2IS48"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS48"
FT                   /protein_id="ACB89478.1"
FT                   /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQLE
FT                   QTARLKEVKKQIARIKTVQSEAK"
FT   gene            222234..222494
FT                   /gene="rpsQ"
FT                   /locus_tag="SPCG_0227"
FT   CDS_pept        222234..222494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SPCG_0227"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89479"
FT                   /db_xref="GOA:B2IS49"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS49"
FT                   /protein_id="ACB89479.1"
FT                   /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   gene            222520..222888
FT                   /gene="rplN"
FT                   /locus_tag="SPCG_0228"
FT   CDS_pept        222520..222888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SPCG_0228"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89480"
FT                   /db_xref="GOA:B2IS50"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS50"
FT                   /protein_id="ACB89480.1"
FT                   /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPVAR
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            222966..223271
FT                   /gene="rplX"
FT                   /locus_tag="SPCG_0229"
FT   CDS_pept        222966..223271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SPCG_0229"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89481"
FT                   /db_xref="GOA:B2IS51"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS51"
FT                   /protein_id="ACB89481.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQ
FT                   RPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
FT   gene            223295..223837
FT                   /gene="rplE"
FT                   /locus_tag="SPCG_0230"
FT   CDS_pept        223295..223837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SPCG_0230"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89482"
FT                   /db_xref="GOA:B2IS52"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS52"
FT                   /protein_id="ACB89482.1"
FT                   /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEAV
FT                   SNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTTANT
FT                   DEESRALLTGLGMPFAK"
FT   gene            223855..224124
FT                   /gene="rpsN"
FT                   /locus_tag="SPCG_0231"
FT   CDS_pept        223855..224124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SPCG_0231"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89483"
FT                   /db_xref="GOA:B2IS53"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS53"
FT                   /protein_id="ACB89483.1"
FT                   /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNASP
FT                   TRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
FT   gene            224338..224736
FT                   /gene="rpsH"
FT                   /locus_tag="SPCG_0232"
FT   CDS_pept        224338..224736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SPCG_0232"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89484"
FT                   /db_xref="GOA:B2IS54"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS54"
FT                   /protein_id="ACB89484.1"
FT                   /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEIIEDDKQGVIRVFLKYGPNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLGIA
FT                   ILSTSEGLLTDKEARQKNVGGEVIAYVW"
FT   gene            224928..225464
FT                   /gene="rplF"
FT                   /locus_tag="SPCG_0233"
FT   CDS_pept        224928..225464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SPCG_0233"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89485"
FT                   /db_xref="GOA:B2IS55"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS55"
FT                   /protein_id="ACB89485.1"
FT                   /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIRV
FT                   EGTEVTLHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLV
FT                   LAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGKGIR
FT                   YVGEFVRRKEGKTGK"
FT   gene            225509..225904
FT                   /gene="rplR"
FT                   /locus_tag="SPCG_0234"
FT   CDS_pept        225509..225904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SPCG_0234"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89486"
FT                   /db_xref="GOA:B2IS56"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS56"
FT                   /protein_id="ACB89486.1"
FT                   /translation="MHSTRFKTKEVKTVISKPDKNKLRQKRHRRVRGKLSGTADRPRLN
FT                   VFRSNTGIYAQVIDDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEV
FT                   VFDRGGYLYHGRVKALADAARENGLKF"
FT   gene            225922..226416
FT                   /gene="rpsE"
FT                   /locus_tag="SPCG_0235"
FT   CDS_pept        225922..226416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SPCG_0235"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89487"
FT                   /db_xref="GOA:B2IS57"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS57"
FT                   /protein_id="ACB89487.1"
FT                   /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRV
FT                   GFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDL
FT                   A"
FT   gene            226388..226612
FT                   /gene="rpmD"
FT                   /locus_tag="SPCG_0236"
FT   CDS_pept        226388..226612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SPCG_0236"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89488"
FT                   /db_xref="GOA:B2IS58"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS58"
FT                   /protein_id="ACB89488.1"
FT                   /translation="MVFQFLIWHKKGDKMAQIKITLTKSPIGRIPSQRKTVVALGLGKL
FT                   NSFVIKEDNAAIRGMITAVSHLVTVEEVN"
FT   gene            226757..227197
FT                   /gene="rplO"
FT                   /locus_tag="SPCG_0237"
FT   CDS_pept        226757..227197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SPCG_0237"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89489"
FT                   /db_xref="GOA:B2IS59"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS59"
FT                   /protein_id="ACB89489.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIVKA
FT                   EKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
FT   gene            227210..228520
FT                   /gene="secY"
FT                   /locus_tag="SPCG_0238"
FT   CDS_pept        227210..228520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SPCG_0238"
FT                   /product="preprotein translocase SecY"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89490"
FT                   /db_xref="GOA:B2IS60"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS60"
FT                   /protein_id="ACB89490.1"
FT                   /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANSL
FT                   NALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTAGSM
FT                   IVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSIIFVII
FT                   LIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKVNPAGVIPVIFASSITA
FT                   APAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQINPEKAA
FT                   ESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVFGLSDVVA
FT                   FGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
FT   gene            228671..229309
FT                   /gene="adk"
FT                   /locus_tag="SPCG_0239"
FT   CDS_pept        228671..229309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SPCG_0239"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89491"
FT                   /db_xref="GOA:B2IS63"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS63"
FT                   /protein_id="ACB89491.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEM
FT                   GVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLAEL
FT                   GIELEGVINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
FT   gene            229372..229644
FT                   /gene="infA"
FT                   /locus_tag="SPCG_0240"
FT   CDS_pept        229372..229644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SPCG_0240"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89492"
FT                   /db_xref="GOA:B2IS64"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS64"
FT                   /protein_id="ACB89492.1"
FT                   /translation="MLSLCLEASNRNLWRCFCVAKDDVIEVEGKVVDTMPNAMFTVELE
FT                   NGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK"
FT   gene            229803..230168
FT                   /gene="rpsM"
FT                   /locus_tag="SPCG_0241"
FT   CDS_pept        229803..230168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SPCG_0241"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89493"
FT                   /db_xref="GOA:B2IS65"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS65"
FT                   /protein_id="ACB89493.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDVRV
FT                   RDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   gene            230186..230569
FT                   /gene="rpsK"
FT                   /locus_tag="SPCG_0242"
FT   CDS_pept        230186..230569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SPCG_0242"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89494"
FT                   /db_xref="GOA:B2IS66"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS66"
FT                   /protein_id="ACB89494.1"
FT                   /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSSA
FT                   GALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   gene            230612..231547
FT                   /gene="rpoA"
FT                   /locus_tag="SPCG_0243"
FT   CDS_pept        230612..231547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SPCG_0243"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89495"
FT                   /db_xref="GOA:B2IS67"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS67"
FT                   /protein_id="ACB89495.1"
FT                   /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLAS
FT                   LPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGPAE
FT                   VTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVGTLA
FT                   VDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEHLDLF
FT                   TNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLTEKSEA
FT                   EMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
FT   gene            231559..231945
FT                   /gene="rplQ"
FT                   /locus_tag="SPCG_0244"
FT   CDS_pept        231559..231945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SPCG_0244"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89496"
FT                   /db_xref="GOA:B2IS68"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IS68"
FT                   /protein_id="ACB89496.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   gene            232117..232476
FT                   /locus_tag="SPCG_0245"
FT   CDS_pept        232117..232476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89497"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS69"
FT                   /protein_id="ACB89497.1"
FT                   /translation="MSIFVRIMLYYLKRILFNVKVSYFKKNWSLLMKAIITVVGKDKSG
FT                   IVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVK
FT                   INIQSAAIFEAMYNI"
FT   gene            232523..233824
FT                   /locus_tag="SPCG_0246"
FT   CDS_pept        232523..233824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89498"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS70"
FT                   /protein_id="ACB89498.1"
FT                   /translation="MRSKTSILEPLPCGISLLDCIDPDINRAAEKIYQKITTKAANLVA
FT                   VGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSA
FT                   LVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLS
FT                   DMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVV
FT                   AETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSVARVLEEMGLETV
FT                   GTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAVQNGSLNLEKLEA
FT                   MTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIPKGREGDMIEFGG
FT                   LLGTAPVMKVNGASSVDFISRGGQIPAPIHSFKN"
FT   gene            234011..234760
FT                   /gene="gpmB"
FT                   /locus_tag="SPCG_0247"
FT   CDS_pept        234011..234760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="SPCG_0247"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89499"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS71"
FT                   /protein_id="ACB89499.1"
FT                   /translation="MGGFYFIIHDIIEANGGRKMVKVRLYLVRHGKTMFNTIGRAQGWS
FT                   DTPLTAEGERGIQELGIGLRESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMD
FT                   KRIREWCFGSFDGAYDGDLFMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEK
FT                   LSGRIKEGFEIIAKEMEDQGGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYE
FT                   DGQFRVEVVGDRSYRELGREKMEEGSI"
FT   gene            complement(234863..235897)
FT                   /locus_tag="SPCG_0248"
FT   CDS_pept        complement(234863..235897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0248"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89500"
FT                   /db_xref="GOA:B2IS61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS61"
FT                   /protein_id="ACB89500.1"
FT                   /translation="MLVFMRAFSDFGTPMLIGEGYRTFPVLIYTQFISEVGGNSAFAIM
FT                   AIIIALAIFLIQKHIANRYSFSMNLLHPIEPKKTTKGKMAAIYATVYGIIFISVLPQIY
FT                   LIYTSFLKTSGMVFVKGYSPNSYKVAFNRMGSAIFNTIRIPLIALVLVVLFATFISYLA
FT                   VRKRNLFTNLIDSLSMVPYIVPGTVLGIAFISSFNTGLFGSGFLMITGTAFILIMSLSV
FT                   RRLPYTIRSSVASLQQIAPSIEEAAESLGSSRLNIFAKITTPMMLSGIISGAILSWVTM
FT                   ISKLSTSILLYNVKTRTMTVAIYTEILRGNYGVAAALSTILTVLTVGSLLLFMKISKSN
FT                   SITL"
FT   gene            complement(235882..236418)
FT                   /locus_tag="SPCG_0250"
FT   CDS_pept        complement(235882..236418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0250"
FT                   /product="ABC transporter membrane-spanning permease-iron
FT                   transport, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89501"
FT                   /db_xref="GOA:B2IS62"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IS62"
FT                   /protein_id="ACB89501.1"
FT                   /translation="MLKQALIHEGQFSLANFVTFFSKTYYSETLVNSFRVSITATVTSL
FT                   VVGTLLAYLFSMYDFKGKKFLQILIIIASMSAPFVGAYSWILLLRRNEVITKFLTNALH
FT                   LPAIDIYGFKGSILVFTLQLFPLVFLYVAGTMNSIDNSLLEAAESMGSFGFKPIVTVVL
FT                   PLLVSTLLAAPCLYL"
FT   gene            complement(236393..236485)
FT                   /locus_tag="SPCG_0249"
FT   CDS_pept        complement(236393..236485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89503"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISG5"
FT                   /protein_id="ACB89503.1"
FT                   /translation="MDSFLFLHLSYLSCLSRLSYRYRAQASTYT"
FT   gene            236462..236560
FT                   /locus_tag="SPCG_0251"
FT   CDS_pept        236462..236560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89502"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISG6"
FT                   /protein_id="ACB89502.1"
FT                   /translation="MKKEEAVQIFSFLHSMVDSFYQVLGTICRKDV"
FT   gene            complement(236498..236902)
FT                   /locus_tag="SPCG_0252"
FT   CDS_pept        complement(236498..236902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89504"
FT                   /db_xref="GOA:B2ISG7"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISG7"
FT                   /protein_id="ACB89504.1"
FT                   /translation="MATFIGRTNIIPANLEKRSDGAYIVFSDGYALRMPALDQVEEQAI
FT                   HVSIRPEEFIKDESGDIEGTISDSVYLGLNTEYFIETGFASKIQVSEESTFEEELQKGN
FT                   RIRLRINTQKLNIFSADGSQNLIKGVNHGM"
FT   gene            complement(236930..237526)
FT                   /locus_tag="SPCG_0253"
FT   CDS_pept        complement(236930..237526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89505"
FT                   /db_xref="GOA:B2ISG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISG8"
FT                   /protein_id="ACB89505.1"
FT                   /translation="MNITIPKGSLFTLLGPSGCGKTTLLRMIAGFNSIKDGEFYFDDTK
FT                   INNMESSKRNIGMVFQNYAIFPHLTVRDNVAFDLKQKKVPKEELIQQTNKYLELMQIAQ
FT                   YADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEPLSNLEAKLRLDMRQAIREIQHEVG
FT                   ITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRPK"
FT   gene            complement(237601..237969)
FT                   /locus_tag="SPCG_0254"
FT   CDS_pept        complement(237601..237969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89506"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISG9"
FT                   /protein_id="ACB89506.1"
FT                   /translation="MAVGLSYEDPAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKAKN
FT                   MENDKKFIDFIISQEVQDTLGTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIKNK
FT                   SDIVKKYNKVFTDIQSKQ"
FT   gene            complement(238114..238707)
FT                   /locus_tag="SPCG_0255"
FT   CDS_pept        complement(238114..238707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89507"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH0"
FT                   /protein_id="ACB89507.1"
FT                   /translation="MYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGATIPAFEE
FT                   KYGIKIELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYATHGELFEKYISKENDNVI
FT                   KEYQNTTGFSTPYTLDGSVLIVHPDLTKGMNIEGYSDLLKPELKGKIATADPANSSSAF
FT                   AQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVK"
FT   gene            complement(239211..239987)
FT                   /gene="pflE"
FT                   /locus_tag="SPCG_0256"
FT   CDS_pept        complement(239211..239987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflE"
FT                   /locus_tag="SPCG_0256"
FT                   /product="pyruvate formate-lyase-activating enzyme,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89508"
FT                   /db_xref="GOA:B2ISH1"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH1"
FT                   /protein_id="ACB89508.1"
FT                   /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQR
FT                   MKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEFAK
FT                   AILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFNQMI
FT                   IKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFGENKY
FT                   RLLNRKYEMDGINALHPEDLIDYQKVFLNHHINCYF"
FT   gene            240061..240855
FT                   /gene="deoR"
FT                   /locus_tag="SPCG_0257"
FT   CDS_pept        240061..240855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoR"
FT                   /locus_tag="SPCG_0257"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89509"
FT                   /db_xref="GOA:B2ISH2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH2"
FT                   /protein_id="ACB89509.1"
FT                   /translation="MLFFAFYFGRIKRRCKMKRLEQIIKLVSEYEKIDVNTLSEKLNVS
FT                   KVTIRKDLDKLESKGLLHREHGYAVLNSGDDLNVRLSINYETKRKIVQEAVKLVSDNET
FT                   IMIESGSTCALLAEEICKQKRNVTIVTNSFFIANFVRAYDSCRVIVLGGEFQKDSQVTV
FT                   GPLLKEMIQTFHVCQAFVGTDGYDKEMGFTGKDLMRSEVVQYISAVSDKVIVLTDSSKF
FT                   DKRGTVRRFALSQVYEVITDEKLSKQNIATLENAGIMVKVVS"
FT   gene            240868..241848
FT                   /locus_tag="SPCG_0258"
FT   CDS_pept        240868..241848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0258"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89510"
FT                   /db_xref="GOA:B2ISH3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH3"
FT                   /protein_id="ACB89510.1"
FT                   /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEAR
FT                   NVGIVKIEIENFDTNMFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGVLR
FT                   NLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYEMSR
FT                   KFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGKHQWL
FT                   DMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQSLAVAY
FT                   GDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
FT   gene            242043..242363
FT                   /locus_tag="SPCG_0259"
FT   CDS_pept        242043..242363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0259"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89511"
FT                   /db_xref="GOA:B2ISH4"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH4"
FT                   /protein_id="ACB89511.1"
FT                   /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQL
FT                   ADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELH
FT                   KK"
FT   gene            242409..242717
FT                   /locus_tag="SPCG_0260"
FT   CDS_pept        242409..242717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0260"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89512"
FT                   /db_xref="GOA:B2ISH5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH5"
FT                   /protein_id="ACB89512.1"
FT                   /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLADY
FT                   APNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG"
FT   gene            242710..244032
FT                   /locus_tag="SPCG_0261"
FT   CDS_pept        242710..244032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0261"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89513"
FT                   /db_xref="GOA:B2ISH6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH6"
FT                   /protein_id="ACB89513.1"
FT                   /translation="MGKKRRFIMSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTV
FT                   VGSLFLIMGQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNS
FT                   GVEALPAGVLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIY
FT                   TFFIKRKIVIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSLTNGGTFIEMIYS
FT                   AIQVPLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKTMLASA
FT                   NLSLENGAHIVTQQFLDSFLILSGSGITFGLVVAMLFAAKSKQYQALGKVAAFPAIFNV
FT                   NEPVVFGFPIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGF
FT                   LVGGWQGVVTQLLVLVISTVVYFPFFKIQDRLAYQNEIKQS"
FT   gene            244174..246621
FT                   /gene="pflF"
FT                   /locus_tag="SPCG_0262"
FT   CDS_pept        244174..246621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflF"
FT                   /locus_tag="SPCG_0262"
FT                   /product="formate acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89514"
FT                   /db_xref="GOA:B2ISH7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH7"
FT                   /protein_id="ACB89514.1"
FT                   /translation="MLTMVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERA
FT                   VLATRAYERYKEQPNVLKRAYMLKEILENMSIYIEEESMIAGNQASSNKDAPIFPEYTL
FT                   EFVLNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETG
FT                   FFGMEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSIF
FT                   IVIDAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSVWF
FT                   IQCILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITINKVR
FT                   SQSHTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGL
FT                   DARFMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAVPGKWG
FT                   YRCTGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDKTLRYLT
FT                   RMSVIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQVGIANLSD
FT                   SLAAIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDDDYADKLVT
FT                   AAYDIYVDEIAKYPNTRYGRGPIGGIRYSGTSSISANVGQGRGTLATPDGRNAGTPLAE
FT                   GCSPSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLIALLRTF
FT                   FNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIGRTE
FT                   HTL"
FT   gene            246640..247308
FT                   /gene="talC"
FT                   /locus_tag="SPCG_0263"
FT   CDS_pept        246640..247308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talC"
FT                   /locus_tag="SPCG_0263"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89515"
FT                   /db_xref="GOA:B2ISH8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH8"
FT                   /protein_id="ACB89515.1"
FT                   /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIK
FT                   DVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKE
FT                   GYHITATAIYTVIQGLLAIEVGADYLAPYYNRMENLNIDSNSVIRQLALAIDRQNSPSK
FT                   ILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVIQNSRSI
FT                   "
FT   gene            247326..248414
FT                   /gene="gldA"
FT                   /locus_tag="SPCG_0264"
FT   CDS_pept        247326..248414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="SPCG_0264"
FT                   /product="glycerol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89516"
FT                   /db_xref="GOA:B2ISH9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISH9"
FT                   /protein_id="ACB89516.1"
FT                   /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGK
FT                   RFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIAD
FT                   LIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRL
FT                   LASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEA
FT                   KVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLV
FT                   QLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMP
FT                   FKISPSDVAQAIIAVDAYVNSK"
FT   gene            248869..251370
FT                   /gene="leuS"
FT                   /locus_tag="SPCG_0265"
FT   CDS_pept        248869..251370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SPCG_0265"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89517"
FT                   /db_xref="GOA:B2ISI0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISI0"
FT                   /protein_id="ACB89517.1"
FT                   /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTSEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWSESIKDMQRN
FT                   WIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQAEAVV
FT                   DYKHQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEMPIWIADYVLASYGTGAVMAV
FT                   PAHDQRDWEFAKQFDLPIVEVLEGGNVEEAAYTEDGLHVNSDFLDGLNKEDAIAKIVAC
FT                   LEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPETELPLVLPVTKDIR
FT                   PSGTGESPLANLTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADED
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DHRGALVATDKVEKRDGSFFHIETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALDKAYNETVKAVTE
FT                   QIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHLAEELWQTVAETDK
FT                   SISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREELQEIALADEKVKAEI
FT                   DGKEIVKVIAVPNKLVNIVVK"
FT   gene            251565..252260
FT                   /locus_tag="SPCG_0266"
FT   CDS_pept        251565..252260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0266"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89518"
FT                   /db_xref="GOA:B2ISI1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI1"
FT                   /protein_id="ACB89518.1"
FT                   /translation="MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHAE
FT                   DLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALGSF
FT                   SLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDALNLP
FT                   SRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENFDKNG
FT                   QQYKSLREL"
FT   gene            252272..252688
FT                   /locus_tag="SPCG_0267"
FT   CDS_pept        252272..252688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0267"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89519"
FT                   /db_xref="GOA:B2ISI2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI2"
FT                   /protein_id="ACB89519.1"
FT                   /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEQALSHSLVIY
FT                   LALDGDAVVGLIRLVGDGFSSVLVQDLIVLPIYQRQGIGSALMKEALEDYKDAYQVQLV
FT                   TEETERTLGFYRSMGFEILSTYNCIGMTWMNRKK"
FT   gene            complement(253503..253595)
FT                   /locus_tag="SPCG_0268"
FT   CDS_pept        complement(253503..253595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89520"
FT                   /db_xref="GOA:B2ISI3"
FT                   /db_xref="InterPro:IPR025882"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI3"
FT                   /protein_id="ACB89520.1"
FT                   /translation="MMELVLKTIIGPIVVGVVLRIVDKWLNKDK"
FT   gene            253729..254727
FT                   /gene="ruvB"
FT                   /locus_tag="SPCG_0269"
FT   CDS_pept        253729..254727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SPCG_0269"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89521"
FT                   /db_xref="GOA:B2ISI4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISI4"
FT                   /protein_id="ACB89521.1"
FT                   /translation="MSRILDNEIMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEAA
FT                   KMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELEPG
FT                   DVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPRIANR
FT                   LLKRVRDFAQIVGNGVIDDVITDKALTMLDVDHEGLDYVDQKILRTMIEMYGGGPVGLG
FT                   TLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRMATAKAYEHLGYEYNEK"
FT   gene            254693..255280
FT                   /locus_tag="SPCG_0270"
FT   CDS_pept        254693..255280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89522"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI5"
FT                   /protein_id="ACB89522.1"
FT                   /translation="MSIWGMSTMKNKQEILEAFRKNPDMMAILTIIQNLELTDSWLAAG
FT                   SVRNFIWNLLSDKSPFDFETDVDVIFFDPDISYEETLLLEKKLREDFPQYQWELKNQVY
FT                   MHQHSPHTAPYTSSRDAMSKYPERCTAVGLRLNEESALELFTPYGLEDILNFQVRPTPH
FT                   FLENQERMELYQTRLSKKNWQEKWKNLIFKNT"
FT   gene            255493..256269
FT                   /gene="uppS"
FT                   /locus_tag="SPCG_0271"
FT   CDS_pept        255493..256269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SPCG_0271"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89523"
FT                   /db_xref="GOA:B2ISI6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI6"
FT                   /protein_id="ACB89523.1"
FT                   /translation="MNRNKIMFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQ
FT                   PRVFGHKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNY
FT                   VPELHANNVKIQMIGETDRLPKQTFEALTKAEELTKNNTGLILNFALNYGGRAEITQAL
FT                   KLISQDVLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGA
FT                   YSELYFTDTLWPDFDEVALQEAILAYNRRHRRFGGV"
FT   gene            256278..257081
FT                   /gene="cdsA"
FT                   /locus_tag="SPCG_0272"
FT   CDS_pept        256278..257081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="SPCG_0272"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89524"
FT                   /db_xref="GOA:B2ISI7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI7"
FT                   /protein_id="ACB89524.1"
FT                   /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIIAMLAMHEL
FT                   LKMRGLETMTMEGLLTLFATFVLTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFSKS
FT                   YTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYGKRK
FT                   LAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAGQFGD
FT                   LLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
FT   gene            257103..258362
FT                   /gene="eep"
FT                   /locus_tag="SPCG_0273"
FT   CDS_pept        257103..258362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eep"
FT                   /locus_tag="SPCG_0273"
FT                   /product="eep protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89525"
FT                   /db_xref="GOA:B2ISI8"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISI8"
FT                   /protein_id="ACB89525.1"
FT                   /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   AHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGKKL
FT                   DQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQYQNA
FT                   TIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGVPETA
FT                   QITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQGRYLLG
FT                   VQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKASSDAAKN
FT                   GIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETYVTLAGVV
FT                   IMVVLMIAVTWNDIMRLFFR"
FT   gene            258375..260228
FT                   /gene="proS"
FT                   /locus_tag="SPCG_0274"
FT   CDS_pept        258375..260228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SPCG_0274"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89526"
FT                   /db_xref="GOA:B2ISI9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISI9"
FT                   /protein_id="ACB89526.1"
FT                   /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLPL
FT                   ANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKSDF
FT                   ILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDAYSF
FT                   HANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSARTALDR
FT                   WVVLDKSVVSFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATNEYKPS
FT                   NRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVGNDQLNE
FT                   VKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVRNAVVGAN
FT                   EDGYHLTGVNPGRDFTAEYVDIREVREGEISPDGQGVLNFARGIEIGHIFKLGTRYSAS
FT                   MGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKFSDSDLIGLPI
FT                   RITVGKKATDGIVEVKIKATGDTIEVHADNVLETLEILSKK"
FT   gene            260327..261706
FT                   /locus_tag="SPCG_0275"
FT   CDS_pept        260327..261706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0275"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89527"
FT                   /db_xref="GOA:B2ISJ0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ0"
FT                   /protein_id="ACB89527.1"
FT                   /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDYWFQVEPNRYY
FT                   NGIGSDKTSTFYENWERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNPQGVDFYRKVF
FT                   EAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWIT
FT                   FNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLN
FT                   LTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDATEEEL
FT                   ELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSHRGWEIY
FT                   EQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKGHLRELHR
FT                   AIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWFKKLSDNNG
FT                   F"
FT   gene            261899..263707
FT                   /gene="glmS"
FT                   /locus_tag="SPCG_0276"
FT   CDS_pept        261899..263707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="SPCG_0276"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89528"
FT                   /db_xref="GOA:B2ISJ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ1"
FT                   /protein_id="ACB89528.1"
FT                   /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGTDNHLV
FT                   KAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIENY
FT                   LEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFALIDS
FT                   ENPDVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADSVEVQ
FT                   DYDGNRRERASYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQVVVDP
FT                   AIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPLLSKKPL
FT                   FIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGPEIAVAST
FT                   KAYTAQIAALAFLAKAVGEANGNAKAQAFDLVHELSIVAQSIESTLSEKETIEAKVREL
FT                   LETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALIEEGTPVLAL
FT                   LSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLSPISMVVPTQL
FT                   VAYFATLHRGLDVDKPRNLAKSVTVE"
FT   gene            263826..264875
FT                   /locus_tag="SPCG_0277"
FT   CDS_pept        263826..264875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0277"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89529"
FT                   /db_xref="GOA:B2ISJ2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ2"
FT                   /protein_id="ACB89529.1"
FT                   /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKIGLDV
FT                   YGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDALSN
FT                   GRSEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTIAGK
FT                   EVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYREIGSE
FT                   AGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQYLEQV
FT                   GPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGTQVAPKV
FT                   RAYFAMKEA"
FT   gene            complement(264975..268772)
FT                   /locus_tag="SPCG_0278"
FT   CDS_pept        complement(264975..268772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0278"
FT                   /product="alkaline amylopullulanase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89530"
FT                   /db_xref="GOA:B2ISJ3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011838"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR040806"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ3"
FT                   /protein_id="ACB89530.1"
FT                   /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGASLVLLAMATPTISSD
FT                   ESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPRNANASLEKTEEKPATEPTTS
FT                   TSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDDVEKPSENWPNGALSFKDA
FT                   KKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVEKLVPKMNEAWLDQDYKVFS
FT                   YEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQWPDGTDFTATGKYGRYIDIPL
FT                   NEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQIFLKDDDESIYTNPYYVHDIR
FT                   MTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHLGNKVTITDVAIDEAGKKVTYSG
FT                   DFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGKLGADLKEEGKQVDLTLWSPSADK
FT                   VSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDSTNKLGITDFTGYYYQYQIERQGKTV
FT                   LALDPYAKSLAAWNSDDAKIDDAHKVAKAAFVDPAKLGPQDLTYGKIHNFKTREDAVIY
FT                   EAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDYLKDLGVTHIQLLPVLSYYFVNELKNH
FT                   ERLSDYASSNSNYNWGYDPQNYFSLTGMYSSDPKNPEKRIAEFKNLINEIHKRGMGAIL
FT                   DVVYNHTAKVDIFEDLEPNYYHFMDADGTPRTSFGGGRLGTTHHMTKRLLVDSIKYLVD
FT                   TYKVDGFRFDMMGDHDAASIEEAYKAARALNPNLIMLGEGWRTYAGDENMPTKAADQDW
FT                   MKHTDTVAVFSDDIRNNLKSGYPNEGQPAFITGGKRDVNTIFKNLIAQPTNFEADSPGD
FT                   VIQYIAAHDNLTLFDIIAQSIKKDPSKAENYAEIHRRLRLGNLMVLTAQGTPFIHSGQE
FT                   YGRTKQFRDPAYKTPVAEDKVPNKSHLLRDKDGNPFDYPYFIHDSYDSSDAVNKFDWTK
FT                   ATDGKAYPENVKSRDYMKGLIALRQSTDAFRLKSLQDIKDRVHLITVPGQNGVEKEDVV
FT                   IGYQITAPNGDIYAVFVNADEKAREFNLGTAFAHLRNAEVLADENQAGSVGIANPKGLE
FT                   WTEKGLKLNALTATVLRVSQNGTSHESTAEEKPDSTPSKPEHQNEASHPAHQEPAPEAR
FT                   PDSTKPDAKVADAENKPSQATADSQAEQPAQKAQASSVKEAVRKESVENSSKENISATP
FT                   DRQAELPNTGIKNENKLLFTGISLLALLGLGFLLKNKKEN"
FT   gene            268849..270405
FT                   /locus_tag="SPCG_0279"
FT   CDS_pept        268849..270405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0279"
FT                   /product="IS1380-Spn1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89531"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ4"
FT                   /protein_id="ACB89531.1"
FT                   /translation="MKKILTFEKFSVLFKPQLFTPNLKTIQNPCLSLDPGWFLFSPNGC
FT                   FLLDKKEFPLYGISVEKNTKRKETHMNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQ
FT                   ELFSQLKLKERISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYF
FT                   PKLLEGGQLASQPTLSRFLSRTDEETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHF
FT                   TTYGKQEGVAYNAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLER
FT                   FNQLLFRMDSGFATPKLYDLIEKTGQYYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPH
FT                   SAYSETLYQAGSWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQA
FT                   ENFIKEMKEGFFGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRH
FT                   LFLHVVGKCVRTGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMM
FT                   H"
FT   gene            270667..270762
FT                   /locus_tag="SPCG_0280"
FT   CDS_pept        270667..270762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89532"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ5"
FT                   /protein_id="ACB89532.1"
FT                   /translation="MFPAIFIQKLISNITNKKEKYLDKQGKILLQ"
FT   gene            270818..270910
FT                   /locus_tag="SPCG_0281"
FT   CDS_pept        270818..270910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89533"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISJ6"
FT                   /protein_id="ACB89533.1"
FT                   /translation="MLQKYTQMISVTKCIITKNKKTQENVDAYN"
FT   gene            270897..271310
FT                   /gene="rpsL"
FT                   /locus_tag="SPCG_0282"
FT   CDS_pept        270897..271310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SPCG_0282"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89534"
FT                   /db_xref="GOA:B2ISJ7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISJ7"
FT                   /protein_id="ACB89534.1"
FT                   /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLP
FT                   GVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
FT   gene            271330..271800
FT                   /gene="rpsG"
FT                   /locus_tag="SPCG_0283"
FT   CDS_pept        271330..271800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SPCG_0283"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89535"
FT                   /db_xref="GOA:B2ISJ8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISJ8"
FT                   /protein_id="ACB89535.1"
FT                   /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYG
FT                   AFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
FT   gene            272225..274306
FT                   /gene="fusA"
FT                   /locus_tag="SPCG_0284"
FT   CDS_pept        272225..274306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="SPCG_0284"
FT                   /product="elongation factor EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89536"
FT                   /db_xref="GOA:B2ISJ9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISJ9"
FT                   /protein_id="ACB89536.1"
FT                   /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAHPIQ
FT                   LPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAVAETD
FT                   EELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIDYLPSP
FT                   LDIPAIKGINPDTDAEETRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLQSGSYV
FT                   LNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEKSKIILES
FT                   INVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVISGMGELHLD
FT                   VLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGED"
FT   gene            274410..278801
FT                   /gene="polC"
FT                   /locus_tag="SPCG_0285"
FT   CDS_pept        274410..278801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="SPCG_0285"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89537"
FT                   /db_xref="GOA:B2ISK0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK0"
FT                   /protein_id="ACB89537.1"
FT                   /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFHF
FT                   VFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGPCA
FT                   SQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQVEK
FT                   NDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPVFDFQAKKAAAKP
FT                   KLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSMQKWVK
FT                   NEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPEGERRVE
FT                   FHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKAGIQLIYG
FT                   MEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKMYKGNVIAE
FT                   FDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVAHNATFDVGF
FT                   MNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEHHHMANYDAEA
FT                   TGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKNQVGLKNIFKLV
FT                   SLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVDGAVEVAKYYDFI
FT                   EVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGNVHYIEPEEEIYRE
FT                   IIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFLGEELARKLVIENTN
FT                   ALAEIFEPVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPLPDIVDLRIEKELTSI
FT                   LGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGITEVNPLSPHYVCGQCQ
FT                   YSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLGFDGDKVPDIDLNFSGED
FT                   QPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERDYGKFYRDAEVERLAQGAA
FT                   GVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQTTHFNFHDIDENVLKLDVL
FT                   GHDDPTMIRKLQDLSGIDPNEIPMDDEGVMALFSGTDVLGVTPEQIGTPTGMLGIPEFG
FT                   TNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKQGIADLSTVIGCRDDIMV
FT                   YLMHAGLEPKMAFTIMERVRKGLWLKISEEERNDYIEAMKANKVPEWYIESCGKIKYMF
FT                   PKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAKAFDIKTMGAGLEVIKRRMEEISE
FT                   KRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLDLYRSQATEFLIDGDTLIPPFVAMD
FT                   GLGENVAKQLVRAREEGEFLSKTELRKRGGLSSTLVEKMDEMGILGNMPEDNQLSLFDE
FT                   LF"
FT   gene            278903..279166
FT                   /locus_tag="SPCG_0286"
FT   CDS_pept        278903..279166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89538"
FT                   /db_xref="GOA:B2ISK1"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK1"
FT                   /protein_id="ACB89538.1"
FT                   /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQG
FT                   LPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
FT   gene            279159..279437
FT                   /locus_tag="SPCG_0287"
FT   CDS_pept        279159..279437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89539"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK2"
FT                   /protein_id="ACB89539.1"
FT                   /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARYR
FT                   DHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
FT   gene            279458..279610
FT                   /locus_tag="SPCG_0288"
FT   CDS_pept        279458..279610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89540"
FT                   /db_xref="GOA:B2ISK3"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK3"
FT                   /protein_id="ACB89540.1"
FT                   /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIFS
FT                   ALREK"
FT   gene            279632..280873
FT                   /gene="pepS"
FT                   /locus_tag="SPCG_0289"
FT   CDS_pept        279632..280873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepS"
FT                   /locus_tag="SPCG_0289"
FT                   /product="aminopeptidase PepS"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89541"
FT                   /db_xref="GOA:B2ISK4"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK4"
FT                   /protein_id="ACB89541.1"
FT                   /translation="MVLPNFKENLEKYAKLLVANGINVQPGHTLALSIDVEQRELAHLI
FT                   VKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLGVR
FT                   SSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAA
FT                   SDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAPGTDL
FT                   TLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYNGNIIE
FT                   GIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGITFFNTL
FT                   FDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMDIDGIRED
FT                   GTRVPLFRNGNWAN"
FT   gene            280883..281113
FT                   /locus_tag="SPCG_0290"
FT   CDS_pept        280883..281113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89542"
FT                   /db_xref="GOA:B2ISK5"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK5"
FT                   /protein_id="ACB89542.1"
FT                   /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLF
FT                   GTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
FT   gene            281369..282091
FT                   /gene="rsuA"
FT                   /locus_tag="SPCG_0291"
FT   CDS_pept        281369..282091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="SPCG_0291"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89543"
FT                   /db_xref="GOA:B2ISK6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK6"
FT                   /protein_id="ACB89543.1"
FT                   /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKI
FT                   DEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDI
FT                   DTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLKDFTCQPA
FT                   RLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERG
FT                   EWRRLTKEELEILRANII"
FT   gene            282308..283642
FT                   /gene="pepC"
FT                   /locus_tag="SPCG_0292"
FT   CDS_pept        282308..283642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SPCG_0292"
FT                   /product="aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89544"
FT                   /db_xref="GOA:B2ISK7"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK7"
FT                   /protein_id="ACB89544.1"
FT                   /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALECRQSHV
FT                   DNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWDKY
FT                   EKSNWFLEQVIVTSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYPESV
FT                   SSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSLGLPP
FT                   RKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATDVYDFES
FT                   SMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVGTDGYFVA
FT                   SDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
FT   gene            complement(283698..284609)
FT                   /gene="manN"
FT                   /locus_tag="SPCG_0293"
FT   CDS_pept        complement(283698..284609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="SPCG_0293"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89545"
FT                   /db_xref="GOA:B2ISK8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK8"
FT                   /protein_id="ACB89545.1"
FT                   /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAIK
FT                   KLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQEIGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKAYIHW
FT                   DKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYLLKKKV
FT                   SPITIILALFAVGIVAHVLHIM"
FT   gene            complement(284633..285436)
FT                   /gene="manM"
FT                   /locus_tag="SPCG_0294"
FT   CDS_pept        complement(284633..285436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="SPCG_0294"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89546"
FT                   /db_xref="GOA:B2ISK9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISK9"
FT                   /protein_id="ACB89546.1"
FT                   /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHLE
FT                   AGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAIPL
FT                   AVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALLLMV
FT                   PTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLAAVSD
FT                   ITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
FT   gene            complement(285464..286462)
FT                   /gene="manL"
FT                   /locus_tag="SPCG_0295"
FT   CDS_pept        complement(285464..286462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="SPCG_0295"
FT                   /product="PTS system, mannose-specific IIAB components"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89547"
FT                   /db_xref="GOA:B2ISL0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL0"
FT                   /protein_id="ACB89547.1"
FT                   /translation="MTIMSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGP
FT                   DDLYAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLI
FT                   QAYTERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGT
FT                   VIGDGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAPG
FT                   NVKANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHSTG
FT                   KTLVNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
FT   gene            complement(286862..288469)
FT                   /locus_tag="SPCG_0296"
FT   CDS_pept        complement(286862..288469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0296"
FT                   /product="IS1380-Spn1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89548"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL1"
FT                   /protein_id="ACB89548.1"
FT                   /translation="MLLPFSTKWKKAKSKDVWYSTSPTNLIETYFKPQLFTPNLKTIQN
FT                   PCLSLDPGWFLFSPNGCFLLDKKEFPLYGISVEKNTKRKETHMNSLPNHHFQNKSFYQL
FT                   SFDGGHLTQYGGLIFFQELFSQLKLKERISKYLVTNDQRRYCRYSDSDILVQFLFQLLT
FT                   GYGTDYACKELSADAYFPKLLEGGQLASQPTLSRFLSRTDEETVHSLRCLNLELVEFFL
FT                   QFHQLNQLIVDIDSTHFTTYGKQEGVAYNAHYRAHGYHPLYAFEGKTGYCFNAQLRPGN
FT                   RYCSEEADSFITPVLERFNQLLFRMDSGFATPKLYDLIEKTGQYYLIKLKKNTVLSRLG
FT                   DLSLPCPQDEDLTILPHSAYSETLYQAGSWSHKRRVCQFSERKEGNLFYDVISLVTNMT
FT                   SGTSQDQFQLYRGRGQAENFIKEMKEGFFGDKTDSSTLIKNEVRMMMSCIAYNLYLFLK
FT                   HLAGGDFQTLTIKRFRHLFLHVVGKCVRTGRKQLLKLSSLYAYSELFSALYSRIRKVNL
FT                   NLPVPYEPPRRKASLMMH"
FT   gene            complement(288396..289415)
FT                   /gene="adhP"
FT                   /locus_tag="SPCG_0297"
FT   CDS_pept        complement(288396..289415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SPCG_0297"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89549"
FT                   /db_xref="GOA:B2ISL2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL2"
FT                   /protein_id="ACB89549.1"
FT                   /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVA
FT                   HGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLC
FT                   RTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPG
FT                   QWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVAG
FT                   LIKEKTDGGAHSAVVTAVSKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQ
FT                   VIGSLVGTRKDLEEAFQFGAEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH"
FT   gene            complement(289524..289670)
FT                   /locus_tag="SPCG_0298"
FT   CDS_pept        complement(289524..289670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89550"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL3"
FT                   /protein_id="ACB89550.1"
FT                   /translation="MKLTWFEEIFEEYDQLASWSLCSFHSLINQLIDCSTFCLQNLGKG
FT                   FLL"
FT   gene            complement(289754..290566)
FT                   /locus_tag="SPCG_0299"
FT   CDS_pept        complement(289754..290566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0299"
FT                   /product="Cof family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89551"
FT                   /db_xref="GOA:B2ISL4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL4"
FT                   /protein_id="ACB89551.1"
FT                   /translation="MTKKIIAVDLDGTLLNSDSQISDFTKKTIKKVAEKGHQVIITTGR
FT                   PYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSEDIQAD
FT                   FIAGEYRKKFYITNPNEEIANPKLFGVEAFQPEDQFQPELVTKDPNCILLQTRASDKYA
FT                   LAKDMNAFYQHQLSINTWGGPLNILECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEH
FT                   NDTEMLAFAGKGYAMKNANPELLPYADEQISLTNDQDGVAKTLQDLFL"
FT   gene            290702..292174
FT                   /locus_tag="SPCG_0300"
FT   CDS_pept        290702..292174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0300"
FT                   /product="xanthine/uracil permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89552"
FT                   /db_xref="GOA:B2ISL5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL5"
FT                   /protein_id="ACB89552.1"
FT                   /translation="MINDIILLLFVKIKRRLMMDKLFKLKENGTDVRTEVLAGLTTFFA
FT                   MSYILFVNPQILSQTGMPAQGVFLATIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTF
FT                   TVVFGLGYSWQEALAMVFICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYV
FT                   GIKNAGLLKFTIDPGNYTVVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAIT
FT                   IFFVIKGIKGGIILSILTTTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTICGAALGSE
FT                   GLGALVSDTPRLPETLMAILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKA
FT                   LYSDLIGTTVGAIAGTSNVTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIV
FT                   PTAATAPILIIVGIMMLGSLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYT
FT                   LTKLVKGQVKDVHVMIWILDALFILNYISMAL"
FT   gene            292224..292934
FT                   /locus_tag="SPCG_0301"
FT   CDS_pept        292224..292934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89553"
FT                   /db_xref="GOA:B2ISL6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL6"
FT                   /protein_id="ACB89553.1"
FT                   /translation="MMKEKSMWKELLNRAGWILVFLLATILYQIPLAVTSILTLNAVPL
FT                   LQSGLIVAGISIVVLALFIIGARKTQLASFNFSFFRAKDLARLGLSYLVIICSNILGSI
FT                   LLQLSNETTTGNQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIIPKKVFRGKESW
FT                   GFVVGTIVFALLHQPSNLPSLLIYGGMSIVLSWTAYKTQRLEMSILLHIIVNGVAFCLL
FT                   ALVVIMSRTLGISV"
FT   gene            293028..294008
FT                   /gene="sulA"
FT                   /locus_tag="SPCG_0302"
FT   CDS_pept        293028..294008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulA"
FT                   /locus_tag="SPCG_0302"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89554"
FT                   /db_xref="GOA:B2ISL7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL7"
FT                   /protein_id="ACB89554.1"
FT                   /translation="MMKSLEGVTDMSSKANHAKTAICGIINVTPDSFSDGGQFFALEQA
FT                   LQQARKLIAEGASMLDIGGESTRPRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDT
FT                   WKSQVAEAALAAGANLVNDITGLMGDEKMAHEVAKAGAKVVIMFNPVMARPQHPSSLIF
FT                   PHFGFGQAFTEKELADFEKLPIEELMETFFERALARAEEAGIAQENILLDSGIGFGLTK
FT                   KENLLLLRDLDKLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHV
FT                   TSIAARQGVDVVRVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
FT   gene            294010..295332
FT                   /gene="sulB"
FT                   /locus_tag="SPCG_0303"
FT   CDS_pept        294010..295332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulB"
FT                   /locus_tag="SPCG_0303"
FT                   /product="dihydrofolate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89555"
FT                   /db_xref="GOA:B2ISL8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISL8"
FT                   /protein_id="ACB89555.1"
FT                   /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHIG
FT                   GTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADYQS
FT                   LLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILTGIT
FT                   TIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRIAEGKDAPRLAYG
FT                   TDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQEDGREL
FT                   ASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADYHKEILF
FT                   TCIKTKALGDMLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQDWHDFLEQ
FT                   NLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
FT   gene            295313..295867
FT                   /gene="folE"
FT                   /locus_tag="SPCG_0304"
FT   CDS_pept        295313..295867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="SPCG_0304"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89556"
FT                   /db_xref="GOA:B2ISL9"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISL9"
FT                   /protein_id="ACB89556.1"
FT                   /translation="MDTQKIEAAVKMIIEAVGENANREGLQETPARVARMYQEIFSGLG
FT                   QTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLAR
FT                   TVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTV
FT                   ARGLFETDKDLRDQAYRLMGL"
FT   gene            295910..296722
FT                   /gene="sulD"
FT                   /locus_tag="SPCG_0305"
FT   CDS_pept        295910..296722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulD"
FT                   /locus_tag="SPCG_0305"
FT                   /product="bifunctional folate synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89557"
FT                   /db_xref="GOA:B2ISM0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM0"
FT                   /protein_id="ACB89557.1"
FT                   /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDL
FT                   DLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPV
FT                   HLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPW
FT                   GGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQI
FT                   LYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
FT   gene            complement(296767..297138)
FT                   /locus_tag="SPCG_0306"
FT   CDS_pept        complement(296767..297138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89558"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM1"
FT                   /protein_id="ACB89558.1"
FT                   /translation="MIFNPICCMIREKKGDRDMAFTNTHMRSASFGIVTSLPDDIIDSF
FT                   WYIIDHFLKNVFELEEELEFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVL
FT                   VLDMDGRETILLPEENDLF"
FT   gene            complement(297128..297232)
FT                   /locus_tag="SPCG_0307"
FT   CDS_pept        complement(297128..297232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89559"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM2"
FT                   /protein_id="ACB89559.1"
FT                   /translation="MGIYLLTSVDFWEFFSFFFPVVKILFKKSPFLDF"
FT   gene            297441..297887
FT                   /gene="rplM"
FT                   /locus_tag="SPCG_0308"
FT   CDS_pept        297441..297887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SPCG_0308"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89560"
FT                   /db_xref="GOA:B2ISM3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM3"
FT                   /protein_id="ACB89560.1"
FT                   /translation="MNKTTFMAKPGQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPT
FT                   FTPHTDTGDFVIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNAVRLIE
FT                   KSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
FT   gene            297907..298299
FT                   /gene="rpsI"
FT                   /locus_tag="SPCG_0309"
FT   CDS_pept        297907..298299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SPCG_0309"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89561"
FT                   /db_xref="GOA:B2ISM4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISM4"
FT                   /protein_id="ACB89561.1"
FT                   /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDSRKVERKKPGLKKARKASQFSKR"
FT   gene            298767..298937
FT                   /locus_tag="SPCG_0310"
FT   CDS_pept        298767..298937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89562"
FT                   /db_xref="GOA:B2ISM5"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM5"
FT                   /protein_id="ACB89562.1"
FT                   /translation="MGSYQKAPQKGITKLQYLLRGYFVLLLFQLIINRYKKKSFYWYKE
FT                   VIESNGETLYD"
FT   gene            299013..299351
FT                   /locus_tag="SPCG_0311"
FT   CDS_pept        299013..299351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89563"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM6"
FT                   /protein_id="ACB89563.1"
FT                   /translation="MTLTIHVYYKGDGDSAIKFAREMLESGLVAEIRCQKGNLKYEYFL
FT                   PIEKEGTILLIDQWINQKALDEHHQSKTMQKILDLRKKYHLQMQVERYIEDDSGMPESD
FT                   KSFIDTGN"
FT   gene            299499..300977
FT                   /gene="bglA"
FT                   /locus_tag="SPCG_0312"
FT   CDS_pept        299499..300977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="SPCG_0312"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89564"
FT                   /db_xref="GOA:B2ISM7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM7"
FT                   /protein_id="ACB89564.1"
FT                   /translation="MRFIIRVSKSGGKKMTTFKDRFLWGGAVAAHQLEGGWQEGGKGIS
FT                   VADVMTAGRHGVAREITSGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSIAW
FT                   TRIFPKGDELEPNEEGLQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKL
FT                   IDFFARFAEVVFKRYKDKVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMY
FT                   QAAHYELVASARAVKIGHEINPDFQIGCMIAMCPIYPATCNPKDILMAMKAMQKRYYFA
FT                   DVHVLGKYPEHIFKYWERKGISVDFTAQDKEDLLGGTVDYIGFSYYMSFAIDSHRENNP
FT                   YFDYLETEDLVKNNYVKASEWEWQIDPEGLRCALNWFTDHYHLPLFIVENGFGAIDQVA
FT                   ADGMVHDDYRIEYLGAHIREMKKTVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIY
FT                   VDKDDNGKGSYNRSPKKSFGWYKEVISSNGESVE"
FT   gene            301029..301268
FT                   /locus_tag="SPCG_0313"
FT   CDS_pept        301029..301268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89565"
FT                   /db_xref="GOA:B2ISM8"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM8"
FT                   /protein_id="ACB89565.1"
FT                   /translation="MIGSIAAILTTFAFLPQVFRVVKTKDTGSIALGMYVMQVIGIALW
FT                   LAHGIRIGDLPLILANSVSFLLSGIILFYKLKYK"
FT   gene            301371..301712
FT                   /locus_tag="SPCG_0314"
FT   CDS_pept        301371..301712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0314"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89566"
FT                   /db_xref="GOA:B2ISM9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISM9"
FT                   /protein_id="ACB89566.1"
FT                   /translation="MDLRKGENIMAKALIICAAGMSSSLMAQKTTEFLKGKGKDIVVDA
FT                   ISATEGGKAIAAAAFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQIPPQAYIPIPMGIEK
FT                   MANLILENI"
FT   gene            301830..303809
FT                   /locus_tag="SPCG_0315"
FT   CDS_pept        301830..303809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0315"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89567"
FT                   /db_xref="GOA:B2ISN0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN0"
FT                   /protein_id="ACB89567.1"
FT                   /translation="MNVLNIKEKDILQFLIKNKERFVTSKELAEYLSCSDRTVRNVLKL
FT                   IEKTMIIQGVRLISKQGQGYQIFFENQGAYQEFRQTYELEEDYTKTAVSKGDDRLVFIL
FT                   NKLLFEQVPVLFDDLADELYVSRSTLSHDFRKIRVMLSEYNLSIESRANKGVYVSGEER
FT                   DKRRFIINYFLENQFFKTIHCYVKFNFFDQTVPLEEFARIVLDECQEANLKLSDFVLQN
FT                   LVVHIALSVIRLKSGFEIKNIDCQMTDDAIERKVAQRILSKVREVTNQEFPVQEIDYIT
FT                   LHLLAKSQQCQKNQKNISEEVLKKSLFKTFQNLGLDDMYNFSSDFQLIEGLITHLMTLQ
FT                   VRLESRITLNNPLVDEIKQNYSDIFFMTREILANMDKFLEWTISDDEVAYVSLHFLAAM
FT                   ERSKESTKFNILAICATGFGAAQMLRNRLETEFGKRVEVVDVIGYYELNQEKLKGIDFI
FT                   VSAVDLSNLYFQIPVFKVSVFLKSDEMEMIRKAMDQMQVSSYVQSSKINKFENNSFRQY
FT                   FSKENFLICTESDKVNLLEKMVESLSVGESNEFEQSLLYGIKQREELSSVVFSEKIAVP
FT                   HPIQPFGTEGKVSVEICKDSLLWDNQSSHVQLVFLLSPSIYGNEGLATVTKKIVSLTEN
FT                   DELQNQLISCNNFEDFINIFEKIK"
FT   gene            303819..304133
FT                   /locus_tag="SPCG_0316"
FT   CDS_pept        303819..304133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0316"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89568"
FT                   /db_xref="GOA:B2ISN1"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN1"
FT                   /protein_id="ACB89568.1"
FT                   /translation="MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQ
FT                   SNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
FT                   "
FT   gene            304164..304670
FT                   /locus_tag="SPCG_0317"
FT   CDS_pept        304164..304670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89569"
FT                   /db_xref="GOA:B2ISN2"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN2"
FT                   /protein_id="ACB89569.1"
FT                   /translation="MDKKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLL
FT                   NQFISPSPIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMLVRIQMLISIGLLVLT
FT                   WTSWFKNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKAYQQFVQLEK
FT                   NSLSL"
FT   gene            304750..306096
FT                   /locus_tag="SPCG_0318"
FT   CDS_pept        304750..306096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0318"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89570"
FT                   /db_xref="GOA:B2ISN3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN3"
FT                   /protein_id="ACB89570.1"
FT                   /translation="MDQQNGLFGFLENHVMGPMGKLAQFKVVRAITAAGMAAVPFTIVG
FT                   SMFLVFSILPQAFSFWPIVADIFSASFDKFTSLYMVANYATMGSLSLYFVLSLAYELTK
FT                   IYAEEEELNMNPLNGALLALMAFVMTVPQIIFDGGMMKTVTSLKEGAVIADGWAMGNGV
FT                   ARFGTTGIFTAIIMAIVTVLIYRMCVKHNWVIKMPEAVPEGVSRGFTALVPGFVVAFVV
FT                   IFINGLLVAMGTDIFKVIAIPFGFVSNLTNSWIGLMIIYLLTQLLWIVGIHGANIVFAF
FT                   VSPIALANMAENAAGGHFAVAGEFSNMFVIAGGSGATLGLCLYIAFASKSEQLKAIGRA
FT                   SVVPALFNINEPLIFGLPIIYNPALAIPFILAPMVTATIYYVANSLNFIKPIIAQVPWP
FT                   TPVGIGAFLGTADLRAVLVALVCAFAAFLVYLPFIRVYDQKLVKEEQGI"
FT   gene            306477..306653
FT                   /locus_tag="SPCG_0319"
FT   CDS_pept        306477..306653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89571"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN4"
FT                   /protein_id="ACB89571.1"
FT                   /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSDV
FT                   EKLRDEALALGMT"
FT   gene            307055..309268
FT                   /locus_tag="SPCG_0320"
FT   CDS_pept        307055..309268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0320"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89572"
FT                   /db_xref="GOA:B2ISN5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN5"
FT                   /protein_id="ACB89572.1"
FT                   /translation="MKIFKGEFYRISVLTDKLVRLEYSRTGNFEDRTTQLIYNRDFGQV
FT                   SLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLKGT
FT                   ARTLDKADGAISLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGHDYR
FT                   GAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVLDMDW
FT                   HITDIPARFGSGWTGYSWNRNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYEEAYPQ
FT                   IAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQGMLDPL
FT                   WLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPYFTATASN
FT                   IGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPWFFSETTSK
FT                   IMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPIYYFYPENDESYNVPNQYFFGTELMV
FT                   APIVEKMDLTFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTTPVFAKSGAII
FT                   PLVGSEIGMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDWEMGMVELALQG
FT                   DSSIVPSNRKHRIHFKGTNVSIIELPNKNDTAKFEWKDNKRTSLNDEVFRLLKTASLPY
FT                   ELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
FT   gene            complement(309490..309966)
FT                   /gene="basA"
FT                   /locus_tag="SPCG_0321"
FT   CDS_pept        complement(309490..309966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basA"
FT                   /locus_tag="SPCG_0321"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89573"
FT                   /db_xref="GOA:B2ISN6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN6"
FT                   /protein_id="ACB89573.1"
FT                   /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGL
FT                   QELYERYQDQGFEILDFPCNQFMGQAPGSAEEINTFCSLHFQTTFPRFAKIKVNGKEAD
FT                   PLYVWLKDHKSGPLGKRVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
FT   gene            310156..313392
FT                   /locus_tag="SPCG_0322"
FT   CDS_pept        310156..313392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0322"
FT                   /product="hyaluronidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89574"
FT                   /db_xref="GOA:B2ISN7"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN7"
FT                   /protein_id="ACB89574.1"
FT                   /translation="MILQYVYWSVYMQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETT
FT                   TNTIQQSQKEVQYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSSADAS
FT                   TRVIEAKDGAITISSPEKLRAAVHRMVPIEAKKKYKLRFKIKTDNKVGIAKVRIIEESG
FT                   KDKRLWNSATTSGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVAAQ
FT                   LSEDSQTDKQLEEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIV
FT                   SKDGKEVKKIPLKILASVKDTYTDRLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVAD
FT                   SLSSISSQADRTYLWEKFSNYKTSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVR
FT                   DSMEWMHKHVYNSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFV
FT                   PDPEHFRKTTDNPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGE
FT                   GFYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKSPIDKDKMQTMYHWIDKSFA
FT                   PLLVNGELMDMSRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQ
FT                   SDSYYDVFKNLKTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAMYNAEKGFGFG
FT                   LSLFSSRTLNYEHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETD
FT                   AKRADSDTGKVLPSAFVGTSKLDDANATATMDFTNWNQTLTAHKSWFMLKDKIAFLGSN
FT                   IQNTSTDTAATTIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESSDSKKNI
FT                   GYFFFKKSSISMSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYMLIPNV
FT                   DRATFNQMIKELESSLIENNETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVLKRGVYT
FT                   IRKEGDEYKIAYYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKNHSDQKNL
FT                   PQTGEGQSILASLGFLLLGAFYLFRRGKNN"
FT   gene            complement(314536..315165)
FT                   /gene="kdgA"
FT                   /locus_tag="SPCG_0323"
FT   CDS_pept        complement(314536..315165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgA"
FT                   /locus_tag="SPCG_0323"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89575"
FT                   /db_xref="GOA:B2ISN8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN8"
FT                   /protein_id="ACB89575.1"
FT                   /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEIA
FT                   YTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETAKM
FT                   CNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSILSPAYISAVKAPIPQVSVMVTGG
FT                   VGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR"
FT   gene            complement(315175..316176)
FT                   /locus_tag="SPCG_0324"
FT   CDS_pept        complement(315175..316176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0324"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89576"
FT                   /db_xref="GOA:B2ISN9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISN9"
FT                   /protein_id="ACB89576.1"
FT                   /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQA
FT                   LGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEVFY
FT                   DRKHTSISQIRPNMLDMDSLFQGISHFHFSGITIAIGQEVRAILLLLLEEAKRRGIVVS
FT                   MDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEVENRM
FT                   RLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEERFEESVQLKTAVYQRIGSGDAFISG
FT                   ALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSATSIENLLANAQDIIR"
FT   gene            complement(316207..316848)
FT                   /locus_tag="SPCG_0325"
FT   CDS_pept        complement(316207..316848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89577"
FT                   /db_xref="GOA:B2ISP0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP0"
FT                   /protein_id="ACB89577.1"
FT                   /translation="MKIALINENSQASKNHIIYDSLKEATDKKDYQLFNYGMRGEEGES
FT                   QLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLYSQ
FT                   INGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNEVKQ
FT                   ITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
FT   gene            complement(316867..317682)
FT                   /gene="gno"
FT                   /locus_tag="SPCG_0326"
FT   CDS_pept        complement(316867..317682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gno"
FT                   /locus_tag="SPCG_0326"
FT                   /product="gluconate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89578"
FT                   /db_xref="GOA:B2ISP1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP1"
FT                   /protein_id="ACB89578.1"
FT                   /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFN
FT                   DINQDLVNKGIEAYREVGIQAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIR
FT                   RVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSA
FT                   YAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFII
FT                   AKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
FT   gene            317954..318388
FT                   /locus_tag="SPCG_0327"
FT   CDS_pept        317954..318388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0327"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89579"
FT                   /db_xref="GOA:B2ISP2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP2"
FT                   /protein_id="ACB89579.1"
FT                   /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELKQ
FT                   KILLAISNEEEVLILSDLLGGSPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFARMA
FT                   HSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEEEDFESGI"
FT   gene            318400..319590
FT                   /locus_tag="SPCG_0328"
FT   CDS_pept        318400..319590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0328"
FT                   /product="glucuronyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89580"
FT                   /db_xref="GOA:B2ISP3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP3"
FT                   /protein_id="ACB89580.1"
FT                   /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDYF
FT                   KEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDRVN
FT                   KRVELDHHDLGFLYTPSCMAEYKINGDGEAREATLKAADKLIERYQEKGGFIQAWGDLG
FT                   KKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHTFYFD
FT                   PETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNYFLNRL
FT                   PKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAMHAMLRS
FT                   LIEHYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDWNLYW"
FT   gene            319601..320092
FT                   /locus_tag="SPCG_0329"
FT   CDS_pept        319601..320092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0329"
FT                   /product="PTS system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89581"
FT                   /db_xref="GOA:B2ISP4"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP4"
FT                   /protein_id="ACB89581.1"
FT                   /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKMQ
FT                   QTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKEIN
FT                   IGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIMDYI
FT                   "
FT   gene            320107..320886
FT                   /locus_tag="SPCG_0330"
FT   CDS_pept        320107..320886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0330"
FT                   /product="PTS system, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89582"
FT                   /db_xref="GOA:B2ISP5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP5"
FT                   /protein_id="ACB89582.1"
FT                   /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGDL
FT                   PTALAMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSGGKVSPEAALALSTPI
FT                   AVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLGALS
FT                   MDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAAYLNI
FT                   PTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
FT   gene            320873..321691
FT                   /locus_tag="SPCG_0331"
FT   CDS_pept        320873..321691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0331"
FT                   /product="PTS system, IID component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89583"
FT                   /db_xref="GOA:B2ISP6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP6"
FT                   /protein_id="ACB89583.1"
FT                   /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPALK
FT                   KHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMGPL
FT                   AGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYKLGT
FT                   TVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIVSIQG
FT                   MLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
FT   gene            321691..321984
FT                   /locus_tag="SPCG_0332"
FT   CDS_pept        321691..321984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0332"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89584"
FT                   /db_xref="GOA:B2ISP7"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP7"
FT                   /protein_id="ACB89584.1"
FT                   /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLAS
FT                   LTSGDEVLLLSGIHGKIISIQDDLVSLQIAKGVVIYVEKESVMGKTKELLFK"
FT   gene            322006..323907
FT                   /locus_tag="SPCG_0333"
FT   CDS_pept        322006..323907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89585"
FT                   /db_xref="GOA:B2ISP8"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP8"
FT                   /protein_id="ACB89585.1"
FT                   /translation="MKEERRQFFERVDGNQCRDYILSHCSKDYEKVKSSLERLIDNRFM
FT                   FDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWSYMLNRQEYLLQFMIGYLVEGDKGYIQK
FT                   CKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKILVSL
FT                   EKQIDFMKSHYRAKYTLSNWGILQTIPMLAIYYFFSDKMDLEEAYHFASEELKQQIETQ
FT                   ILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYRELLEKMATYIQMMTGLDGRTLA
FT                   FGDSDSTETTEILSLSAVVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFERRAWQP
FT                   KSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDAGRYSYRE
FT                   IYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHYIEGAYWSA
FT                   EPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALTQFILDKDVTYQDGKINQLRLWSE
FT                   VDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRHSVYQTDDREV
FT                   ENALAFEVKNDETDKLILLLSEDIGVGEKLCLVDGTKMRGKCLVYDKINERMIRLQC"
FT   gene            323901..324968
FT                   /gene="regR"
FT                   /locus_tag="SPCG_0334"
FT   CDS_pept        323901..324968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SPCG_0334"
FT                   /product="sugar binding transcriptional regulator RegR"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89586"
FT                   /db_xref="GOA:B2ISP9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISP9"
FT                   /protein_id="ACB89586.1"
FT                   /translation="MLEIGILNSEYVIISISRRCFRLEKKLTIKDIAEMAQTSKTTVSF
FT                   YLNGKYEKMSQETREKIEKVIHETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIV
FT                   KGIEDIASQNGYQVMIGNSNYSQESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEK
FT                   KKKMVFFDSQLYEHRTSWVKTNNYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERA
FT                   SGFVDALTDANMRHASLTIEDKHTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTV
FT                   IKELNYNLPQVGLIGFDNTEWTCFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEER
FT                   QQVLDCSVNWKESTF"
FT   gene            complement(325424..325666)
FT                   /locus_tag="SPCG_0335"
FT   CDS_pept        complement(325424..325666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89587"
FT                   /db_xref="GOA:B2ISQ0"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ0"
FT                   /protein_id="ACB89587.1"
FT                   /translation="MKKEKKQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSLL
FT                   NTKHIFKTILGAFFFGVMIHIVDSLRIARAKKDQD"
FT   gene            complement(325682..325876)
FT                   /gene="yorfE"
FT                   /locus_tag="SPCG_0336"
FT   CDS_pept        complement(325682..325876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yorfE"
FT                   /locus_tag="SPCG_0336"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89588"
FT                   /db_xref="GOA:B2ISQ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ1"
FT                   /protein_id="ACB89588.1"
FT                   /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELCL
FT                   NLARSLQTDLNSLFWKEDF"
FT   gene            326042..326992
FT                   /gene="mraW"
FT                   /locus_tag="SPCG_0337"
FT   CDS_pept        326042..326992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SPCG_0337"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89589"
FT                   /db_xref="GOA:B2ISQ2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISQ2"
FT                   /protein_id="ACB89589.1"
FT                   /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSKL
FT                   SEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLRETGVQEIDGICY
FT                   DLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNNYDYHDLVRIFFKYGEDK
FT                   FSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPDDLKPK
FT                   MELVSRKPILPSAEELEANNRSHSAKLRVVRKIHK"
FT   gene            327004..327321
FT                   /gene="ftsL"
FT                   /locus_tag="SPCG_0338"
FT   CDS_pept        327004..327321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SPCG_0338"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89590"
FT                   /db_xref="GOA:B2ISQ3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ3"
FT                   /protein_id="ACB89590.1"
FT                   /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFMQ
FT                   TKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIRIA
FT                   E"
FT   gene            327325..329577
FT                   /gene="pbp2X"
FT                   /locus_tag="SPCG_0339"
FT   CDS_pept        327325..329577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp2X"
FT                   /locus_tag="SPCG_0339"
FT                   /product="penicillin-binding protein 2X"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89591"
FT                   /db_xref="GOA:B2ISQ4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ4"
FT                   /protein_id="ACB89591.1"
FT                   /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNFA
FT                   VIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENY
FT                   KSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGSKGNGITYANM
FT                   MSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESS
FT                   LNSILAGTDGIITYEKDRVGNIVPGTELVSQQTVDGKDVYTTLSSPLQSFMETQMDAFL
FT                   EKVKGKYMTATLVSAKTGEILATTQRPTFNADTKEGITEDFVWRDILYQSNYEPGSAMK
FT                   VMTLASSIDNNTFPSGEYFNSSEFKIADATTRDWDVNDGLTTGGMMTFLQGFAHSSNVG
FT                   MSLLEQKMGDATWLDYLKRFKFGVPTRFGLTDEYAGQLPADNIVSIAQSSFGQGISVTQ
FT                   TQMLRAFTAIANDGVMLEPKFISAIYDTNNQSVRKSQKEIVGNPVSKEAASTTRNHMIL
FT                   VGTDPLYGTMYNHYTGKPIITVPGQNVAVKSGTAQIADEKNGGYLVGSTNYIFSVVTMN
FT                   PAENPDFILYVTVQQPEHYSGIQLGEFATPILERASAMKESLNLQSPAKNLDKVTTESS
FT                   YAMPSIKDISPGELAEALRRNIVQPIVVGTGTKIKETSVEEGTNLAPNQQVLLLSDKVE
FT                   EIPDMYGWKKETAETFAKWLDIELEFEGSGSVVQKQDVRTNTAIKNIKKIKLTLGD"
FT   gene            329579..330559
FT                   /gene="mraY"
FT                   /locus_tag="SPCG_0340"
FT   CDS_pept        329579..330559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SPCG_0340"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89592"
FT                   /db_xref="GOA:B2ISQ5"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISQ5"
FT                   /protein_id="ACB89592.1"
FT                   /translation="MFISISAGVVTFLITLVGIPAFIQFYRKAQITGQQMHEDVKQHQA
FT                   KAGTPTMGGLVFLIAAVVVSFLLALFSKQLTNNVGMILFILVLYGLVGFLDDFLKVFRK
FT                   INEGLNPKQKLALQLLGGVIFYLFYERGGDMLSVFSYQVHLGIFYIIFALFWLVGFSNA
FT                   VNLTDGIDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFVFNHKPAKVF
FT                   MGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKRIFRMT
FT                   PVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
FT   gene            330699..330887
FT                   /locus_tag="SPCG_0341"
FT   CDS_pept        330699..330887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89593"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ6"
FT                   /protein_id="ACB89593.1"
FT                   /translation="MLEIDLTVLIDLSCSYFILIYSFEMVDRTDEVSSKHGFEVVDKEK
FT                   LMWFEEVFEECKKILVS"
FT   gene            331168..333273
FT                   /gene="clpL"
FT                   /locus_tag="SPCG_0342"
FT   CDS_pept        331168..333273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="SPCG_0342"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89594"
FT                   /db_xref="GOA:B2ISQ7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISQ7"
FT                   /protein_id="ACB89594.1"
FT                   /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEFA
FT                   HYRATGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEIQE
FT                   TSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGLEAG
FT                   TQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKPALSR
FT                   GELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQHHNVI
FT                   LPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREIETEKDK
FT                   QEKAVEAEDFEAALNYKTRIAELERKIENHTEDMKVTASVNDVAESVERMTGIPVSQMG
FT                   ASDIERLKDMAHRLQNKVIGQDKAVEAVARAIRRNRAGFDEGNRPIGSFLFVGSTGVGK
FT                   TELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTERVRRN
FT                   PYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATSNAGFGYEANL
FT                   TEDADKPELMDRLKPFFRPEFLNRFNAVIEFSQLTKEDLSKIVDLMLAEVNQTLAKKDI
FT                   DLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLDAKHLEADMKDGV
FT                   LVIREKA"
FT   gene            complement(334126..334608)
FT                   /gene="luxS"
FT                   /locus_tag="SPCG_0343"
FT   CDS_pept        complement(334126..334608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SPCG_0343"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89595"
FT                   /db_xref="GOA:B2ISQ8"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISQ8"
FT                   /protein_id="ACB89595.1"
FT                   /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQ
FT                   PNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIK
FT                   DSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWARLILEQGISDDAFERHVI"
FT   gene            complement(334703..336187)
FT                   /locus_tag="SPCG_0344"
FT   CDS_pept        complement(334703..336187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89596"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ISQ9"
FT                   /protein_id="ACB89596.1"
FT                   /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHAA
FT                   RVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKFNE
FT                   LGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMGKND
FT                   YIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHHPVNL
FT                   AYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYASPTDM
FT                   GVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVSEAAVKKIELLMNDLGITPA
FT                   DRKVAVVARQKAEETGGPALAFELPNGEIVTGKNSELFGPTAAALINAIKKSADIAKEV
FT                   KLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEELGNLKGSE
FT                   AHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
FT   gene            336340..337947
FT                   /gene="dexB"
FT                   /locus_tag="SPCG_0345"
FT   CDS_pept        336340..337947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="SPCG_0345"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89597"
FT                   /db_xref="GOA:B2ISR0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISR0"
FT                   /protein_id="ACB89597.1"
FT                   /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGVGDLPGITSKLDYLAKLGI
FT                   TAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVNHT
FT                   SDEHAWFVEACENTDSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSKKQP
FT                   DLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYLKEMN
FT                   QATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKWHYQKE
FT                   LNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKAFAILLH
FT                   LMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAHEALEKGVPIEEIMDSIRVIGRD
FT                   NARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKLVQIRKENS
FT                   WLIRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSVLIENTLAQE
FT                   VFEKQILVPWDAFCVELL"
FT   gene            339007..340461
FT                   /gene="wzg"
FT                   /locus_tag="SPCG_0346"
FT   CDS_pept        339007..340461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzg"
FT                   /locus_tag="SPCG_0346"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps14A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89598"
FT                   /db_xref="GOA:B2ISR1"
FT                   /db_xref="InterPro:IPR004190"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISR1"
FT                   /protein_id="ACB89598.1"
FT                   /translation="MLIMSRRFKKSRSQKVKRSVNIVLLTIYLLLICFLLFLIFKYNIL
FT                   AFRYLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLLFSILVSSVSLFAVQQFVGLTN
FT                   RLNATSNYSEYSISVAVLADSDIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLT
FT                   VDQSSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAPK
FT                   TSKNQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADGGN
FT                   NQKDKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKMIDLLGGVDVHNDQEFL
FT                   ALHGKFHFPVGNVHLDSEQALGFVRERYSLADGDRDRGRNQQKVIVAILQKLTSTEALK
FT                   NYSMIIDSLQDSIQTNMPLETMINLVNAQLESGGNYKVNSQDLKGTGRTDLPSYAMPDS
FT                   NLYVMEIDDSSLAVVKAAIQDVMEGR"
FT   gene            340463..341194
FT                   /gene="wzh"
FT                   /locus_tag="SPCG_0347"
FT   CDS_pept        340463..341194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzh"
FT                   /locus_tag="SPCG_0347"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps14B"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89599"
FT                   /db_xref="GOA:B2ISR2"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2ISR2"
FT                   /protein_id="ACB89599.1"
FT                   /translation="MIDIHSHIVFDVDDGPKSREESKALLIESYRQGVRTIVSTSHRRK
FT                   GMFETPEEKIAENFLQVREIAKEVADDLVIAYGAEIYYTLDALEKLEKKEIPTLNDSRY
FT                   ALIEFSMHTSYRQIHTGLSNILMLGITPVIAHIERYDALENNEKRVRELIDMGCYTQIN
FT                   SYHVSKPKFFGEKYKFMKKRARYFLERDLVHVVASDMHNLDSRPPYMQQAYDIIAKKYG
FT                   AKKAKELFVDNPRKIIMDQLI"
FT   gene            341203..341895
FT                   /gene="wzd"
FT                   /locus_tag="SPCG_0348"
FT   CDS_pept        341203..341895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzd"
FT                   /locus_tag="SPCG_0348"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps14C"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89600"
FT                   /db_xref="GOA:B2ILP4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005701"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP4"
FT                   /protein_id="ACB89600.1"
FT                   /translation="MKEQNTLEIDVLQLSRALWKRKLVILLVAIITSSVAFAYSTFVIK
FT                   PEFTSTTRIYVVNRDQGEKSGLTNQDLQAGSYLVKDYREIILSQDVLEEVVSDLKLDLT
FT                   PKGLANKIKVTVPVDTRIVSVSVNDRVPEEASRIANSLREVAAQKIISITRVSDVTTLE
FT                   EARPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVKRPEDIENTLQMTLLGV
FT                   VPNLSKLK"
FT   gene            341905..342588
FT                   /gene="wze"
FT                   /locus_tag="SPCG_0349"
FT   CDS_pept        341905..342588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wze"
FT                   /locus_tag="SPCG_0349"
FT                   /product="capsular polysaccharide biosynthesis protein
FT                   Cps14D"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89601"
FT                   /db_xref="GOA:B2ILP5"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP5"
FT                   /protein_id="ACB89601.1"
FT                   /translation="MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNP
FT                   GEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTADLSY
FT                   GLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAV
FT                   IITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYG
FT                   NYGKK"
FT   gene            342604..343971
FT                   /gene="wchA"
FT                   /locus_tag="SPCG_0350"
FT   CDS_pept        342604..343971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchA"
FT                   /locus_tag="SPCG_0350"
FT                   /product="glucosyl-1-phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89602"
FT                   /db_xref="GOA:B2ILP6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP6"
FT                   /protein_id="ACB89602.1"
FT                   /translation="MDKKGLEIFLAVLQSIIVILLVYFLSFVRETELERSSMVILYLLH
FT                   FFVFYFSSYGNKFFKRGYLVEFNSTIRYIFFFAIAISVLNFFIAERFSISRRGMVYFLT
FT                   LEGISLYLLNFLVKKYWKHVFFNPKNSKKILLLTVTENIEKVLDKLLESDELSWKLVAV
FT                   SVLDKSDFQHDKIPVIEKEKIIEFATHEVVDEVFVDLPGESYDIGEIISKFETMGIDVT
FT                   VNLNAFNKNLGRNKQIHEIVGLNVVTFSTNFYKTSHVISKRILDICGATIGLILFAIAS
FT                   LVLVPLIRKDGGPAIFAQTRIGKNGRHFTFYKFRSMRIDAEAIKEQLMDQNTMRGGMFK
FT                   MDNDPRVTKIGRFIRKTSLDELPQFWNVFIGDMSLVGTRPPTVDEYDQYTPEQKRRLSF
FT                   KPGITGLWQVSGRSKITDFDDVVKLDVAYIDNWTIWKDIEILLKTVKVVFMRNGAK"
FT   gene            343975..344424
FT                   /gene="wchJ"
FT                   /locus_tag="SPCG_0351"
FT   CDS_pept        343975..344424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchJ"
FT                   /locus_tag="SPCG_0351"
FT                   /product="putative glycosyltransferase activity enhancer"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89603"
FT                   /db_xref="GOA:B2ILP7"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP7"
FT                   /protein_id="ACB89603.1"
FT                   /translation="MKVCLVGSSGGHLTHLYLLKPFWKDRERFWVTFDKEDARSILENE
FT                   IFYPCYYPTNRNLKNLIKNTILAFKILRKERPDIIVSSGAAVAVPFFYLGKIFGAKTVY
FT                   IEVFDRIDAPTMTGKLVYPVTDRFIVQWEEMKKVYPKAINLGGIF"
FT   gene            344424..344927
FT                   /gene="wchK"
FT                   /locus_tag="SPCG_0352"
FT   CDS_pept        344424..344927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchK"
FT                   /locus_tag="SPCG_0352"
FT                   /product="ss-1,4-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89604"
FT                   /db_xref="GOA:B2ILP8"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP8"
FT                   /protein_id="ACB89604.1"
FT                   /translation="MIFVTVGTHEQQFNRLIKEVDRLKGEGFIQDDVFIQTGYSNYVPK
FT                   FCKWEKVISYEKMNQLIKESDIIITHGGPATFMAVIAKGKNPIIVPRLKKFGEHVNDHQ
FT                   MQFVKITKEIYNLIVIDDISDLHLILHNFKDKHFETYLNNERFNVRFNVEISNLFKGNK
FT                   INEN"
FT   gene            344917..346089
FT                   /gene="wzy"
FT                   /locus_tag="SPCG_0353"
FT   CDS_pept        344917..346089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzy"
FT                   /locus_tag="SPCG_0353"
FT                   /product="putative polysaccharide polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89605"
FT                   /db_xref="GOA:B2ILP9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILP9"
FT                   /protein_id="ACB89605.1"
FT                   /translation="MKIRIEPQYFLYKYLWFIILLPKQFMQLILFFLIALTLLPTYIKE
FT                   KQVFKIDTPSFCMVLWTIIYSISIIFNSLIDGLAVQVIFSDLSKAFNWLIAVFFYNYYL
FT                   KMPINIDRIKRYMYYNFTILVVFVGLFYIQRGSNVILFGRSLLDWDGFTLATSYGVRYT
FT                   GFLEYATLNGQLILFLLPLIRLFRFRFFTQTIIFAFLLEVLVLSKSRIAIVAMLIYIAF
FT                   AVVNEINSNNKWLIGIFCPIIPFMLFYNFEKIKQIFFQMFSSRSGSNATRFRVYEESLK
FT                   AINGMEMLLGAGVRIPSTVDILLGSHSMYISFIYRTGVLGSIIITVMFYYLFSKFLKCD
FT                   SSERLRSIGYILALSVFWLFEELDPHYWCLILFFSTISIFINNRKEEIVG"
FT   gene            346086..347105
FT                   /gene="wchL"
FT                   /locus_tag="SPCG_0354"
FT   CDS_pept        346086..347105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchL"
FT                   /locus_tag="SPCG_0354"
FT                   /product="ss-1,3-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89606"
FT                   /db_xref="GOA:B2ILQ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ0"
FT                   /protein_id="ACB89606.1"
FT                   /translation="MIEVSIIIPIYNAEKTIKNCVDSALKQNLESLEVILVNDGSNDST
FT                   SKILEQYGDNPQVMIFHQVNMGVSAARNVGLSYASGEYVFFLDSDDILDEGMLSKMYQF
FT                   AKSNKIDLLSCWHKEPSTTQYGGNDNSSASFIARTKEEIGNHFVDIFPRSACAKLFLRR
FT                   RIEENNIAFSTEMSLGEDMSFVCQYLMVSRSIAVIDGLYYTIQNVNPQSLSKRYVSNIE
FT                   NSLLMQNQLWDQLLEVYPKIEENYYKQHMDFRFYLASLYVNNLFKFDSPYSSKEKWDNI
FT                   AQQLKKYRPFLDEKVSKEKKPKNMNEMVIFYLLKSKIPALIYSFYSFKEWWKKKRLKN"
FT   gene            347075..348076
FT                   /gene="wchM"
FT                   /locus_tag="SPCG_0355"
FT   CDS_pept        347075..348076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchM"
FT                   /locus_tag="SPCG_0355"
FT                   /product="ss-1,4-galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89607"
FT                   /db_xref="GOA:B2ILQ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ1"
FT                   /protein_id="ACB89607.1"
FT                   /translation="MVEEKAIKKLKEKSVMEDLVSIVVPVYNVEKYLKKSIESILNQTY
FT                   DNLEVLLVDDGSTDSSGEICDSFIKVDSRIRVFHKENGGLSDARNFGIEHMKGQYVSFI
FT                   DGDDYISKDYVWKLYHSLKNNNSEVSICSFSLVDETGEKIKDELLDSGEVSLSGQQILE
FT                   KALTADGYRYVVAWNKLYRSTLFEKLKFKKGMLYEDEFLNYPLFWDCKRVSIVEEPLYL
FT                   YVQRKGSIIQSNMTLEKIKMKDKMHTSRIEFYAEKKNSFLHQRSCQQYCNWIVTITVSH
FT                   YNVLNVAFLKYLQHQFRRIVKYTQNDDKKLIIQNILGYINIRLAAYVKSKVM"
FT   gene            348144..349013
FT                   /gene="wchN"
FT                   /locus_tag="SPCG_0356"
FT   CDS_pept        348144..349013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wchN"
FT                   /locus_tag="SPCG_0356"
FT                   /product="capsular polysaccharide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89608"
FT                   /db_xref="GOA:B2ILQ2"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ2"
FT                   /protein_id="ACB89608.1"
FT                   /translation="MKSKIHRMFPIYIISNQNIAFQQEIDIAYRKMKRQFSHISLTESE
FT                   QKNDMNISNKVWICWFQGEERPPELIRTCIQSMRTHFLGREIIVLTEENISDYIDIPDY
FT                   ITDKYKKGSISRAHYSDILRVELLCRYGGLWVDVTVLNTGGDFSNLELPLFVYKSLDLS
FT                   RKDSQAIVASSWLISSYSNHPILLYARKLLWEYWRRKNSLCNYFLFHIFFTIATELYPI
FT                   EWSAVLTFNNHSPHMFNFELNNQFSEKRWEQLKQISVFHKLNHHIDYSIGVNNFYKFIV
FT                   FSKVEKNE"
FT   gene            348997..350469
FT                   /gene="wzx"
FT                   /locus_tag="SPCG_0357"
FT   CDS_pept        348997..350469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzx"
FT                   /locus_tag="SPCG_0357"
FT                   /product="putative repeating unit transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89609"
FT                   /db_xref="GOA:B2ILQ3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ3"
FT                   /protein_id="ACB89609.1"
FT                   /translation="MRKMSNKISKNLAYNIGYQLIGIAFPLITSPYLSRILGAENLGIH
FT                   SFTISVALYFMMFMLLGIANYGNRTIATVKREGKEILSKTFWNIYYVQLLMSVLVTIAY
FT                   LIYLYFWVSSYKFIAILQLFLLLSNAVDITWLFYGLEDFKQIVFRNTLVKLLGLFLIFS
FT                   FVHESSDLWKYTLINGGVTLVGQLLLWGQLKGRLSWVKIQKKDLLSHIKPILVLFIPVL
FT                   AISIFSNMDKYMLGLMVGVKQVGFYDNANRIIDIPKALIAALEAVMLPRTSYLLAEGQE
FT                   EKSNYYIEVTILYAMMISSVLIFGIISVSDIFSLVFWGEEFLESGRLIAAMAPVFVFSV
FT                   PGNIIRTQYLIPRAKDKDYVLSLIIGALVNILLNCFLIKPFGAMGATISTVLAEFVLYG
FT                   VQFWTVRRDLDFKKYLKNGFIFYLFGMIMYLAIIAVKAHLQYNIINLVLLIVLGGIVYT
FT                   GFCCFYILISRNVHFEILREKIKRKIGYENIL"
FT   gene            350621..350713
FT                   /locus_tag="SPCG_0358"
FT   CDS_pept        350621..350713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89610"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ4"
FT                   /protein_id="ACB89610.1"
FT                   /translation="MFQKELEKYGMEVGELFLNGAPQRYGLTTL"
FT   gene            350730..351047
FT                   /locus_tag="SPCG_0359"
FT   CDS_pept        350730..351047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89611"
FT                   /db_xref="GOA:B2ILQ5"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ5"
FT                   /protein_id="ACB89611.1"
FT                   /translation="MIRFHPNVDNTFFNNTDKRLINVTDYPNPQDLMFVADIMISDYSS
FT                   APIDFLLLNRVVFLYLPDFKEYQSDKNPFFEVFKVSKTKGIALDPFDEIIGRFQFGVRI
FT                   V"
FT   gene            351407..353770
FT                   /gene="lrp"
FT                   /locus_tag="SPCG_0360"
FT   CDS_pept        351407..353770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="SPCG_0360"
FT                   /product="putative surface anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89612"
FT                   /db_xref="GOA:B2ILQ6"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ6"
FT                   /protein_id="ACB89612.1"
FT                   /translation="MTVITSDTHVNSDDFAFCLANGKKFPSFTDKKPKGSYTLVRDIDK
FT                   DQYTKLLKDNHRWSAIPDLNKAWDTFSRLSYMYLKDPTDIVKRAWGTDLKTARTYFHQV
FT                   IQYEIWRYTDGMRVSSDTNIYEYRALSPQQKAALEMIRADLYKFTVPYENLEYRFYKPD
FT                   WVFGLGYQALATVRWKIEPATITVTKKWENVKEGAKKPDVWIQLLKDGKPEGERKRIES
FT                   DKGQTTFEIPNKDEINKYSVKEVDKEGRDWKHKDFTAGQPVNKGNGHFEITNTKKEKPK
FT                   IKVTFKKIAGDTNKDLAGAHLVLKKIFDDGNGLLIKQWDTIGQPVDIDLDAGSYTLTEE
FT                   KAPDGYMLAAPVSFYVEEDGQIILPKGEDLEAQNDKTITMVDEKIKEKPTKPSGKLATT
FT                   VEVDGTKADAQKELELSVATDKVTKTVKDTVVYENLLAGETYKLTGQLMKITADKEEEV
FT                   ATKETTFVADASGNGTTSLEFEDVSLEAGVKYVVYETAESEKEIDFKEGKEKHKVEHKD
FT                   KDDKAQTVVVSKIKPEPGAQEVHFSKVNVGGEEIAGAEIHIKQGDTVVASWVSEAGKTH
FT                   TLKLKPGHYIFHEAVAPGGYLAVTDIHFSVDETGQVTVTDVNGNTAVAEGNKLTVTDQT
FT                   KPVTPPSPEEPGAQEVHFSKVNVGGEEIAGAEIHIKQGDTVVASWVSEAGKTHTLKLKP
FT                   GHYIFHEAVAPGGYLAVTDIHFSVDETGQVTVTDVNGNTAVAEGNKLTVTDQSADKDKQ
FT                   DKLPNTGETTGTYLSILGMITAVFASLLYRSKKK"
FT   gene            complement(353925..354452)
FT                   /locus_tag="SPCG_0361"
FT   CDS_pept        complement(353925..354452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0361"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89613"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ7"
FT                   /protein_id="ACB89613.1"
FT                   /translation="MSRMRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSDKRFYRPT
FT                   FRMHLTNKEILDKLLSYSQDLKHHYQLYQLLLFHFQNKEPEKFFGLIEDNLKQVHPLFQ
FT                   TVFKTFLKDKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRNFENFKKRIFIALNI
FT                   KKERTKFVLSQA"
FT   gene            complement(354733..355251)
FT                   /locus_tag="SPCG_0362"
FT   CDS_pept        complement(354733..355251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0362"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89614"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ8"
FT                   /protein_id="ACB89614.1"
FT                   /translation="MEQLHFITKLLDIKDTNTQIIDVVNRDSHKEIIAKLDYDAPSCPE
FT                   CGSQMKKYDFQKPSKIPYLETTGMPTRILLRKRRFKCYHCSKMMVAETSIVKKNHQIPR
FT                   IINQKIAQKLIEKISMTDIAHQLSISTSTVIRKLNDFHFECNFRNLPEIMSWDVETVRG
FT                   VTVSIGRWR"
FT   gene            355487..357472
FT                   /gene="aliA"
FT                   /locus_tag="SPCG_0363"
FT   CDS_pept        355487..357472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aliA"
FT                   /locus_tag="SPCG_0363"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein AliA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89615"
FT                   /db_xref="GOA:B2ILQ9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILQ9"
FT                   /protein_id="ACB89615.1"
FT                   /translation="MMKSSKLFALAGVTLLAATTLAACSGSGSSAKGEKTFSYIYETDP
FT                   DNLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYIIRKDAK
FT                   WYTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVGIK
FT                   VLDEQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGPYLL
FT                   KSIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARLYPTS
FT                   ASFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALLNKDFR
FT                   QAIAFGFDRTAYASQLNGQTGASKILRNIFVPPTFVQADGKNFGDMVKEKLVTYGDEWK
FT                   DVNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQRVQSMKQ
FT                   SLEATLGADNVVIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFADPSTYLDI
FT                   IKPSVGESTKTYLGFDSGEDNVAAKKLGLYDYEKLVTEAGDETTDVAKRYDKYAAAQAW
FT                   LTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPVLYKYLELQDKAVTVDEYQ
FT                   KAQEKWMKEKEESNKKAQEDLAKHVK"
FT   gene            357773..363076
FT                   /locus_tag="SPCG_0364"
FT   CDS_pept        357773..363076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0364"
FT                   /product="cell wall surface anchor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89616"
FT                   /db_xref="GOA:B2ILR0"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="InterPro:IPR035364"
FT                   /db_xref="InterPro:IPR040502"
FT                   /db_xref="InterPro:IPR040575"
FT                   /db_xref="InterPro:IPR040633"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR0"
FT                   /protein_id="ACB89616.1"
FT                   /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSGS
FT                   TANLPADLATALATAKENDGRDFEAPKVGEDQGSPEVTDGPKTEEELLALEKEKPAEEK
FT                   PKEDKPAAAKPETPKTVTPEWQTVEKKEQKGTVTIREEKGVRYNQLSSTAQNDNAGKPA
FT                   LFEKKGLTVVANGNATVDLTFKDDSEKGKSRFGVFLKFKDTNNNVFVGYDKDGWFWEYK
FT                   SPTTSTWYRGSRVAAPETGSTNRLSITLKSDGQLNASNNDVNLFDTVTLPAAVNDHLKN
FT                   EKKILLKAGSYGNDRTVVSVKTDNQEGVKADDTPAQKETGPVVDDSKVTYDTIQSKVLK
FT                   AVIDQAFPRVKEYSLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAEYLMKIRD
FT                   DAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISFLGNALVSV
FT                   SSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLAAGVWSNSQN
FT                   SYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKELPSAKVVITE
FT                   DANADKKVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQNPFLMTLDGIKK
FT                   INLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIEKAKKYGAHLGIH
FT                   VNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLAHGRLARWEDLKKK
FT                   LGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWGHGGEYDSTFHHWAA
FT                   DLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLLGGYSMKDFEGWQGRS
FT                   DYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYKWTPEMRVELVDADNNK
FT                   VVVTRKSNDVNSPQYRERTVTLNGRVIQDGSAYLTPWNWDANGKKLSTDKEKMYYFNTQ
FT                   AGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKITLDLLANQPYVLYRSKQTN
FT                   PEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAEIVKSQGANDMLRIQGNKEKVSLTQK
FT                   LTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYTNKSLALNYVKAYAHNTRRDN
FT                   ATVDDTSYFQNMYAFFTTGADVSNVTLTLSREAGDQATYFDEIRTFENNSSMYGDKHDT
FT                   GKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEKHNPYTQRGWNGKKVDDVIEGNW
FT                   SLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEYEAGSDNTYAFVVGKGEFQSGRRG
FT                   TQASNLEMHELPNTWTDSKKAKKATFLVTGAETGDTWVGIYSTGNASNTRGDSGGNANF
FT                   RGYNDFMMDNLQIEEITLTGKMLTENALKNYLPTVAMTNYTKESMDALKEAVFNLSQAD
FT                   DDISVEEARAEIAKIEALKNALVQKKTALVADDFESLDAPAQPDEGLENAFDGNVSSLW
FT                   HTSWNGGDVGKPATMVLKEATEITGLRYIPRGSGSNGNLRDVKLVVTDESGKEHTFAAT
FT                   DWPDNNKPKDIDFGKTIKAKKIVLTGTKTYGDGGDKYQSAAELIFTRPQVAETPLDLSG
FT                   YEAALAKAQKLTDKDNQEEVASVQASMKYATDNHLLTERMVEYFADYLNQLKDSATKSD
FT                   APTVEKPEFKLSSLASEQGKTPDYKQEIDRPETPEQILPATGESQSDTALFLAGVSLAL
FT                   SALFVVKTKKD"
FT   gene            complement(363243..365402)
FT                   /gene="pbp1A"
FT                   /locus_tag="SPCG_0365"
FT   CDS_pept        complement(363243..365402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SPCG_0365"
FT                   /product="penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89617"
FT                   /db_xref="GOA:B2ILR1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR1"
FT                   /protein_id="ACB89617.1"
FT                   /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSES
FT                   KLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDSI
FT                   RILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATK
FT                   QEILTYYINKVYMSNGNYGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHP
FT                   EAAQDRRNLVLSEMKNQGYISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVIN
FT                   QVEQETGYNLLTTGMDVYTNVDQEAQKHLWDIYNSDQYVSYPDDDLQVASTVVDVSNGK
FT                   VIAQLGARHQASNVSFGTNQAVETNRDWGSAMKPITDYAPAIEYGVYDSTATMVNDIPY
FT                   NYPGTSTPVYNWDRAYFGNITLQYALQQSRNVTAVETLNKVGLDRAKTFLNGLGIDYPS
FT                   MHYANAISSNTTESNKQYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSDGSKKEFSN
FT                   VGTRAMKETTAYMMTDMMKTVLTYGTGRGAYLPWLPQAGKTGTSNYTDEEVENHIKNTG
FT                   YVAPDEMFVGYTRKYSMAVWTGYSNRLTPIVGDGFLVAAKVYRSMITYLSEDTHPEDWT
FT                   MPDGLFRNGEFVFKNGARPIWTEPSTQQSSTAESSSSSSDSSTSQSSSTTPSTNNSTTT
FT                   NPNNNTQQSNTTPDQQNQNPQPAQP"
FT   gene            complement(365399..365995)
FT                   /locus_tag="SPCG_0366"
FT   CDS_pept        complement(365399..365995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89619"
FT                   /db_xref="GOA:B2ILR2"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILR2"
FT                   /protein_id="ACB89619.1"
FT                   /translation="MVNYPHKLSSQKRQPSLSQPKNFANRGMSFEKMINATNDYYLSQG
FT                   LAVIHKKPTPIQIVRVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEAKETKQKR
FT                   AIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQKSMP
FT                   LGYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
FT   gene            365978..366589
FT                   /locus_tag="SPCG_0367"
FT   CDS_pept        365978..366589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89618"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILR3"
FT                   /protein_id="ACB89618.1"
FT                   /translation="MWIVDHNSPYWYNNITLLYHKFAQKGLKMATALVLGYSAFDLGLF
FT                   SDKDPRLKLIKKAIRKDLEAMAADGVSWLVFTGSLGFEYWVLEVAQEMKTEYGFQLATI
FT                   FAFETHGENWNEGNQMKLSRFKQVDFVKYAYPRYEHKGQLRDYQQFLLENTTSSYLFYD
FT                   EENETKLAYFYQKMKNQEDYFIKRLTFDQLNELAENFSEN"
FT   gene            366647..367000
FT                   /locus_tag="SPCG_0368"
FT   CDS_pept        366647..367000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89620"
FT                   /db_xref="GOA:B2ILR4"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR4"
FT                   /protein_id="ACB89620.1"
FT                   /translation="MERDMTSIIFSAKDIFEQEFGREVRGYSKVEVDEFLDDVIKDYET
FT                   YATLVKSLRQEIADLKEELTRKPQVSSAPSPSHPDPIDVAASSSMTNFDILKRLNRLEK
FT                   EVFGKQILDNTDL"
FT   gene            367471..368643
FT                   /locus_tag="SPCG_0369"
FT   CDS_pept        367471..368643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89621"
FT                   /db_xref="GOA:B2ILR5"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR5"
FT                   /protein_id="ACB89621.1"
FT                   /translation="MQDCNMKKEFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQ
FT                   GDVRTIIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAK
FT                   CVKSKLHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMID
FT                   TTGSSLFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIESVMIAR
FT                   KMAPGLRRSFAFEEWNWISDRLIQEVRTEAAKKVERELELDIMGCDIDARMVEIAKANA
FT                   QAAGVAGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPLK
FT                   TWSKFILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
FT   gene            368656..370050
FT                   /locus_tag="SPCG_0370"
FT   CDS_pept        368656..370050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89622"
FT                   /db_xref="GOA:B2ILR6"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="InterPro:IPR040532"
FT                   /db_xref="InterPro:IPR041295"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR6"
FT                   /protein_id="ACB89622.1"
FT                   /translation="MSKKRRNRHKKEAQEPQFDFDEAKELTVGQAIRKNEEVEAGVLPE
FT                   DSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEVPS
FT                   SEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGFILT
FT                   VLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTNSNKTAL
FT                   KNSQFDKLSQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIVDGVLD
FT                   TNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSSQASSNT
FT                   TSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNYAWDFADGVL
FT                   EQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGYFVGNGAGH
FT                   ADDLDY"
FT   gene            370105..371550
FT                   /gene="gnd"
FT                   /locus_tag="SPCG_0371"
FT   CDS_pept        370105..371550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SPCG_0371"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89623"
FT                   /db_xref="GOA:B2ILR7"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR7"
FT                   /protein_id="ACB89623.1"
FT                   /translation="MKQEECQMTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEK
FT                   TEDVIACHPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDIL
FT                   IDGGNTFYKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVSDVL
FT                   EEISAKAPEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAED
FT                   MAEIFTEWNKGELDSYLIEITADILSRKDDEDQDGPIVDYILDAAGNKGTGKWTSQSSL
FT                   DLGVPLSLITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSK
FT                   IISYAQGFAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLL
FT                   LDEYFLDVTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRDY
FT                   FGAHTYQRKDKEGTFHYSWYDEK"
FT   gene            371562..372251
FT                   /gene="csrR"
FT                   /locus_tag="SPCG_0372"
FT   CDS_pept        371562..372251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrR"
FT                   /locus_tag="SPCG_0372"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89624"
FT                   /db_xref="GOA:B2ILR8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR8"
FT                   /protein_id="ACB89624.1"
FT                   /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQT
FT                   DYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIYKP
FT                   VFIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTRREY
FT                   DLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIKTVRG
FT                   VGYTMQE"
FT   gene            372260..373348
FT                   /gene="cbpJ"
FT                   /locus_tag="SPCG_0373"
FT   CDS_pept        372260..373348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpJ"
FT                   /locus_tag="SPCG_0373"
FT                   /product="choline binding protein J"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89625"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILR9"
FT                   /protein_id="ACB89625.1"
FT                   /translation="MQLCNCFFEEFLYIDIQSSFYYNRFRRIYKMKLLKKMMPIALAVF
FT                   FFGLLGTSTVFADDSEGWQFVQENGRTYYKKGDLKETYWRVIDGKYYYFDSLSGEMVVG
FT                   WQYIPFPSKGSTIGPYPNGIRLEGFPKSEWYYFDKNGVLQEFVGWKTLEIKTKDSVGRK
FT                   YGEKREDSEDKEEKRYYTNYYFNQNHSLETGWLYDQSNWYYLAKTEINGENYLGGERRA
FT                   GWINDDSTWYYLDPTTGIMQTGWQYLGNNWYYLRSSGAMATGWYQEGTTWYYLDQPNGD
FT                   MKTGWQYLGNKWYYLRSSGAMVTGWYQDGLTWYYLNAGNGDMKTGWFQVNGKWYYAYSS
FT                   GALAVNTTVDGYYVNYNGEWVR"
FT   gene            complement(373466..374722)
FT                   /locus_tag="SPCG_0374"
FT   CDS_pept        complement(373466..374722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89626"
FT                   /db_xref="GOA:B2ILS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS0"
FT                   /protein_id="ACB89626.1"
FT                   /translation="MCRHKEKSMKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQ
FT                   YNFAPLAILLISISEMVPLLSQLFLGILGDFQENRVKHALWIAKIKILLYAILTVFLVL
FT                   SPFSLVSVIMIVIINLISDTLSYLSAYMMNALYISVIKDDLHDAMGFRQSLMRVVHIVA
FT                   NLAGAFLINVMSIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQ
FT                   HLKQSLAVLLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLAMLSI
FT                   IISCGAILGNMTSSNLFKNIRFTHLLVFCEISLLALITSILCQAYIVIFMTSFISSTII
FT                   GILSPRLQAAVFAHIPSDKMGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLY
FT                   LILIALIFCQWLVKFNTHN"
FT   gene            complement(374857..375327)
FT                   /locus_tag="SPCG_0375"
FT   CDS_pept        complement(374857..375327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89627"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS1"
FT                   /protein_id="ACB89627.1"
FT                   /translation="MTILLKLSSTIVYGEIYHYFLQRDTAKESILDYSFAHGYCEIAYA
FT                   LFAYSKVLEPSMFYNDLHTFHAELKKLLEKVTSNTENLGNLQLSWCEGISGIILYLCMY
FT                   DCDGNKDIISKYQEFVFNHHLKMMTGYCHGITSLLQTTVYNQNKLLMKKSNR"
FT   gene            376699..377577
FT                   /gene="mvk"
FT                   /locus_tag="SPCG_0376"
FT   CDS_pept        376699..377577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvk"
FT                   /locus_tag="SPCG_0376"
FT                   /product="mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89628"
FT                   /db_xref="GOA:B2ILS2"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS2"
FT                   /protein_id="ACB89628.1"
FT                   /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVPA
FT                   ESPWRLYEEDTLSMAVYASLEYLDITEACIRCEIDSAIPEKRGMGSSAAISIAAIRAVF
FT                   DYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDLSAY
FT                   LVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQILSQA
FT                   HLHLKEIGVSSPEADFLVETTLSHGALGAKMSGGGLGGCIIALVTNLTHAQELAERLEE
FT                   KGAVQTWIESL"
FT   gene            377559..378512
FT                   /gene="mvd1"
FT                   /locus_tag="SPCG_0377"
FT   CDS_pept        377559..378512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvd1"
FT                   /locus_tag="SPCG_0377"
FT                   /product="diphosphomevalonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89629"
FT                   /db_xref="GOA:B2ILS3"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029765"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="InterPro:IPR041431"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS3"
FT                   /protein_id="ACB89629.1"
FT                   /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTE
FT                   TTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGL
FT                   SSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPV
FT                   ETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDF
FT                   AKIGELTEKNALAMHATTKTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNV
FT                   KVFCQEKDLEHLSEIFGHRYRLIVSKTKDLSQDDCC"
FT   gene            378499..379506
FT                   /gene="mvaK2"
FT                   /locus_tag="SPCG_0378"
FT   CDS_pept        378499..379506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK2"
FT                   /locus_tag="SPCG_0378"
FT                   /product="phosphomevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89630"
FT                   /db_xref="GOA:B2ILS4"
FT                   /db_xref="InterPro:IPR005917"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR035102"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS4"
FT                   /protein_id="ACB89630.1"
FT                   /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYR
FT                   IYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLEICGKMEREGKKFGL
FT                   GSSGSVVVLVVKALLALYDVSVDQELLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQ
FT                   SFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQ
FT                   NINQNFLSSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEAS
FT                   QDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS"
FT   gene            379490..380500
FT                   /gene="fni"
FT                   /locus_tag="SPCG_0379"
FT   CDS_pept        379490..380500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fni"
FT                   /locus_tag="SPCG_0379"
FT                   /product="isopentenyl pyrophosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89631"
FT                   /db_xref="GOA:B2ILS5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="PDB:4N02"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILS5"
FT                   /protein_id="ACB89631.1"
FT                   /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLST
FT                   EFAGRKWDFPFYINAMTGGSNKGREINQKLAQVAESCGILFVTGSYSAALKNPTDDSFS
FT                   VKSSHPNLLLGTNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPEGERKFRSWQS
FT                   HLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGRGGTSFAYIENRRSGQR
FT                   DYLNQWGQSTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELV
FT                   ETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEAKDQMKKA"
FT   gene            380577..381275
FT                   /locus_tag="SPCG_0380"
FT   CDS_pept        380577..381275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89632"
FT                   /db_xref="GOA:B2ILS6"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS6"
FT                   /protein_id="ACB89632.1"
FT                   /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYT
FT                   GKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEV
FT                   VTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMV
FT                   GTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTT
FT                   MIGDVEVVRG"
FT   gene            381272..382267
FT                   /locus_tag="SPCG_0381"
FT   CDS_pept        381272..382267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0381"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89633"
FT                   /db_xref="GOA:B2ILS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS7"
FT                   /protein_id="ACB89633.1"
FT                   /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEKF
FT                   VFLLLVFSMSMTCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVADPDLDASFKSLS
FT                   GKLNLLTETLQKAENQSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQQAL
FT                   KLDREKMQIQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELEDKSDL
FT                   RVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKVVDNGI
FT                   GFQLGSLDDLSYGLRNIKERVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
FT   gene            382281..382913
FT                   /locus_tag="SPCG_0382"
FT   CDS_pept        382281..382913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0382"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89634"
FT                   /db_xref="GOA:B2ILS8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS8"
FT                   /protein_id="ACB89634.1"
FT                   /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALEL
FT                   RPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYMLKT
FT                   SSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGYENQ
FT                   RIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGQEEF"
FT   gene            382914..383156
FT                   /locus_tag="SPCG_0383"
FT   CDS_pept        382914..383156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89635"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILS9"
FT                   /protein_id="ACB89635.1"
FT                   /translation="MSLADLLEELEAAKDSKKARSMEAYMRHQFSFLGIAVPERNKLYK
FT                   NIFQKRKKQRLSIGILQTLAGKRSLENTNMWLLTI"
FT   gene            383138..383392
FT                   /locus_tag="SPCG_0384"
FT   CDS_pept        383138..383392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0384"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89636"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT0"
FT                   /protein_id="ACB89636.1"
FT                   /translation="MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVVGSLV
FT                   YEHPELEEIILILFENLFKPRQLYLQPQNSVLSNLRLAS"
FT   gene            383411..383683
FT                   /locus_tag="SPCG_0385"
FT   CDS_pept        383411..383683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0385"
FT                   /product="DNA alkylation repair enzyme, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89637"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT1"
FT                   /protein_id="ACB89637.1"
FT                   /translation="MSIKWSLSDNIWLRRVAIDHQLLRKEKTNTQLMEKILLHNLNQTE
FT                   FFINKAIGWTLRDYSKTNPTWVTCFIEKNKERMAELSIKEASKYL"
FT   gene            383833..384072
FT                   /locus_tag="SPCG_0386"
FT   CDS_pept        383833..384072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89638"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT2"
FT                   /protein_id="ACB89638.1"
FT                   /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETL
FT                   EKGPGSNDSSLSEISPTYGSYYQKQSEVLSVMMI"
FT   gene            384069..384974
FT                   /gene="cbpG"
FT                   /locus_tag="SPCG_0387"
FT   CDS_pept        384069..384974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbpG"
FT                   /locus_tag="SPCG_0387"
FT                   /product="choline binding protein G"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89639"
FT                   /db_xref="GOA:B2ILT3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008353"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT3"
FT                   /protein_id="ACB89639.1"
FT                   /translation="MIKIDNTLQYPYSTSAMVLSKYYGVADGMNVEGRGSANFIKDNVL
FT                   ITAAHNYYRHDYGKEADDIYVLPAVSPSQELFGKIKVKEVRYLKEFRNLNSKDAREYDL
FT                   ALLILEEPIGAKLGTLGLPTSQKNLTGITVTITGYPSYNFKIHQMYTDKKQVLSDDGMF
FT                   LDYQVDTLEGSSGSTVYDASHRVVGVHTLGDGANQINSAVKLNERNLPFIYSVLKGYSL
FT                   EGWKKINGSWYHYRQHDKQTGWQEINDTWYYLDSSGKMLTDWQKVNGKWYYLNSNGAMV
FT                   TGSQTIDGKVYNFASSGEWI"
FT   gene            384993..385418
FT                   /locus_tag="SPCG_0388"
FT   CDS_pept        384993..385418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89640"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT4"
FT                   /protein_id="ACB89640.1"
FT                   /translation="MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYYK
FT                   KGDLKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEISLRPDWFYF
FT                   GQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAEK"
FT   gene            385536..386015
FT                   /locus_tag="SPCG_0389"
FT   CDS_pept        385536..386015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89641"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT5"
FT                   /protein_id="ACB89641.1"
FT                   /translation="MAVGELARGWVKDSPLTYDEEKLKAAPWYYLDPTTGIMQTGWQFL
FT                   GNRWYYLHSSGAMATGWYKEGSTWYYLDAENGDMRTGWQYLGNKWYYLRSSGAMATGWY
FT                   QEGSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTVGGYYLNYNGEWVK"
FT   gene            complement(386143..386328)
FT                   /locus_tag="SPCG_0390"
FT   CDS_pept        complement(386143..386328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0390"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89642"
FT                   /db_xref="GOA:B2ILT6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT6"
FT                   /protein_id="ACB89642.1"
FT                   /translation="MVESFFGILKSEMFYGYEKTFKSLNQLEQAIIDYIDYYNNKRIKV
FT                   KLKGLSPVQYRTKSFG"
FT   gene            complement(386276..386506)
FT                   /locus_tag="SPCG_0391"
FT   CDS_pept        complement(386276..386506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0391"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89643"
FT                   /db_xref="GOA:B2ILT7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT7"
FT                   /protein_id="ACB89643.1"
FT                   /translation="MEKCYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSTSPNLE
FT                   QVQTMLEQAFTEKHYGGVLLWDSEIGNVLWL"
FT   gene            complement(386568..386840)
FT                   /locus_tag="SPCG_0392"
FT   CDS_pept        complement(386568..386840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0392"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89644"
FT                   /db_xref="GOA:B2ILT8"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT8"
FT                   /protein_id="ACB89644.1"
FT                   /translation="MTEFSLDLLLKAIKLARWTYYYHLKQLDKPDKDQELKAEIQSIFI
FT                   EHKGNYTYRRVHLELRNRGYLVNHKRVQGLMKVLNLQAKMRQKRK"
FT   gene            complement(387066..387341)
FT                   /locus_tag="SPCG_0393"
FT   CDS_pept        complement(387066..387341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0393"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89645"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILT9"
FT                   /protein_id="ACB89645.1"
FT                   /translation="MYMNYTPKVRQKKSNFWGVFIMKLTYDDKVQIYELRKQGYSLEKL
FT                   SNKFGINNSNIRYMIKLIDRYGIEFIKKGKNRYYSPDLKQEMINKV"
FT   gene            387487..389256
FT                   /gene="mtlA"
FT                   /locus_tag="SPCG_0394"
FT   CDS_pept        387487..389256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="SPCG_0394"
FT                   /product="PTS system, mannitol-specific IIBC components"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89646"
FT                   /db_xref="GOA:B2ILU0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU0"
FT                   /protein_id="ACB89646.1"
FT                   /translation="MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGYL
FT                   PNEQLATVVGPMLTYLLPILIGYTGGYMIHGQRGAVVGSIATVGAITGSSVPMFIGAMV
FT                   MGPLGGWTIKKFDEKFQEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLTGAV
FT                   GNGVEAIVNARLLPMANIIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFLLEAN
FT                   PGPGLGILLAYAVFGKGSAKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAMAGGIS
FT                   GTFTFQLLDAGLKSPASPGSIIAIMATAPKGVWPHLNVLLGVLVAAVVSFLVAALILHA
FT                   DKSTEDSLEAAQAATQAAKAQSKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAMGAS
FT                   ILRDKVKKAGLEIPVSNQAISNLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDNFLAS
FT                   PRYDEIVASLTGASPIAEIEGDIPTSAPVDSQEIDLNHIDAVVVAYGKAQGTATMGCET
FT                   IRAIFRNKNIRIPVSTAKISELGEFNSKNIMIVTTISLQAEVQQAAPNSQFLIVDSLVT
FT                   TPEYDKMAARMYK"
FT   gene            389280..391235
FT                   /locus_tag="SPCG_0395"
FT   CDS_pept        389280..391235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0395"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89647"
FT                   /db_xref="GOA:B2ILU1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU1"
FT                   /protein_id="ACB89647.1"
FT                   /translation="MLLTKREEQLLKAFLHVGKLSMQDMTEILQVSSRTIYRTLSDLTD
FT                   SMEQYGIEITKHGKYYILTGELDDLPTELEVLVEYSPQERQELITYRLLTESGFVTNEA
FT                   LQECTKVSNVTIIQDISDIDKRLLDFDLKIERQKGYRISGDSVGKRRFLAILLTNCISV
FT                   ADFSTGNFGSFDILEADRTRLASQIVNKQLSGFPDMDARMKMFFAILLSLIGQEQNIEN
FT                   SPNTSKQALEISQKIFQAYSKQTAQFYSIQEIIYFASILDELIIKRQDNPLFTEKFDGE
FT                   FFYNISNLIDTVSMYTKIDFFKDKVLFNFLFHHIRLSLGVPILFQGENLPESVQILVER
FT                   NKFLYTVISLLVNDIFPKYLHTEYEYGMIALHFISSLGRSPEIYPVRVLLLTDERRVTR
FT                   DLLVSKIKSVAPFVELIDIQSLVDYHSIDLSQYDYILSTKPLTNQEIDVISSFPTVKEL
FT                   LELQERLQYVQAHRTIVARDAIAPEKSYDLQDYLISSSQLLSQFELVQLENNQSFEHTV
FT                   EQIIQYQKNVSDRDYLTRKLLSHFQNSPMAIPNTGLVLLHSQSSKVTTNSFTMFELKLP
FT                   ISALSMKREEEEVKRCLLMLMSKEASEEARDLMTAISQSIIENHLYTEIYKTGNQSIIY
FT                   QMLNTIFNEKIKKLEN"
FT   gene            391237..391674
FT                   /gene="mtlF"
FT                   /locus_tag="SPCG_0396"
FT   CDS_pept        391237..391674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="SPCG_0396"
FT                   /product="PTS system, mannitol-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89648"
FT                   /db_xref="GOA:B2ILU2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU2"
FT                   /protein_id="ACB89648.1"
FT                   /translation="MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIER
FT                   DKELSVYMGNFIAIPHGTDAAKKDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIAGI
FT                   GNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE"
FT   gene            391736..392872
FT                   /gene="mtlD"
FT                   /locus_tag="SPCG_0397"
FT   CDS_pept        391736..392872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="SPCG_0397"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89649"
FT                   /db_xref="GOA:B2ILU3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILU3"
FT                   /protein_id="ACB89649.1"
FT                   /translation="MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKG
FT                   KYEIEIAQKGQSRIEVTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELLAK
FT                   GIEARRVAGNTQVLDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRI
FT                   VPAQSHEDSLFVVVEPFNEWVVETKRLKNPDLRLKDVHYEEDLEPFIERKLFSVNSGHA
FT                   TSAYIGAHYGAKTILEALQNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIER
FT                   FENPFIVDEVSRVARTPIRKLGYNERFIRPIRELKELSLSYKNLLKTVGYAFDYRDVND
FT                   EESIRLGELLAKQSVKDVVIQVTGLDDQELIEQIVEYI"
FT   gene            393088..393246
FT                   /locus_tag="SPCG_0398"
FT   CDS_pept        393088..393246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89650"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU4"
FT                   /protein_id="ACB89650.1"
FT                   /translation="MSLIFVVIYKVKEAGQKVFKIGKRQPIGCSKILIGCPLLWKALLD
FT                   FLLRLSF"
FT   gene            393716..394999
FT                   /gene="tig"
FT                   /locus_tag="SPCG_0399"
FT   CDS_pept        393716..394999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SPCG_0399"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89651"
FT                   /db_xref="GOA:B2ILU5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILU5"
FT                   /protein_id="ACB89651.1"
FT                   /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGFR
FT                   KGHLPRPIFDKKFGEESLYQDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQDW
FT                   VIAAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAAENG
FT                   DTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVTFPED
FT                   YQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKELAAAKE
FT                   EAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDMYFQITG
FT                   TTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYNMEVAQVQ
FT                   NLLSADMLKHDITIKKAVELITSTATVK"
FT   gene            complement(395047..397413)
FT                   /gene="recD"
FT                   /locus_tag="SPCG_0400"
FT   CDS_pept        complement(395047..397413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="SPCG_0400"
FT                   /product="helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89652"
FT                   /db_xref="GOA:B2ILU6"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU6"
FT                   /protein_id="ACB89652.1"
FT                   /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTG
FT                   TMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRTKPTSKGLVKYFSSSHFKGIGLKTA
FT                   QKIVDTYGENTIDEILQHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANYGIP
FT                   NKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGL
FT                   VHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQID
FT                   TKIFDNSLFFAEEGIRSHLVRILEKGKQKSHDLETIQKHITTVEQELGIEYDNIQKQAI
FT                   CDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRM
FT                   NELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNS
FT                   KILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILP
FT                   ADFTQKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQ
FT                   LMQDLLNPPQKDQLSFEAPQCHYRKGDKVIHLVNDAEINVFNGDLGAITDLIPGKYTES
FT                   KQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPITSASRRMLERNL
FT                   IYTAITRAKSKLILLGELQAFDYATQHIGTARKTYLIERFSDLLENVEEKQQAVSETVT
FT                   SSASEQSYILTEENWDSIPAMIGITDTDLKEIFGK"
FT   gene            complement(397647..398261)
FT                   /gene="spi"
FT                   /locus_tag="SPCG_0401"
FT   CDS_pept        complement(397647..398261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spi"
FT                   /locus_tag="SPCG_0401"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89653"
FT                   /db_xref="GOA:B2ILU7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU7"
FT                   /protein_id="ACB89653.1"
FT                   /translation="MNLFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLAD
FT                   GEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDEETDEPY
FT                   LADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEY
FT                   LLLGDDRLVSSDSRHVGTFKAKDITGEAKFRFWPITRIGTF"
FT   gene            complement(398273..399145)
FT                   /locus_tag="SPCG_0402"
FT   CDS_pept        complement(398273..399145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0402"
FT                   /product="ribonuclease HIII"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89654"
FT                   /db_xref="GOA:B2ILU9"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILU9"
FT                   /protein_id="ACB89654.1"
FT                   /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVSI
FT                   YTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFVTP
FT                   DQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAVSVK
FT                   VALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQETNRFSNPISLEEKAEGKYLA
FT                   VAVSSVIARDLFLENLENLERELGYQLPSGAGTASDKVASQILQAYGMQGLNFCAKLHF
FT                   KNTEKAKNA"
FT   gene            399223..399534
FT                   /locus_tag="SPCG_0403"
FT   CDS_pept        399223..399534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89655"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV0"
FT                   /protein_id="ACB89655.1"
FT                   /translation="MNFMANLNRFKFTFGKKSLTLTSEHDNLFMEEIAKVATEKYQAIK
FT                   EQMPSADDETIALLLAVNCLSTQLSREIEFDDKEQELEELRHKLVTCKQEQSKIEDSL"
FT   gene            399531..400079
FT                   /locus_tag="SPCG_0404"
FT   CDS_pept        399531..400079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89656"
FT                   /db_xref="GOA:B2ILV1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV1"
FT                   /protein_id="ACB89656.1"
FT                   /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYKG
FT                   LGEQFHLLLPYANSQEGQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGLLL
FT                   HLIPSKKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKHIIQ
FT                   SIPITTSWLKQIWVTNLIG"
FT   gene            400183..402519
FT                   /gene="mutS2"
FT                   /locus_tag="SPCG_0405"
FT   CDS_pept        400183..402519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="SPCG_0405"
FT                   /product="mutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89657"
FT                   /db_xref="GOA:B2ILV2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILV2"
FT                   /protein_id="ACB89657.1"
FT                   /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIKQ
FT                   AFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLTSRELQS
FT                   FYANLENVSLEELALWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHDSES
FT                   QVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTVYIEP
FT                   REVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRAKVRFI
FT                   QERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVYFGQDLTAIVITGPNTGGKTIMLKT
FT                   LGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNIVDILGKV
FT                   NQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYGIETAFVQN
FT                   ASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQDNDVNRIIEQ
FT                   LEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKAREQAAEIVDMAL
FT                   SESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAKKKRAPKVGDDI
FT                   VVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPVKKKQVNVVKRTS
FT                   GRGPQARLDLRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTGVIREGVTKYLQRN
FT                   KHVKSFGYAPQNAGGSGATIVTFKG"
FT   gene            complement(402640..402741)
FT                   /locus_tag="SPCG_0406"
FT   CDS_pept        complement(402640..402741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89658"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV3"
FT                   /protein_id="ACB89658.1"
FT                   /translation="MSSCLPCPFGAFTVSPEFRPFTVMENQTIPHFY"
FT   gene            402862..404184
FT                   /gene="dagA"
FT                   /locus_tag="SPCG_0407"
FT   CDS_pept        402862..404184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dagA"
FT                   /locus_tag="SPCG_0407"
FT                   /product="sodium:alanine symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89659"
FT                   /db_xref="GOA:B2ILV4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV4"
FT                   /protein_id="ACB89659.1"
FT                   /translation="MLELLKSIDAFAWGPPLLILLVGTGIYLTIRLGLLQVLRLPKAFQ
FT                   LIFIQDKGHGDVSSFAALCTALASTVGTGNIIGVATAIKVGGPGALFWMWMAAFFGMAT
FT                   KYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIGTFT
FT                   QVNSIAESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYILGTL
FT                   TVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESGLGSAP
FT                   IAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALTQSAFST
FT                   VFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVLMVLLGGFI
FT                   ELDMVWIIADIVNALMALPNLIALLVLSPVVIAETKKYFDK"
FT   gene            404402..404950
FT                   /gene="mip"
FT                   /locus_tag="SPCG_0408"
FT   CDS_pept        404402..404950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="SPCG_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89660"
FT                   /db_xref="GOA:B2ILV5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV5"
FT                   /protein_id="ACB89660.1"
FT                   /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVL
FT                   QAYQIVSSIHRRNSLTPVDREVVQITAAVTNGCAFCVAGHTALSIKQIQMNDDLIQALR
FT                   NRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLAILC
FT                   NYANNLANTPINPELQPYA"
FT   gene            405048..405959
FT                   /gene="shetA"
FT                   /locus_tag="SPCG_0409"
FT   CDS_pept        405048..405959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shetA"
FT                   /locus_tag="SPCG_0409"
FT                   /product="exfoliative toxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89661"
FT                   /db_xref="GOA:B2ILV6"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV6"
FT                   /protein_id="ACB89661.1"
FT                   /translation="MEVRMKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLW
FT                   IYFLILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFS
FT                   FLLDLTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGF
FT                   LLTFYLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMIL
FT                   ASQSFFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLAET
FT                   IICLTILFFVLGAYLIWLRKKV"
FT   gene            complement(405984..407342)
FT                   /gene="serS"
FT                   /locus_tag="SPCG_0410"
FT   CDS_pept        complement(405984..407342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SPCG_0410"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89662"
FT                   /db_xref="GOA:B2ILV7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV7"
FT                   /protein_id="ACB89662.1"
FT                   /translation="MHTCEVGWNRGPATPTFCQACFFHKGVLMLDIKRIRTDFEAVAEK
FT                   LATRGVDAAVLNEMKEIDAKRRNILIKVETLKAERNTVSAEIAQAKRNKENTDDKIAAM
FT                   QNLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADEDDNVEVRRWGTPREFDF
FT                   EPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIYNFMLDEHGKEGYTEVI
FT                   TPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTNYYRDEILDGKDLPIYF
FT                   TAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEELEKMTANAENILQKL
FT                   NLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNNYREISSCSNTEDFQARRAQIRYRDEA
FT                   DGKVKLLHTLNGSGLAVGRTVAAILENYQNEDASVTIPEALRPYMGGAEVIKP"
FT   gene            complement(407472..407843)
FT                   /locus_tag="SPCG_0411"
FT   CDS_pept        complement(407472..407843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89663"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV8"
FT                   /protein_id="ACB89663.1"
FT                   /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQ
FT                   FIQIPWSHINQIGANVTGRKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVK
FT                   LPTLIQTISQKFKNLFAKK"
FT   gene            complement(407846..409210)
FT                   /gene="lysC"
FT                   /locus_tag="SPCG_0412"
FT   CDS_pept        complement(407846..409210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="SPCG_0412"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89664"
FT                   /db_xref="GOA:B2ILV9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILV9"
FT                   /protein_id="ACB89664.1"
FT                   /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAED
FT                   TKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISKSIHALATLP
FT                   IEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARIIPSS
FT                   YDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKADLYENFTDVD
FT                   GIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKNTNNPD
FT                   HPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEELNIGWEH
FT                   MPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGEKMKSHIG
FT                   VTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGESKED"
FT   gene            409579..410349
FT                   /gene="phaB"
FT                   /locus_tag="SPCG_0413"
FT   CDS_pept        409579..410349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="SPCG_0413"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89665"
FT                   /db_xref="GOA:B2ILW0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW0"
FT                   /protein_id="ACB89665.1"
FT                   /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENP
FT                   AVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLME
FT                   VDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLA
FT                   MTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKD
FT                   WQGYATLELNLQKSLAQTEDFKEGVPSSFGEKKT"
FT   gene            410459..410893
FT                   /locus_tag="SPCG_0414"
FT   CDS_pept        410459..410893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0414"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89666"
FT                   /db_xref="GOA:B2ILW1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW1"
FT                   /protein_id="ACB89666.1"
FT                   /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIG
FT                   KAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHR
FT                   LHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
FT   gene            410893..411867
FT                   /gene="fabH"
FT                   /locus_tag="SPCG_0415"
FT   CDS_pept        410893..411867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SPCG_0415"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89667"
FT                   /db_xref="GOA:B2ILW2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILW2"
FT                   /protein_id="ACB89667.1"
FT                   /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRHI
FT                   SRTESTSDLATEVAKKLMAKAGITGEELDFIILATITPDSMMPSTAARVQANIGANKAF
FT                   AFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDGAGG
FT                   VLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVFDFAI
FT                   RDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMMEYGNTS
FT                   AASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
FT   gene            411927..412151
FT                   /gene="acp"
FT                   /locus_tag="SPCG_0416"
FT   CDS_pept        411927..412151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acp"
FT                   /locus_tag="SPCG_0416"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89668"
FT                   /db_xref="GOA:B2ILW3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW3"
FT                   /protein_id="ACB89668.1"
FT                   /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISEI
FT                   EDAFDIQIEAENDLKTVGDLVAYVEEQAK"
FT   gene            412270..413244
FT                   /gene="fabK"
FT                   /locus_tag="SPCG_0417"
FT   CDS_pept        412270..413244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="SPCG_0417"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89669"
FT                   /db_xref="GOA:B2ILW4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW4"
FT                   /protein_id="ACB89669.1"
FT                   /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGN
FT                   APKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYME
FT                   RFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAVSI
FT                   PVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISA
FT                   QHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVEGGSVM
FT                   AGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGVVRND"
FT   gene            413237..414157
FT                   /gene="fabD"
FT                   /locus_tag="SPCG_0418"
FT   CDS_pept        413237..414157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SPCG_0418"
FT                   /product="acyl-carrier-protein S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89670"
FT                   /db_xref="GOA:B2ILW5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW5"
FT                   /protein_id="ACB89670.1"
FT                   /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLR
FT                   YLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALD
FT                   FEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPA
FT                   QIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVSFSDF
FT                   TCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGF
FT                   VKKIDQTAHLAHVEDQASLVALLEK"
FT   gene            414191..414922
FT                   /gene="fabG"
FT                   /locus_tag="SPCG_0419"
FT   CDS_pept        414191..414922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SPCG_0419"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89671"
FT                   /db_xref="GOA:B2ILW6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW6"
FT                   /protein_id="ACB89671.1"
FT                   /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELL
FT                   AEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEAD
FT                   FEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGF
FT                   TKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTV
FT                   FLAGQDYLTGQVIAIDGGLSM"
FT   gene            414935..416179
FT                   /gene="fabF"
FT                   /locus_tag="SPCG_0420"
FT   CDS_pept        414935..416179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SPCG_0420"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89672"
FT                   /db_xref="GOA:B2ILW7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW7"
FT                   /protein_id="ACB89672.1"
FT                   /translation="MKRMKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFD
FT                   HSDFDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRF
FT                   GVIVASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSI
FT                   NTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRAS
FT                   IPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEGQG
FT                   AIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSFTGH
FT                   LLGAAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISNTFGF
FT                   GGHNAVLAFKRWENR"
FT   gene            416182..416667
FT                   /gene="accB"
FT                   /locus_tag="SPCG_0421"
FT   CDS_pept        416182..416667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="SPCG_0421"
FT                   /product="acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89673"
FT                   /db_xref="GOA:B2ILW8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILW8"
FT                   /protein_id="ACB89673.1"
FT                   /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVAT
FT                   QVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVATEGNLVESPLVGVVYLAAGPDK
FT                   PAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRIK"
FT   gene            416664..417086
FT                   /gene="fabZ"
FT                   /locus_tag="SPCG_0422"
FT   CDS_pept        416664..417086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SPCG_0422"
FT                   /product="(3R)-hydroxymyristoyl ACP dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89674"
FT                   /db_xref="GOA:B2ILW9"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILW9"
FT                   /protein_id="ACB89674.1"
FT                   /translation="MIDIQEIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFN
FT                   GHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVM
FT                   TATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
FT   gene            417098..418465
FT                   /gene="accC"
FT                   /locus_tag="SPCG_0423"
FT   CDS_pept        417098..418465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SPCG_0423"
FT                   /product="acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89675"
FT                   /db_xref="GOA:B2ILX0"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX0"
FT                   /protein_id="ACB89675.1"
FT                   /translation="MFRKILIANRGEIAVRIIRAARELGIATVAVYSTADKEALHTLLA
FT                   DEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKFIG
FT                   PSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKASAGG
FT                   GGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEHGHVI
FT                   HLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEFLLDEA
FT                   SSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGHAIECRI
FT                   NAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKIIVHGENRF
FT                   DALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPKYQEKE"
FT   gene            418502..419368
FT                   /gene="accD"
FT                   /locus_tag="SPCG_0424"
FT   CDS_pept        418502..419368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SPCG_0424"
FT                   /product="acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89676"
FT                   /db_xref="GOA:B2ILX1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX1"
FT                   /protein_id="ACB89676.1"
FT                   /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIY
FT                   QKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASM
FT                   REKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVV
FT                   LFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDI
FT                   ILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVR
FT                   LHGGSPR"
FT   gene            419365..420132
FT                   /gene="accA"
FT                   /locus_tag="SPCG_0425"
FT   CDS_pept        419365..420132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SPCG_0425"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89677"
FT                   /db_xref="GOA:B2ILX2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILX2"
FT                   /protein_id="ACB89677.1"
FT                   /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAVV
FT                   GGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKHAEKFGRPVVTFI
FT                   NTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRVWML
FT                   ENSIYAILSPEGFASILWKDGSRAMEAAELMKITSHELLEMDVVDKVISEVGLSSKELI
FT                   KSVKKELQTELARLSQKPLEELLEERYQRFRKY"
FT   gene            420329..420580
FT                   /locus_tag="SPCG_0426"
FT   CDS_pept        420329..420580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89678"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX3"
FT                   /protein_id="ACB89678.1"
FT                   /translation="MTFLIELFTSYFKSLYFKKVLAMTATETFTVISTEDLEQTSGGLA
FT                   VWEDGYSRWLYYREFAPYMRQGALNSYIDAWKYGFRAG"
FT   gene            complement(421370..421810)
FT                   /gene="nusB"
FT                   /locus_tag="SPCG_0427"
FT   CDS_pept        complement(421370..421810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SPCG_0427"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89679"
FT                   /db_xref="GOA:B2ILX4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX4"
FT                   /protein_id="ACB89679.1"
FT                   /translation="MTRTSSMTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTH
FT                   DREYTDVQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEI
FT                   TSFDTPQLVAINEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
FT   gene            complement(421785..422174)
FT                   /locus_tag="SPCG_0428"
FT   CDS_pept        complement(421785..422174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89680"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX5"
FT                   /protein_id="ACB89680.1"
FT                   /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLSK
FT                   LSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAINIH
FT                   VAGIVPDKTPKPELKDLFDEDFLND"
FT   gene            complement(422196..422756)
FT                   /gene="efp"
FT                   /locus_tag="SPCG_0429"
FT   CDS_pept        complement(422196..422756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SPCG_0429"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89681"
FT                   /db_xref="GOA:B2ILX6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILX6"
FT                   /protein_id="ACB89681.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENELL
FT                   YILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   gene            complement(422885..424327)
FT                   /gene="gatB"
FT                   /locus_tag="SPCG_0430"
FT   CDS_pept        complement(422885..424327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SPCG_0430"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89682"
FT                   /db_xref="GOA:B2ILX7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILX7"
FT                   /protein_id="ACB89682.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFP
FT                   GVLPVLNKGVVDAGIKAALALNMDLHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNV
FT                   RKGLEYEVQRQAEILRSGGQIRQETRRYDEANKTTILMRVKEGAADYRYFPEPDLPLFE
FT                   ISDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNG
FT                   GGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVALKLLAQELAKLKEN"
FT   gene            complement(424327..425793)
FT                   /gene="gatA"
FT                   /locus_tag="SPCG_0431"
FT   CDS_pept        complement(424327..425793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SPCG_0431"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89683"
FT                   /db_xref="GOA:B2ILX8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILX8"
FT                   /protein_id="ACB89683.1"
FT                   /translation="MTFNNKTIEELHNLLVSKEISATELTQATLEDIKSREEALNSFVT
FT                   IAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFDAT
FT                   AVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTVKENA
FT                   LLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKETILNA
FT                   AKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDATNLDEI
FT                   YVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFADYDLILG
FT                   PTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVGLQLIGPKY
FT                   SEETIYQAAAAFEATTDYHKQQPVIFGGDN"
FT   gene            complement(425793..426155)
FT                   /gene="gatC"
FT                   /locus_tag="SPCG_0432"
FT   CDS_pept        complement(425793..426155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SPCG_0432"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89684"
FT                   /db_xref="GOA:B2ILX9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILX9"
FT                   /protein_id="ACB89684.1"
FT                   /translation="MGKYGKIEQTKNHHFTKGCKMKITQEEVTHVANLSKLRFSEEETA
FT                   AFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEKD
FT                   NYYIKVPAILDDGGDA"
FT   gene            426308..427852
FT                   /gene="prfC"
FT                   /locus_tag="SPCG_0433"
FT   CDS_pept        426308..427852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="SPCG_0433"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89685"
FT                   /db_xref="GOA:B2ILY0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILY0"
FT                   /protein_id="ACB89685.1"
FT                   /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKG
FT                   KKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNILDTPGHEDFSEDTYRTLMAVD
FT                   AAVMVVDSAKGIEAQTKKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIAS
FT                   YPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELL
FT                   NEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLEIFLKFAPEPHGHKKTDGEIVDPY
FT                   DKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAE
FT                   SRENVTNAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQ
FT                   KSFHKGIEQLVQEGAVQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMSPMGK
FT                   KTVRWIKPEDLDERMSSSRNILAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM"
FT   gene            428107..428304
FT                   /locus_tag="SPCG_0434"
FT   CDS_pept        428107..428304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89686"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY1"
FT                   /protein_id="ACB89686.1"
FT                   /translation="MKEEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPR
FT                   EWFQLMEKRLETLNSEIVNV"
FT   gene            428415..428591
FT                   /locus_tag="SPCG_0435"
FT   CDS_pept        428415..428591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89687"
FT                   /db_xref="GOA:B2ILY2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY2"
FT                   /protein_id="ACB89687.1"
FT                   /translation="MDSDIVVRKSIDELWDLDLTAIPLAAVRDDFYTHNFNSGVLLIND
FT                   GMWRAENVTQDLI"
FT   gene            428707..428895
FT                   /gene="rpmB"
FT                   /locus_tag="SPCG_0436"
FT   CDS_pept        428707..428895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SPCG_0436"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89688"
FT                   /db_xref="GOA:B2ILY3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILY3"
FT                   /protein_id="ACB89688.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKPK
FT                   KVWASARALKSGKVERV"
FT   gene            429052..429417
FT                   /gene="asp23"
FT                   /locus_tag="SPCG_0437"
FT   CDS_pept        429052..429417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asp23"
FT                   /locus_tag="SPCG_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89689"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY4"
FT                   /protein_id="ACB89689.1"
FT                   /translation="MTVKINTKDGQIELTDEVIATVVGGAATEIFGVVGMASKNALKDN
FT                   FQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGI
FT                   TAQTVNVYIQNIKVVGE"
FT   gene            429420..431087
FT                   /locus_tag="SPCG_0438"
FT   CDS_pept        429420..431087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89690"
FT                   /db_xref="GOA:B2ILY5"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY5"
FT                   /protein_id="ACB89690.1"
FT                   /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMG
FT                   MTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELT
FT                   GQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDTVEVMRAALEGA
FT                   KTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMI
FT                   NVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEY
FT                   ALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNIF
FT                   MAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTT
FT                   AVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDG
FT                   SEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
FT   gene            431288..432988
FT                   /gene="ilvB"
FT                   /locus_tag="SPCG_0439"
FT   CDS_pept        431288..432988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SPCG_0439"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89691"
FT                   /db_xref="GOA:B2ILY6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY6"
FT                   /protein_id="ACB89691.1"
FT                   /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIYN
FT                   FKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPLLV
FT                   FTGQVARAGIGKDAFQEADIVGITMPITKYSYQVRETADIPRIITEAVHIATTGRPGPV
FT                   VIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAGGGIS
FT                   YAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTEADFMI
FT                   SIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQMLLAEPT
FT                   VHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDVGQHQMWT
FT                   AQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQMTNQELAIL
FT                   NIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAYGIKNYKFDN
FT                   PETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA"
FT   gene            432957..433457
FT                   /gene="ilvN"
FT                   /locus_tag="SPCG_0440"
FT   CDS_pept        432957..433457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SPCG_0440"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89692"
FT                   /db_xref="GOA:B2ILY7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILY7"
FT                   /protein_id="ACB89692.1"
FT                   /translation="MRCWGCSSMRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGA
FT                   TEDPNVSRITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPA
FT                   EKRAEILAIIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGF
FT                   TRD"
FT   gene            433523..434545
FT                   /gene="ilvC"
FT                   /locus_tag="SPCG_0441"
FT   CDS_pept        433523..434545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SPCG_0441"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89693"
FT                   /db_xref="GOA:B2ILY8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2ILY8"
FT                   /protein_id="ACB89693.1"
FT                   /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDVI
FT                   IGVRPGKSFDKAKEDGFDTYTVTEATKLADVIMILAPDEIQQELYEAEIAPNLEAGNAV
FT                   GFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYQDATGNAKN
FT                   IAMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAGYAPE
FT                   LAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMKAVLAD
FT                   IQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDDAFKIYN
FT                   "
FT   gene            434622..434888
FT                   /locus_tag="SPCG_0442"
FT   CDS_pept        434622..434888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89694"
FT                   /db_xref="UniProtKB/TrEMBL:B2ILU8"
FT                   /protein_id="ACB89694.1"
FT                   /translation="MYNVITPSVIVLADQNKADWSYDENTVINIYDDANFEDGRLHMTF
FT                   EQFFKLAQIAREEGLEIHSSFERAGATKSARYIAKWILRNKKH"
FT   gene            435126..435482
FT                   /locus_tag="SPCG_0443"
FT   CDS_pept        435126..435482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89695"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM68"
FT                   /protein_id="ACB89695.1"
FT                   /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSNF
FT                   VPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIRMA
FT                   HKYHESVTEVFGDE"
FT   gene            435532..436782
FT                   /gene="ilvA"
FT                   /locus_tag="SPCG_0444"
FT   CDS_pept        435532..436782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="SPCG_0444"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89696"
FT                   /db_xref="GOA:B2IM69"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM69"
FT                   /protein_id="ACB89696.1"
FT                   /translation="MLSSKDIIKAHKILNGVVVNTPLDYDHYLSEKYGAKIYLKKENAQ
FT                   RVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITTPQ
FT                   QKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGTVAY
FT                   EILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKAAFEA
FT                   GGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIKTLVGVDEGLISETLIDLYSKQGIVA
FT                   EPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHYFVVNFP
FT                   QRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLIRRMEGFD
FT                   PAYINLNGNETLYNMLV"
FT   gene            436924..437112
FT                   /locus_tag="SPCG_0445"
FT   CDS_pept        436924..437112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89697"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM70"
FT                   /protein_id="ACB89697.1"
FT                   /translation="MAQISILHFDFLSIDKHSHTVFNTLRKSLQTTLALSATSKQCFEQ
FT                   LAASFLVCSLIFIEYKV"
FT   gene            437666..437881
FT                   /locus_tag="SPCG_0446"
FT   CDS_pept        437666..437881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89698"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM71"
FT                   /protein_id="ACB89698.1"
FT                   /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGRA
FT                   KVKNISFETALGLIDFYEKNHEKFED"
FT   gene            complement(437990..438730)
FT                   /gene="glnQ"
FT                   /locus_tag="SPCG_0447"
FT   CDS_pept        complement(437990..438730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="SPCG_0447"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89699"
FT                   /db_xref="GOA:B2IM72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM72"
FT                   /protein_id="ACB89699.1"
FT                   /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGKS
FT                   TFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENTIV
FT                   AQTTVLKRERTEAEEIAKENLEKVGMGERYWQANPKQLSGGQKQRVAIARALSMNPDAI
FT                   LFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGVIAEE
FT                   GKPEDLFTNPKEDRTKEFLQRYLK"
FT   gene            complement(438730..440295)
FT                   /gene="glnH"
FT                   /locus_tag="SPCG_0448"
FT   CDS_pept        complement(438730..440295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="SPCG_0448"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89700"
FT                   /db_xref="GOA:B2IM73"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM73"
FT                   /protein_id="ACB89700.1"
FT                   /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDD
FT                   DSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAG
FT                   MSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYDLIA
FT                   QIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGFKTGE
FT                   EDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSSSFFSQ
FT                   VAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKAIYGLQKLVG
FT                   WVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYMTEIVRGG
FT                   ILAVDKGQFEAATALGMTHNQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVV
FT                   ELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTYTTGANQMQT
FT                   EDLK"
FT   gene            440430..442322
FT                   /locus_tag="SPCG_0449"
FT   CDS_pept        440430..442322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89701"
FT                   /db_xref="GOA:B2IM74"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM74"
FT                   /protein_id="ACB89701.1"
FT                   /translation="MMKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEF
FT                   RQKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEADG
FT                   YTVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRGDK
FT                   GAEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWPRTDFASARDQGLKG
FT                   NRLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVKYAKN
FT                   HRLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRGNVSII
FT                   SEGDAVGLRLVKEDGLSSFEKDCLNLAFSGKKEETLSNLFADYKVSDSLYRRAKVSDEK
FT                   RIQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGGEKALQVGMGALTILPL
FT                   FIGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEAGAEVYYLW
FT                   TSFENMLREIARLDQAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQVENPDINLY
FT                   VAYGWHSMFYHSTAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGGSIGAF"
FT   gene            complement(442319..442489)
FT                   /locus_tag="SPCG_0450"
FT   CDS_pept        complement(442319..442489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89702"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM75"
FT                   /protein_id="ACB89702.1"
FT                   /translation="MKKWTFSIAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLPL
FT                   YHTFSVYGSSL"
FT   gene            complement(442701..443171)
FT                   /locus_tag="SPCG_0451"
FT   CDS_pept        complement(442701..443171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0451"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89703"
FT                   /db_xref="GOA:B2IM76"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM76"
FT                   /protein_id="ACB89703.1"
FT                   /translation="MDKIVGKHSEYTYQLLTCYPNPQKRLEAGFDKLIEIKRLTASKIQ
FT                   DILSVAPRSIGTTSPAREFEIIENIKHYKRLIDKAKKCVNDLMAEFNSVITTVTGIENR
FT                   LGAVILAEIRNIHAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMVKRGSPHLR"
FT   gene            443747..444592
FT                   /locus_tag="SPCG_0452"
FT   CDS_pept        443747..444592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0452"
FT                   /product="bacitracin resistance protein/undecaprenol
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89704"
FT                   /db_xref="GOA:B2IM77"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IM77"
FT                   /protein_id="ACB89704.1"
FT                   /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNEA
FT                   FMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGVFK
FT                   FDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYIGLF
FT                   QVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKAGELL
FT                   SFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSFVRLFV
FT                   "
FT   gene            complement(444631..445275)
FT                   /locus_tag="SPCG_0453"
FT   CDS_pept        complement(444631..445275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0453"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89705"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM78"
FT                   /protein_id="ACB89705.1"
FT                   /translation="MKIITMDMFSPYYDLAKQLFPCAKIVLDRFHIIQHLSRAMSRFRV
FT                   QIMNQFERKSHEYKAIKRYWKLIQQDSRKLSDKRFYRPTFRMHLTNKEILDKILSYSED
FT                   LKHHYQIYQLLLFHFQNKDPEKFFGLIEDTLKQVHPIFQTVFKTFLKNKEKIVNALQLP
FT                   YSNAKLEATNNLIKLIKRNAFGFRNFENFKKRIFIALNIKKERTNFVLSRA"
FT   gene            complement(445272..445922)
FT                   /locus_tag="SPCG_0454"
FT   CDS_pept        complement(445272..445922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0454"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89706"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM79"
FT                   /protein_id="ACB89706.1"
FT                   /translation="MKSDKTIIRKIHMEQLHFITKLLDIKDPNIKILDIINMDTHKEII
FT                   AKLDYEAPSCPDCGSLMKKYDFQKPSKIPYLETTGMPSRILLRKRRFKCYHCSKMMVAE
FT                   TPLVKKNHQIPRIINQKIAQKLIEKISMTDIAHQLAISTSTVIRKLNDFHFEHDFSRLP
FT                   KIMSWDEYAFTKGKMSFIAQDFDNLNIITVLEGRTQAVIRNHFFATIEPFVVK"
FT   gene            complement(446159..447286)
FT                   /gene="dinP"
FT                   /locus_tag="SPCG_0455"
FT   CDS_pept        complement(446159..447286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="SPCG_0455"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89707"
FT                   /db_xref="GOA:B2IM80"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM80"
FT                   /protein_id="ACB89707.1"
FT                   /translation="MRLQIELTWFEEIFEEYKKVLGMLIFPLLNDLSRKIIHIDMDAFF
FT                   AAVEIRDNPKLRGKPVIIGSDPRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQA
FT                   VFISGNYEKYKSVGLQIRAIFKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQK
FT                   DIWQELHLTASAGVSYNKFLAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKK
FT                   TVERLHQMGVFTGADLLEVPEVTLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKE
FT                   KTYGKILLAEEDIKKELTLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQK
FT                   TQDASQISQIALQLYEELSEKERGVRLLGITLTGF"
FT   gene            447568..449892
FT                   /gene="pfl"
FT                   /locus_tag="SPCG_0456"
FT   CDS_pept        447568..449892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="SPCG_0456"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89708"
FT                   /db_xref="GOA:B2IM81"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM81"
FT                   /protein_id="ACB89708.1"
FT                   /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDGD
FT                   ESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGIQN
FT                   DELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRAR
FT                   HAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLREEVNL
FT                   QYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLD
FT                   IFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTSMAGMGN
FT                   DGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHSSIQYEGV
FT                   TTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHKD
FT                   YKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDKYNYEAVQMAFLP
FT                   TKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYPRWGEDDPRSN
FT                   ELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVHKGVYLNEDGSV
FT                   NLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQVSPRALGKTRDEQ
FT                   VDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGYCVNTKYLTPEQKT
FT                   ELTQRVFHEVLSMDDALDALS"
FT   gene            complement(450260..450607)
FT                   /locus_tag="SPCG_0457"
FT   CDS_pept        complement(450260..450607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89709"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM82"
FT                   /protein_id="ACB89709.1"
FT                   /translation="MAQQSCCKANMNKQPPLSLCESLYSFENLTVLVVPIEYVLGMKMM
FT                   SIREQDLKDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVLLEGFSYAYGMDWLEKFF
FT                   KENQDKLREFY"
FT   gene            complement(450805..451089)
FT                   /locus_tag="SPCG_0458"
FT   CDS_pept        complement(450805..451089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89710"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM83"
FT                   /protein_id="ACB89710.1"
FT                   /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKLL
FT                   DSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
FT   gene            452664..452888
FT                   /locus_tag="SPCG_0459"
FT   CDS_pept        452664..452888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0459"
FT                   /product="PTS system, lactose-specific IIBC components,
FT                   truncated"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89711"
FT                   /db_xref="GOA:B2IM84"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM84"
FT                   /protein_id="ACB89711.1"
FT                   /translation="MIANSGAYGAHYDIMGVYDLIILAPQVRSYYREMKVDAERLGIQI
FT                   VATRGMEYIHLTKNPSKALQFVLEHYQAV"
FT   gene            complement(453013..454452)
FT                   /gene="trkH"
FT                   /locus_tag="SPCG_0460"
FT   CDS_pept        complement(453013..454452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="SPCG_0460"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89712"
FT                   /db_xref="GOA:B2IM85"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM85"
FT                   /protein_id="ACB89712.1"
FT                   /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFSTI
FT                   GILVLLGGSGSLQKPKNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQILSLIDAFFE
FT                   ISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEVMKA
FT                   EVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAGTGGF
FT                   TVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYLVIVLV
FT                   STGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILLFLMAIG
FT                   GSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNQTVIDKDTQHKILKYFVI
FT                   YAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISKILLSFAMI
FT                   AGRLEIYPILLLFMKRTWSKR"
FT   gene            complement(454456..455805)
FT                   /gene="trkA"
FT                   /locus_tag="SPCG_0461"
FT   CDS_pept        complement(454456..455805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="SPCG_0461"
FT                   /product="potassium uptake protein, Trk family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89713"
FT                   /db_xref="GOA:B2IM86"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM86"
FT                   /protein_id="ACB89713.1"
FT                   /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFDI
FT                   IGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPEYS
FT                   NSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKSTSGL
FT                   CQMPISDFRKKFGNVIVCAIERDHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHNYFKS
FT                   RAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQGDGTAK
FT                   DILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIINAPDFSS
FT                   IITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMTAKPLSQL
FT                   KLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLLVTTLLPNITKIYDLIAR"
FT   gene            455966..456841
FT                   /locus_tag="SPCG_0462"
FT   CDS_pept        455966..456841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89714"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM87"
FT                   /protein_id="ACB89714.1"
FT                   /translation="MIKDIQGDKMNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIH
FT                   HLTHDITPYNIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTP
FT                   DNGTLSFIKKHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEV
FT                   GPELSVEQIVELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFE
FT                   VTIYHADMLVYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSS
FT                   WTIEIKKIEG"
FT   gene            456856..457404
FT                   /locus_tag="SPCG_0463"
FT   CDS_pept        456856..457404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89715"
FT                   /db_xref="GOA:B2IM88"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IM88"
FT                   /protein_id="ACB89715.1"
FT                   /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQA
FT                   LLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVF
FT                   DWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGT
FT                   LLLLAYAGTQTRAGSLKKD"
FT   gene            457411..457668
FT                   /locus_tag="SPCG_0464"
FT   CDS_pept        457411..457668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89716"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM89"
FT                   /protein_id="ACB89716.1"
FT                   /translation="MKIKEQTRKLAAGCSKQCFEIVDRTDEVSSKHGFEVVDETDEVSN
FT                   HTYGKAKLTWFEEIFEEYKMMGKAGQLVFFDVYRLVRQVS"
FT   gene            457770..459452
FT                   /locus_tag="SPCG_0465"
FT   CDS_pept        457770..459452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0465"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89717"
FT                   /db_xref="GOA:B2IM90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM90"
FT                   /protein_id="ACB89717.1"
FT                   /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGSG
FT                   KSTLGQCLNGIIPNIYKGQTYGEFLIKGQVAFDMSIYDKSHLVSTVLQDTDGQFIGLSV
FT                   AEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVLIDE
FT                   SPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIVLISD
FT                   GRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLANLDNMSISKGQVQ
FT                   LQNELAKETPELQSLFKLEDVSFSYDDRPILKSLHLDIKKGEKIAIVGKNGAGKSTLAK
FT                   AISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVALGLRLRG
FT                   VDEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEIILLDEPTAG
FT                   QDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIADTVPASLLS
FT                   DPELLVKANLKETSIFNLAKKLDVDPLDLTAFYKERREGCKLN"
FT   gene            459437..460267
FT                   /locus_tag="SPCG_0466"
FT   CDS_pept        459437..460267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89718"
FT                   /db_xref="GOA:B2IM91"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM91"
FT                   /protein_id="ACB89718.1"
FT                   /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLLL
FT                   IAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQGI
FT                   GVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSVSLT
FT                   LRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDTIATA
FT                   MELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK"
FT   gene            460421..460963
FT                   /gene="cspR"
FT                   /locus_tag="SPCG_0467"
FT   CDS_pept        460421..460963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="SPCG_0467"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89719"
FT                   /db_xref="GOA:B2IM92"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM92"
FT                   /protein_id="ACB89719.1"
FT                   /translation="MWLFFCNGERKQVMTNHIVLFEPQIPQNTGNIARTCAATNSPLHI
FT                   IKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKVYSEVDL
FT                   STDEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQ
FT                   NFAGLELVHTYEVDKLK"
FT   gene            461401..461979
FT                   /locus_tag="SPCG_0468"
FT   CDS_pept        461401..461979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89720"
FT                   /db_xref="GOA:B2IM93"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM93"
FT                   /protein_id="ACB89720.1"
FT                   /translation="MEEPVMTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSI
FT                   LPVLVGLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWK
FT                   KERTTLRFLLGSLAGTVGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLP
FT                   FNLIEGVIFSVSFWLLYVLLKPTLKHYER"
FT   gene            461969..462619
FT                   /locus_tag="SPCG_0469"
FT   CDS_pept        461969..462619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0469"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89721"
FT                   /db_xref="GOA:B2IM94"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM94"
FT                   /protein_id="ACB89721.1"
FT                   /translation="MKDKQTFLMKGSFALLLFVILGYMVKFYPEMLVNFDQSIQTAIRG
FT                   DLPDYLTILFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIVTF
FT                   KNIYQRPRPAILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKNPVWRKIVQIVLG
FT                   LYLVSVLVSRVYLGVHYPSDVLASLCVGLGVLFIEFPFYDKLRFQWRFKGKQK"
FT   gene            462647..463036
FT                   /locus_tag="SPCG_0470"
FT   CDS_pept        462647..463036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89722"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM95"
FT                   /protein_id="ACB89722.1"
FT                   /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFGD
FT                   CLLITDGHHRAYQALLAGRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRILA
FT                   QDGYEAKWYNWCDGFNQAATLLLKR"
FT   gene            463041..463490
FT                   /locus_tag="SPCG_0471"
FT   CDS_pept        463041..463490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89723"
FT                   /db_xref="GOA:B2IM96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM96"
FT                   /protein_id="ACB89723.1"
FT                   /translation="MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYS
FT                   YLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELAR
FT                   VKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV"
FT   gene            463603..464205
FT                   /gene="rpoE"
FT                   /locus_tag="SPCG_0472"
FT   CDS_pept        463603..464205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SPCG_0472"
FT                   /product="DNA-directed RNA polymerase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89724"
FT                   /db_xref="GOA:B2IM97"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IM97"
FT                   /protein_id="ACB89724.1"
FT                   /translation="MRRNALELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVN
FT                   EIQNYLGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEEN
FT                   DDDEVAPKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVE
FT                   AYDAEINEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
FT   gene            464595..466202
FT                   /gene="pyrG"
FT                   /locus_tag="SPCG_0473"
FT   CDS_pept        464595..466202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SPCG_0473"
FT                   /product="CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89725"
FT                   /db_xref="GOA:B2IM98"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM98"
FT                   /protein_id="ACB89725.1"
FT                   /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYI
FT                   NIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKER
FT                   RGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMK
FT                   ADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGI
FT                   KNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAADMTEWSAM
FT                   VDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENV
FT                   AELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGL
FT                   EGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQ
FT                   RRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPN
FT                   RPEELYTAFVTAAVENSN"
FT   gene            complement(466761..468392)
FT                   /locus_tag="SPCG_0474"
FT   CDS_pept        complement(466761..468392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0474"
FT                   /product="Na/Pi cotransporter II-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89726"
FT                   /db_xref="GOA:B2IM99"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B2IM99"
FT                   /protein_id="ACB89726.1"
FT                   /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDKY
FT                   TSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTSFL
FT                   IGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLKDLQ
FT                   VFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGNLIDLQGALPVLFGDN
FT                   IGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATLNLAPE
FT                   MTIAFAHGTFNITNTIVQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIKQAPSIA
FT                   LGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLTRYLIALS
FT                   SEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAALKELEEVYR
FT                   QTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGECSTQAGVNF
FT                   IDIISHYTRVSDHAMNLAEKVFAEQI"
FT   gene            468594..468704
FT                   /locus_tag="SPCG_0475"
FT   CDS_pept        468594..468704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89727"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA0"
FT                   /protein_id="ACB89727.1"
FT                   /translation="MIIMVLEFDKKLQNIKRFLENNKINLLGGENEESIF"
FT   gene            468685..473664
FT                   /locus_tag="SPCG_0476"
FT   CDS_pept        468685..473664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0476"
FT                   /product="endo-beta-N-acetylglucosaminidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89728"
FT                   /db_xref="GOA:B2IMA1"
FT                   /db_xref="InterPro:IPR005201"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR032979"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA1"
FT                   /protein_id="ACB89728.1"
FT                   /translation="MKNPFFERRCRYSIRKLSVGACSLMIGAVLFAGPALAEETAVPEN
FT                   SGANTELVSGESEHSTNEADKQNEGEHARENKLEKAEGVAIASETASPASNEAATTETA
FT                   EAASAAKPEEKASEVVAETPSAEAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQ
FT                   PDVPKNTEKTLKPKEIKFNSWEELLKWEPGAREDDAINRGSVVLASRRTGHLVNEKASK
FT                   EAKVQALSNTNSKAKDHASVGGEEFKAYAFDYWQYLDSMVFWEGLVPTPDVIDAGHRNG
FT                   VPVYGTLFFNWSNSIADQERFAEALKQDADGSFPIARKLVDMAKYYGYDGYFINQETTG
FT                   DLVKPLGEKMRQFMLYSKEYAAKVNHPIKYSWYDAMTYNYGRYHQDGLGEYNYQFMQPE
FT                   GDKVPADNFFANFNWDKAKNDYTIATANWIGRNPYDVFAGLELQQGGSYKTKVKWNDIL
FT                   DENGKLRLSLGLFAPDTITSLGKTGEDYHKNEDIFFTGYQGDPTGQKPGDKDWYGIANL
FT                   VADRTPAVGNTFTTSFNTGHGKKWFVDGKVSKDSEWNYRSVSGVLPTWRWWQTSTGEKL
FT                   RAEYDFTDAYNGGNSLKFSGDVAGKTDQDVRLYSTKLEVTEKTKLRVAHKGGKGSKVYM
FT                   AFSTTPDYKFDDADAWKELTLSDNWTNEEFDLSSLAGKTIYAVKLFFEHEGAVKDYQFN
FT                   LGQLTISDNHQEPQSPTSFSVVKQSLKNAQEAEAVVQFKGNKDADFYEVYEKDGDSWKL
FT                   LTGSSSTTIYLPKVSRSASAQGTTQELKVVAVGKNGVRSEAATTTFDWGMTVKDTSLPK
FT                   PLAENIVPGATVIDSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKPRT
FT                   VVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPI
FT                   TAQDWRLNVVTSDNGTPWKAIRIYNWKMYEKLDTESVNIPMAKAAARSLGNNKVQVGFA
FT                   DVPAGATITVYDNPNSQTPLATLKSEVGGDLASAPLDLTNQSGLLYYRTQLPGKEISNV
FT                   LAVSVPKDDRRIKSVSLETGPKKTSYAEGEDLDLRGGVLRVQYEGGTEDELIRLTHAGV
FT                   SVSGFDTHHKGEQNLTLQYLGQPVNANLSVTVTGQDEASPKTILGIEVSQEPKKDYLVG
FT                   DSLDLSEGRFAVAYSNDTMEEHSFTDEGVEISGYDAQKTGRQTLTLRYQGHEVNFDVLV
FT                   SPKAALNDEYLKQKLAEVEAAKNKVVYNFASPEVKEAFLKAIEAAEQVLKDHETSTQDQ
FT                   VNDRLNKLTEAHKALNGQEKFTEEKTELDRLTGEVQELLAAKPNHPSGSALAPLLEKNK
FT                   ALVEKVDLSPEELTTTKQSLKDLVALLKEDKPAVFSDSKTGVEVHFSNKEKTVIKGLKV
FT                   ERVQASAEEKKYFAGEDAHVFEIEGLDEKGQDVDLSYASIVKIPIEKDKKVKKVFFLPE
FT                   GKGAVELAFEQTDSHVIFTAPHFTHYAFVYESAEKPQPAKPAPQNKVLPKPTYQPASDQ
FT                   QKAPKLEVQEEKVAFHRQEHENTEMLVGEQRVIIQGRDGLLRHVFEVDENGQRRLRSTE
FT                   VIQEAIPEIVEIGTKVKTVPAVVATQEKPAQNTAVKSEEASKQLPNTGTADANEALIAG
FT                   LASLGLASLALTLRRKREDKD"
FT   gene            473754..474950
FT                   /gene="pgk"
FT                   /locus_tag="SPCG_0477"
FT   CDS_pept        473754..474950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SPCG_0477"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89729"
FT                   /db_xref="GOA:B2IMA2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMA2"
FT                   /protein_id="ACB89729.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEAAI
FT                   NALEDGQVLLVENTRYEDVDGKKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAGTIGVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   gene            475086..475613
FT                   /locus_tag="SPCG_0478"
FT   CDS_pept        475086..475613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89730"
FT                   /db_xref="GOA:B2IMA3"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA3"
FT                   /protein_id="ACB89730.1"
FT                   /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQIG
FT                   ALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPICTM
FT                   LTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETILYVFVRVLETFMGVFVAIIVNYDI
FT                   DRIRLFLEKKEK"
FT   gene            475690..476046
FT                   /gene="glnR"
FT                   /locus_tag="SPCG_0479"
FT   CDS_pept        475690..476046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="SPCG_0479"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89731"
FT                   /db_xref="GOA:B2IMA4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA4"
FT                   /protein_id="ACB89731.1"
FT                   /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYENQELIKPDRNEG
FT                   NRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQ
FT                   QGRFASVQSPFGRG"
FT   gene            476083..477429
FT                   /gene="glnA"
FT                   /locus_tag="SPCG_0480"
FT   CDS_pept        476083..477429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SPCG_0480"
FT                   /product="glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89732"
FT                   /db_xref="GOA:B2IMA5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA5"
FT                   /protein_id="ACB89732.1"
FT                   /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEGEP
FT                   FAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDLAPT
FT                   DLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLVVKTI
FT                   ARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAYHFLGG
FT                   LIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGTRLELRS
FT                   VDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDLPSTLHNA
FT                   LKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
FT   gene            477902..478039
FT                   /locus_tag="SPCG_0481"
FT   CDS_pept        477902..478039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89733"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA6"
FT                   /protein_id="ACB89733.1"
FT                   /translation="MNPDRAEEYFCRGCQGENPEDIEFYDEQLQAEKVEVLNIRLEVKN
FT                   "
FT   gene            478210..479502
FT                   /gene="hsdS"
FT                   /locus_tag="SPCG_0482"
FT   CDS_pept        478210..479502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="SPCG_0482"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89734"
FT                   /db_xref="GOA:B2IMA7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA7"
FT                   /protein_id="ACB89734.1"
FT                   /translation="MRFSTLVEIVRGGSPRPIKDYLTSEVDGINWIKIGDTEKGEKYIN
FT                   NVKEKIKKSGLNKTRFVKKGTFLLTNSMSFGRPYILNVDGAIHDGWLAISNYENSLNKD
FT                   YLFYILSSNVVYSQFLSLISGAVVKNLNSDKVASILIPLPPLSEQQRIIEAIESALEKV
FT                   DEYAESYNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLF
FT                   EEGKIKKKDLDISIVSQGDDNSYYGNIPMNWVVIKIKDIFSINTGLSYKKGDLSINKGV
FT                   RIIRGGNIKPLEFSLLDNDYYIDTQFISSEQVYLKHNQLITPVSTSIEHIGKFARIDKD
FT                   YDGVVAGGFIFQLTPFESSEIISKFLLFNLSSPLFYKQLKAITKLSGQALYNIPKTTLS
FT                   ELLIPLAPFEEQELITQKVEKLFEKVNQLWK"
FT   gene            complement(479450..481000)
FT                   /gene="hsdS"
FT                   /locus_tag="SPCG_0483"
FT   CDS_pept        complement(479450..481000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="SPCG_0483"
FT                   /product="type I restriction-modification system, S
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89735"
FT                   /db_xref="GOA:B2IMA8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA8"
FT                   /protein_id="ACB89735.1"
FT                   /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLIS
FT                   EGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRIKSIYWNFGQNK
FT                   PEKSFRYIDTSSIDRKKNIINYKNLQYLSPEQAPSRARKLVSQNSVLFSTVRPYLKNIA
FT                   VVRELKEYLIASTAFIVLDTLLNETYLKYYLLSDNFINRVNNKSTGTSYPAINDYNFNL
FT                   LLIALPPLSEQQRIVEAIESALEKVDEYAESYNRLEQLDKEFPDKLKKSILQYAMQGKL
FT                   VEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNSYYGNKDETTSYP
FT                   IYEIPEAWRYIKFASLVNFRIGKTPPRSEATFWGTEIPWVSISDMPISGYVTNTRESIS
FT                   KLALKSKKIDISPKGTLLMSFKLSIGKVAILDIPATHNEAIISIFPYANKENIIRDYLM
FT                   IFLPLISTLGDSKDAIKGKTLNSTSISELLIPISNHEEMKRIISKVDLLFQKVSQLFE"
FT   gene            complement(481000..482463)
FT                   /gene="hsdM"
FT                   /locus_tag="SPCG_0484"
FT   CDS_pept        complement(481000..482463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="SPCG_0484"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89736"
FT                   /db_xref="GOA:B2IMA9"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMA9"
FT                   /protein_id="ACB89736.1"
FT                   /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREMV
FT                   WELEEDEYESIIPEELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSIMPI
FT                   RKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQNAGN
FT                   SGEFYTPRAATDFIAEVLNPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTKKYNT
FT                   AVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMNPPFGG
FT                   SELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKTRLKQKL
FT                   VDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKNFSKTKPM
FT                   KSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCDFPKEEEEILNPFEL
FT                   IQNYQAERATLNHKIDNVLADILQLLEDK"
FT   gene            complement(482476..484809)
FT                   /gene="hsdR"
FT                   /locus_tag="SPCG_0485"
FT   CDS_pept        complement(482476..484809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="SPCG_0485"
FT                   /product="type I restriction-modification system, R
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89737"
FT                   /db_xref="GOA:B2IMB0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB0"
FT                   /protein_id="ACB89737.1"
FT                   /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTDG
FT                   RIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDVPF
FT                   VYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYYTDA
FT                   FSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLAKRVL
FT                   FLADRNILVDQTMAEDFKPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGEDGTET
FT                   HYQKFDKDFFDLIVIDEAHRGSAKENSNWRKVIDYFSSATQIGMTATPKETKNASNTEY
FT                   FGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDANGQLIEDRYYGRKD
FT                   FDKTIVIDDRTQRVAKFVSDYMKQNNARFDKTIVFCVDIDHAERMRAALVKENLDLVQE
FT                   DYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRLIVLDSNIQS
FT                   MTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADSDFDGEPVKVLETGAKTVSGST
FT                   PGFVDEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRKNILGSYATLND
FT                   FITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLKLAYGQKELTKTE
FT                   RINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLPEFQIYGGTFKIIN
FT                   TYFGDKKRYLQAIKELEQELFTVA"
FT   gene            complement(485159..485287)
FT                   /locus_tag="SPCG_0486"
FT   CDS_pept        complement(485159..485287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89738"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB1"
FT                   /protein_id="ACB89738.1"
FT                   /translation="MKIKNTFQLKELPPVTNFEQNGSRAKKRSKIGSIRIVKIRLA"
FT   gene            485488..485925
FT                   /locus_tag="SPCG_0487"
FT   CDS_pept        485488..485925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89739"
FT                   /db_xref="GOA:B2IMB2"
FT                   /db_xref="InterPro:IPR021359"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB2"
FT                   /protein_id="ACB89739.1"
FT                   /translation="MHLKGWRYRTSRFGLFYFDQCQPDDVIYRIYDSRFLKKYKHELQD
FT                   FRDRGWELIGAGSCSILRKSSSDLLPEDQVYMSKGLKWEVMQSRLRSCTATFLGGLVVC
FT                   MSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKRKYRVDE"
FT   gene            486056..487123
FT                   /gene="hrcA"
FT                   /locus_tag="SPCG_0488"
FT   CDS_pept        486056..487123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SPCG_0488"
FT                   /product="heat-inducible transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89740"
FT                   /db_xref="GOA:B2IMB3"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB3"
FT                   /protein_id="ACB89740.1"
FT                   /translation="MLIDQTERSDEMVTERQQDILNLIIDIFTKTHEPVGSKALQESIN
FT                   SSSATIRNDMAELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKA
FT                   FDQEFFKLEDILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLD
FT                   ESRTVTSQFLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTD
FT                   NVIDLFEHIFKEMFNENIVMAGKVHLLNFANLAAYQFFDQPQKVALEIREGLREEQMQN
FT                   VRVADGQESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQVNVVNRVLTMKL
FT                   TDFYRYLSSNHYEVH"
FT   gene            487126..487674
FT                   /gene="grpE"
FT                   /locus_tag="SPCG_0489"
FT   CDS_pept        487126..487674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SPCG_0489"
FT                   /product="heat shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89741"
FT                   /db_xref="GOA:B2IMB4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB4"
FT                   /protein_id="ACB89741.1"
FT                   /translation="MKSLKEANMAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANE
FT                   RADEFENKYLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLT
FT                   DDVKKGLGMVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQ
FT                   KGYKLHDRILRPAMVVVYN"
FT   gene            488154..489977
FT                   /gene="dnaK"
FT                   /locus_tag="SPCG_0490"
FT   CDS_pept        488154..489977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SPCG_0490"
FT                   /product="molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89742"
FT                   /db_xref="GOA:B2IMB5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMB5"
FT                   /protein_id="ACB89742.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGLDKTDKEEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKENGIDL
FT                   STDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFDDLTRD
FT                   LVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNEVDQAIFATE
FT                   KTIKETEGKGFDAERDAAQAALDDLKKAQENNNLDDMKAKLEALNEKAQGLAVKLYEQA
FT                   AAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
FT   gene            491122..492258
FT                   /locus_tag="SPCG_0491"
FT   CDS_pept        491122..492258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0491"
FT                   /product="dnaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89743"
FT                   /db_xref="GOA:B2IMB6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB6"
FT                   /protein_id="ACB89743.1"
FT                   /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAEDK
FT                   YKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSFFG
FT                   GGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGTSPV
FT                   TCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAHSVHV
FT                   KIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLNLNFVQ
FT                   AALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVNVVTPTG
FT                   LNDRQKVALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE"
FT   gene            complement(492948..493235)
FT                   /locus_tag="SPCG_0492"
FT   CDS_pept        complement(492948..493235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89744"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB7"
FT                   /protein_id="ACB89744.1"
FT                   /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDVD
FT                   IIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
FT   gene            complement(493245..493655)
FT                   /locus_tag="SPCG_0493"
FT   CDS_pept        complement(493245..493655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0493"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89745"
FT                   /db_xref="GOA:B2IMB8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB8"
FT                   /protein_id="ACB89745.1"
FT                   /translation="MSDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKE
FT                   HYRNLLEMDATSASQLFAQVPKVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHLVP
FT                   RYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
FT   gene            493723..494454
FT                   /locus_tag="SPCG_0494"
FT   CDS_pept        493723..494454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0494"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89746"
FT                   /db_xref="GOA:B2IMB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMB9"
FT                   /protein_id="ACB89746.1"
FT                   /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTIN
FT                   EIIGLLAPYSGSININGLTLQGDATSYRKQIGYIPETPSLYEELTLREHIETVAMAYGI
FT                   EQKVAFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPFLGL
FT                   DPLAISDLIQLLEVEKQKGKSILMSTHVLDSAEKMCDAFVILHKGEVRSKGNLLQLREA
FT                   FDMPEASLNDIYLALTKEEDL"
FT   gene            494451..495500
FT                   /locus_tag="SPCG_0495"
FT   CDS_pept        494451..495500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0495"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89747"
FT                   /db_xref="GOA:B2IMC0"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC0"
FT                   /protein_id="ACB89747.1"
FT                   /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYSQ
FT                   LLQHFPENHWPILLFVGITSVLLLLWGGTATYMEAPDKLFLLVGEEEIKLHLKRQTGIS
FT                   LVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFCQKASKFFTETGLDW
FT                   DYVISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNLYLRS
FT                   YLRNGDLFALSLRLLLLSLLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFDYQYLT
FT                   QLFPLDKGQKEKGLQEVVRGLTSFVLLVELVVGLITFQEKLALLALLGAGLVLLVLYLP
FT                   YQVKRQMQD"
FT   gene            complement(495668..495997)
FT                   /gene="blpT"
FT                   /locus_tag="SPCG_0496"
FT   CDS_pept        complement(495668..495997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpT"
FT                   /locus_tag="SPCG_0496"
FT                   /product="blpT protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89748"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC1"
FT                   /protein_id="ACB89748.1"
FT                   /translation="MTDTDPIKRAHTLITDLNKAYQACKQASADDVRFQEQLNSILGFL
FT                   AKAETVDNRFLIELEKFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLILNE
FT                   NQRAN"
FT   gene            496274..496612
FT                   /gene="blpS"
FT                   /locus_tag="SPCG_0497"
FT   CDS_pept        496274..496612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpS"
FT                   /locus_tag="SPCG_0497"
FT                   /product="blpS protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89749"
FT                   /db_xref="GOA:B2IMC2"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC2"
FT                   /protein_id="ACB89749.1"
FT                   /translation="MKHMIIQTQKTVYKVNVDDIYYIQTHPTKAHTVQIVTEEASFNML
FT                   QNLSNLENQCGETLMRCHRNCLVNLDKLKSIDFQERILFLGEEGQYAVKYARRRYREIR
FT                   QKWLKQGE"
FT   gene            496617..497354
FT                   /locus_tag="SPCG_0498"
FT   CDS_pept        496617..497354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0498"
FT                   /product="response regulator BlpR"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89750"
FT                   /db_xref="GOA:B2IMC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC3"
FT                   /protein_id="ACB89750.1"
FT                   /translation="MRIFVLEDDFSQQTRIETTIEKLLKEHHITPSSFEVFGKPDQLLA
FT                   EVHEKGAHQLFFLDIEIRNEEMKGLEVARKIREQDPYALIVFVTTHSEFMPLSFRYQVS
FT                   ALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYYLET
FT                   STRPHRVILYTKTDRLEFTASLEEVLKQEPRLLQCHRSFLINPANVVHLDKKEKLLFFP
FT                   NGGSCLIARYKVREVSEAINNLH"
FT   gene            497368..498708
FT                   /locus_tag="SPCG_0499"
FT   CDS_pept        497368..498708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0499"
FT                   /product="sensor histidine kinase BlpH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89751"
FT                   /db_xref="GOA:B2IMC4"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC4"
FT                   /protein_id="ACB89751.1"
FT                   /translation="MNVAWILLYTLVTHGLKIVIFFKVDGISLTFERIFKAFLFKILLA
FT                   VVFVMISYIVGNVYLSYFMEPLYGIGLSFLLLRGLPKKLLFFYGLFPMILVNLFYRGVS
FT                   YFVLPFLGQGQVYDGYSFTGLCIIIFNFFISLAFLKWLDYDFTSLRREILDTGFQKSLT
FT                   KINWIMGAYYLVIQSLSYFEYEQGIQSTTVRHLILVFYLLFFMGVIKKLDTYLKDKLHD
FT                   RLDQEQVLRYRDIERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIKEVYDL
FT                   VLKDSSKKLQDNKYDLGRLVNVRDRALKSLLAGKFIKAREKDIVFNVEVPEEIQVEGMR
FT                   LLDFLTIVSILCDNAIEASAEAGQPHVSIAFLKSGAQETFIIENSIKEEGIDISEIFSF
FT                   GVSSKGEERGVGLYTVMKIVESYPNASLNTTCQDQVFRQVLTMIPTE"
FT   gene            complement(498965..500326)
FT                   /locus_tag="SPCG_0500"
FT   CDS_pept        complement(498965..500326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0500"
FT                   /product="blpC ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89752"
FT                   /db_xref="GOA:B2IMC5"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC5"
FT                   /protein_id="ACB89752.1"
FT                   /translation="MNPNLFRSVEFYQRRYHNYATVLIIPLSLLFTFILIFSLVATKEI
FT                   TVTSQGEITPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIKYSETMEESQKTALET
FT                   QLQRLEKQKEGLGILKQSLEKATDLFSSEDEFGYHNTFMNFTKQSHDIELGISKTNTEV
FT                   SNQANLTNSSSSAIEQEITKVQQQIGEYQELRDTIVNKRARLPTGNPHQSILNRYLIAS
FT                   QEQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLATKIEVLRTQFL
FT                   QTASQQQLTVENQLTELKVQLDQATQRLGNNTLTAPSKGIVHLNSEFEGKNRIPTGTEI
FT                   AQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQSIDQTPT
FT                   RTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTAKKTYFDYFKDKILTHSD"
FT   gene            complement(500337..502496)
FT                   /locus_tag="SPCG_0501"
FT   CDS_pept        complement(500337..502496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0501"
FT                   /product="competence factor transporting
FT                   ATP-binding/permease protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89753"
FT                   /db_xref="GOA:B2IMC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC6"
FT                   /protein_id="ACB89753.1"
FT                   /translation="MPMTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAK
FT                   TNKEGTTALGIVKAADEMGFETRPVQADKTLFDMSDVPYPFIVHVNKEGKLQHYYVVYQ
FT                   TKKDYLIIGDPDPSVKITKMSKERFFSEWTGVAIFLAPKPSYQPHKDKKNGLLSFLPLI
FT                   FKQKSLIAYIVLSSLLVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYILQQ
FT                   VMSFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSIIDAL
FT                   ASTILSLFLDVSILILVGGVLLAQNPNLFLLSLLSIPIYMFIIFSFMKPFEKMNHDVMQ
FT                   SNSMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQTSLKQG
FT                   TKLVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQSAKVANN
FT                   RLNEVYLVESEFQAPENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIKQGDKVSL
FT                   VGVSGSGKTTLAKMIVNFFEPYKGHISINHQDIKNIDKKVLRRHINYLPQQAYIFNGSI
FT                   LENLTLGGNHMISQEDILKACELAEIRQDIERMPMGYQTQLSDGAGLSGGQKQRIALAR
FT                   ALLTKAPVLILDEATSGLDVLTEKKVIDNLISLTDKTILFVAHRLSIAERTNRVIVLDQ
FT                   GKIIEVGSHQELMQAQGFYHHLFNK"
FT   gene            502771..503001
FT                   /gene="blpU"
FT                   /locus_tag="SPCG_0502"
FT   CDS_pept        502771..503001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpU"
FT                   /locus_tag="SPCG_0502"
FT                   /product="bacteriocin BlpU"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89754"
FT                   /db_xref="GOA:B2IMC7"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC7"
FT                   /protein_id="ACB89754.1"
FT                   /translation="MNTKMMSQFSVMDNEMLARVEGGGCNWGDFAKAGVGGGAARGLQL
FT                   GIKTGTWQGAATGAAGGAILGGVAYAATCWW"
FT   gene            503581..503985
FT                   /gene="blpL"
FT                   /locus_tag="SPCG_0503"
FT   CDS_pept        503581..503985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpL"
FT                   /locus_tag="SPCG_0503"
FT                   /product="immunity protein BlpL"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89755"
FT                   /db_xref="GOA:B2IMC8"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC8"
FT                   /protein_id="ACB89755.1"
FT                   /translation="MKTFLAKKRNIFLARLFLGQLPLLVSTYLFLSRQFLNFSVVFQFL
FT                   LVVINLASILVTVYLTREMRIREFEDDDLVSPRTNQLMFIGLTGFMSIICLYRGITAGE
FT                   SYQQLIAYIGAVLCLIIMLLLMWGLKYYKK"
FT   gene            504183..504371
FT                   /locus_tag="SPCG_0504"
FT   CDS_pept        504183..504371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0504"
FT                   /product="IS1381 transposase protein A, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89756"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMC9"
FT                   /protein_id="ACB89756.1"
FT                   /translation="MNYEASKQLTDARFKRLVGVQRTTFEEMLAVLKTAYQLKHAKGGR
FT                   KPKLSLEDLLMATLQYV"
FT   gene            504599..504988
FT                   /locus_tag="SPCG_0505"
FT   CDS_pept        504599..504988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0505"
FT                   /product="IS1381 transposase protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89757"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD0"
FT                   /protein_id="ACB89757.1"
FT                   /translation="MKAQAIVTSQGRIVSLDITVNYCHDMKLFKMSRRNIGQAGKILAD
FT                   SGYQGLMKIYPQAQTPRKSSKLKPLTVEDKACNHALSKERSKVENIFAKVKTFKMFSTT
FT                   YRNHRKRFGLRMNLIAGIINHELGF"
FT   gene            505190..505444
FT                   /gene="blpM"
FT                   /locus_tag="SPCG_0506"
FT   CDS_pept        505190..505444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpM"
FT                   /locus_tag="SPCG_0506"
FT                   /product="bacteriocin BlpM"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89758"
FT                   /db_xref="GOA:B2IMD1"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD1"
FT                   /protein_id="ACB89758.1"
FT                   /translation="MDTKIMEQFHEMDITMLSSIEGGKNNWQTNVLEGGGAAFGGWGLG
FT                   TAICAASGVGAPFMGACGYIGAKFGVDLWAGVTGATGGF"
FT   gene            505460..505663
FT                   /gene="blpN"
FT                   /locus_tag="SPCG_0507"
FT   CDS_pept        505460..505663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpN"
FT                   /locus_tag="SPCG_0507"
FT                   /product="blpN protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89759"
FT                   /db_xref="GOA:B2IMD2"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD2"
FT                   /protein_id="ACB89759.1"
FT                   /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGGVKYGRLLGPW
FT                   GAAIGGIGGAVVCGYLAYTATS"
FT   gene            505895..506056
FT                   /gene="blpO"
FT                   /locus_tag="SPCG_0508"
FT   CDS_pept        505895..506056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpO"
FT                   /locus_tag="SPCG_0508"
FT                   /product="bacteriocin BlpO"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89760"
FT                   /db_xref="GOA:B2IMD3"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD3"
FT                   /protein_id="ACB89760.1"
FT                   /translation="MIYYMDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGA
FT                   IDGCATTV"
FT   gene            507050..507448
FT                   /gene="blpX"
FT                   /locus_tag="SPCG_0509"
FT   CDS_pept        507050..507448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpX"
FT                   /locus_tag="SPCG_0509"
FT                   /product="immunity protein BlpX"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89761"
FT                   /db_xref="GOA:B2IMD4"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD4"
FT                   /protein_id="ACB89761.1"
FT                   /translation="MEVFNMKYRLFFVIFLSSVLDILLGTFLQISIVSIGWLVFYSGLF
FT                   EAGVFLLANKGVAVKIKEVDIRNRFKFIFGKTLWFQILLLIFLIIKLYLGLDARLILFY
FT                   GHIFIVFNALMYLLSSSQVSLKKNKLSS"
FT   gene            507500..508189
FT                   /gene="blpY"
FT                   /locus_tag="SPCG_0510"
FT   CDS_pept        507500..508189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpY"
FT                   /locus_tag="SPCG_0510"
FT                   /product="immunity protein BlpY"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89762"
FT                   /db_xref="GOA:B2IMD5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD5"
FT                   /protein_id="ACB89762.1"
FT                   /translation="MKKYQLLFKTSAILSYLFFVFGLSQLTLIVQNYWQFSSQIGNLFW
FT                   IQNILSLLFIGVMIVVLVKTGHGYLFRIPRKKWLWYSILTVLVVVFQISFNVQTAKHVQ
FT                   STAEGWAVLIGYSGTNFAELGIYIALFFLVPLMEELIYRGLLQHAFFKHSRFGLDLLLP
FT                   SILFALPHFSSLPSLLDIFVFATVGIIFAGLTRYTKSIYPSYAVHVINNIVATFPFLLT
FT                   FLHRVLG"
FT   gene            508231..508464
FT                   /gene="blpZ"
FT                   /locus_tag="SPCG_0511"
FT   CDS_pept        508231..508464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpZ"
FT                   /locus_tag="SPCG_0511"
FT                   /product="blpZ protein, fusion"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89763"
FT                   /db_xref="GOA:B2IMD6"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD6"
FT                   /protein_id="ACB89763.1"
FT                   /translation="MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFNF
FT                   LNSMLALMAIFIGAGYVVGFWLLILNENQRAN"
FT   gene            508615..509226
FT                   /locus_tag="SPCG_0512"
FT   CDS_pept        508615..509226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89764"
FT                   /db_xref="GOA:B2IMD7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD7"
FT                   /protein_id="ACB89764.1"
FT                   /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGGFFQNESALILVSLL
FT                   VTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAE
FT                   VSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPS
FT                   FIFYLLGGLLLGFAYKKSQNLWVSTLVHMLYNSWPLLYYL"
FT   gene            509387..510181
FT                   /locus_tag="SPCG_0513"
FT   CDS_pept        509387..510181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89765"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMD8"
FT                   /protein_id="ACB89765.1"
FT                   /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGLA
FT                   REQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQLS
FT                   RLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDVRHS
FT                   NWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTVLSKL
FT                   YWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
FT   gene            510178..510813
FT                   /locus_tag="SPCG_0514"
FT   CDS_pept        510178..510813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0514"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89766"
FT                   /db_xref="GOA:B2IMD9"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMD9"
FT                   /protein_id="ACB89766.1"
FT                   /translation="MRVRNRKGATELLEANPQYVVLNFLEAKAKWRDLFGNDNPIHVEV
FT                   GSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEAGVSNIKLLWVDGSDLTDYF
FT                   EDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSL
FT                   VSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
FT   gene            510868..511419
FT                   /locus_tag="SPCG_0515"
FT   CDS_pept        510868..511419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89767"
FT                   /db_xref="GOA:B2IME0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IME0"
FT                   /protein_id="ACB89767.1"
FT                   /translation="MCYTKGKNMRKRGGEISSPLAYEEVDAIATIVELVREVVEPVIEA
FT                   PFELVDIEYGKIGSDMILSIFVDKPEGITLNDTADLTEMISPVLDTIKPDPFPEQYFLE
FT                   ITSPGLERPLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTR
FT                   KKTVQIPYSLVSKARLAVKL"
FT   gene            511463..512599
FT                   /gene="nusA"
FT                   /locus_tag="SPCG_0516"
FT   CDS_pept        511463..512599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SPCG_0516"
FT                   /product="transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89768"
FT                   /db_xref="GOA:B2IME1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME1"
FT                   /protein_id="ACB89768.1"
FT                   /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSV
FT                   AIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGR
FT                   VAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSK
FT                   QDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEI
FT                   MSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIE
FT                   ENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPDNKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
FT   gene            512621..512914
FT                   /locus_tag="SPCG_0517"
FT   CDS_pept        512621..512914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89769"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME2"
FT                   /protein_id="ACB89769.1"
FT                   /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGR
FT                   GAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
FT   gene            512907..513206
FT                   /locus_tag="SPCG_0518"
FT   CDS_pept        512907..513206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89770"
FT                   /db_xref="GOA:B2IME3"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME3"
FT                   /protein_id="ACB89770.1"
FT                   /translation="MNKQKISNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDAG
FT                   PNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
FT   gene            513223..516015
FT                   /gene="infB"
FT                   /locus_tag="SPCG_0519"
FT   CDS_pept        513223..516015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SPCG_0519"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89771"
FT                   /db_xref="GOA:B2IME4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IME4"
FT                   /protein_id="ACB89771.1"
FT                   /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAAK
FT                   IAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVAAK
FT                   PQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNRRFN
FT                   DQAKKQQGQQKRRNERRQQEDKRSNQVAPRIDFKARAAALKAEQNAEYARSSEERFKQY
FT                   QAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKKQARPD
FT                   KNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTPKPVTER
FT                   KFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGETIELLMVD
FT                   YGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTLLDTLRNSR
FT                   VATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDITILVVAADDG
FT                   VMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTAWGGDSEFVEI
FT                   SAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAVATLLVQQGTLN
FT                   VQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGDHFAVYEDEKSAR
FT                   AAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADVQGSVEALSASLQK
FT                   IDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQARQQAEADDVEIRLHS
FT                   IIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIGGFMVINGKVARDSKV
FT                   RVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDIKMDDVIEAYVMEEIKR
FT                   "
FT   gene            516239..516616
FT                   /gene="rbfA"
FT                   /locus_tag="SPCG_0520"
FT   CDS_pept        516239..516616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SPCG_0520"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89772"
FT                   /db_xref="GOA:B2IME5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME5"
FT                   /protein_id="ACB89772.1"
FT                   /translation="MVQSRERNIMANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTI
FT                   TDVQMLGDLSVAKVYYTILSNLASDNQKVQIGLEKATGTIKRELGRNLKLYKIPDLTFV
FT                   KDESIEYGNKIDEMLRNLDKN"
FT   gene            516859..517674
FT                   /locus_tag="SPCG_0521"
FT   CDS_pept        516859..517674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89773"
FT                   /db_xref="GOA:B2IME6"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME6"
FT                   /protein_id="ACB89773.1"
FT                   /translation="MIRCKKEIRSLYMAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFS
FT                   KELGPQDIPTLLEQGPTSLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITI
FT                   PADVAQFYGFSLKLAQELGYIYGYEDLWASRDELSEDAQNTLLLYLGVMLGVNGTAALL
FT                   RAGGITIAKQVMKTVPNKALTKTLWYPILKKVLRIFGVNLTKGGLAKGMGKFIPILGGI
FT                   ISGGLTFATMKPMGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE"
FT   gene            complement(518045..518278)
FT                   /locus_tag="SPCG_0522"
FT   CDS_pept        complement(518045..518278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89774"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME7"
FT                   /protein_id="ACB89774.1"
FT                   /translation="MKIKEQTRKLAADCSKQCFEVVDRTDEVSSKHRFEVVDRTDEVSN
FT                   HTYSKVKLTWFEEIFEEYKMILLLILYHMERD"
FT   gene            518297..518542
FT                   /locus_tag="SPCG_0523"
FT   CDS_pept        518297..518542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89775"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME8"
FT                   /protein_id="ACB89775.1"
FT                   /translation="MEVVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNT
FT                   VGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
FT   gene            518542..519876
FT                   /locus_tag="SPCG_0524"
FT   CDS_pept        518542..519876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89776"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2IME9"
FT                   /protein_id="ACB89776.1"
FT                   /translation="MADERIHVLRDILLELHNGASPESVQERFDATFAGVSAIEISLME
FT                   HELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVSDTEHPGHPVRVFKEENLALRAAL
FT                   IRIRRLLDTYEYMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGHDSP
FT                   PKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESILLMIL
FT                   LESFTQDDWLQIAEESDAYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEGQVQQV
FT                   IDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFVNKDDIF
FT                   QYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKTIMKGLREGSKDKYEMWFKSE
FT                   SRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
FT   gene            519886..520140
FT                   /locus_tag="SPCG_0525"
FT   CDS_pept        519886..520140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89777"
FT                   /db_xref="InterPro:IPR015026"
FT                   /db_xref="InterPro:IPR038024"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF0"
FT                   /protein_id="ACB89777.1"
FT                   /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDAM
FT                   IRYESRLDAYQFLLGKFENFKAGKGFHDLPEGLFGERNY"
FT   gene            520236..520631
FT                   /locus_tag="SPCG_0526"
FT   CDS_pept        520236..520631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89778"
FT                   /db_xref="GOA:B2IMF1"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF1"
FT                   /protein_id="ACB89778.1"
FT                   /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKRAEQPASA
FT                   AGKAVSKKVEQAVEATKEQAQKVANSVEDFAANLGGLPLDRAKTFYDEGIKSASDFKNW
FT                   TEKELLALKGIGPATIKKLKENGIKFK"
FT   gene            521004..521438
FT                   /locus_tag="SPCG_0527"
FT   CDS_pept        521004..521438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89779"
FT                   /db_xref="GOA:B2IMF2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF2"
FT                   /protein_id="ACB89779.1"
FT                   /translation="MTCSSSYSLGDWVVIGVVARENAAEQIKQYQKFTVNISDETSMLA
FT                   MEQAGFISHQEKLERLGVHYEISERTQTPILDACPLVLDYRVDRIVEEDGICHIFAKIL
FT                   ERLVAPELLDEKGHFKNQLFAQPISWEMDISAFIAIWTSV"
FT   gene            521272..521841
FT                   /locus_tag="SPCG_0528"
FT   CDS_pept        521272..521841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89780"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF3"
FT                   /protein_id="ACB89780.1"
FT                   /translation="MLRKTVFATSLPRFLSDLLPQNSWMKRDILKINCLPNLFHGRWIS
FT                   ARLSLSGQACRYEGQFHQKSEEEGWQELSCQIKSKQNVSFYESVLWRMLRISLTMLVCQ
FT                   RSPIQQVFLQSRPWKMRFIIWSTFFRSVIKRKISQQATGLSSKERIRSLALSISTIAMK
FT                   MMCWKSAIPYTQTIGGEVMCQKLRVP"
FT   gene            521478..522038
FT                   /locus_tag="SPCG_0529"
FT   CDS_pept        521478..522038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0529"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89781"
FT                   /db_xref="GOA:B2IMF4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF4"
FT                   /protein_id="ACB89781.1"
FT                   /translation="MARTELPDKIETERLVLRVRTVADAEDIFDYASLPEVAYPAGFPP
FT                   VKTLEDEIYYLEYIFPERNQKENLPAGYGIVVKGTDKIVGSVDFNHRHEDDVLEIGYTL
FT                   HPDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSKRVAEKLDFTLEARIRDR
FT                   KDAQGNCCDDLRYALLKSEWEVI"
FT   gene            522023..522616
FT                   /locus_tag="SPCG_0530"
FT   CDS_pept        522023..522616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89782"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF5"
FT                   /protein_id="ACB89782.1"
FT                   /translation="MGGDLMHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALE
FT                   IYQDYTEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYHLIYLKQIQSLLDDYH
FT                   QEILFVELETSLEECIRRNRTENRLKYKPLKRHIEVSEREIIETAETLQLNSQYQPNEL
FT                   HHYFKINNTNLSAEEAAKQIQNKINKIEKGHTHV"
FT   gene            522609..525260
FT                   /gene="valS"
FT                   /locus_tag="SPCG_0531"
FT   CDS_pept        522609..525260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SPCG_0531"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89783"
FT                   /db_xref="GOA:B2IMF6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF6"
FT                   /protein_id="ACB89783.1"
FT                   /translation="MSKELSSKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPP
FT                   PNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGIS
FT                   RYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDL
FT                   YKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPE
FT                   TMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDP
FT                   NDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVIAKLEEIGALVKIEKRV
FT                   HSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMEN
FT                   VHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTM
FT                   GWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQ
FT                   GRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWN
FT                   ISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGV
FT                   AGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVT
FT                   EEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPIT
FT                   ILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDL
FT                   LNVEEELARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDAT
FT                   VARIDEMKKLVK"
FT   gene            525341..525505
FT                   /locus_tag="SPCG_0532"
FT   CDS_pept        525341..525505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0532"
FT                   /product="type II DNA modification methyltransferase,
FT                   truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89784"
FT                   /db_xref="GOA:B2IMF7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF7"
FT                   /protein_id="ACB89784.1"
FT                   /translation="MGKIVAIDLFNGAGGTTSGLKKSGIDVQVAVEIDSVAVKTYKLNN
FT                   PEVSVIDME"
FT   gene            complement(525453..525548)
FT                   /locus_tag="SPCG_0533"
FT   CDS_pept        complement(525453..525548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF9"
FT                   /protein_id="ACB89785.1"
FT                   /translation="MAGEPYKACKIEVLFTPYLLQTPQDYLTYKF"
FT   gene            525556..527160
FT                   /locus_tag="SPCG_0534"
FT   CDS_pept        525556..527160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89786"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMG0"
FT                   /protein_id="ACB89786.1"
FT                   /translation="MSEYWFSTNVDQIDEVDGKQCLIYSYYNVKASRNVEVLKGRSGTK
FT                   KGLDYWEPYAPQKQYEMERLPKNKYIGSSSTDRWDGIEKNVVFCDCKEYVSAFDLFFYH
FT                   YNFKKISTQRSKQDFIRLRSKPVADILKNNTSSYTRYKKEMVIDNVKVDDKVCEIISEI
FT                   MDESYTDIQILTHKLYSKGDDIKASKTIWMKKSGKEYSEAFAGTGEARIILLVNDIVNA
FT                   QSNSLILIDEPEISLHPSAIYKFKEFLLQECLNKKHQIIITTHSTQLIKDFLREAVKLL
FT                   VKNGEKVDVIENIDYQDAFFELGDVYHSRKMIYVEDRLAKYILEFVITHSGSENLKQNL
FT                   VVRYIPGGANQIICNNILNSSYLDSDNHYFWLDGDQNTNVSESNNLMNYLENGVVISDK
FT                   IPESDNKNLDDIIKLITGCPIKFNVSGNKGQKNNIELIAKQRSFIDYWAKYVSYLPFPT
FT                   PEFFLANLCNSVDREGYDFSKDGNGKEYFRKKTQVALGIENITSEDIFQEQRRAVSKIQ
FT                   PESSMFQCIKEKLEALF"
FT   gene            527540..528343
FT                   /locus_tag="SPCG_0535"
FT   CDS_pept        527540..528343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0535"
FT                   /product="cell filamentation protein Fic-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89787"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMG1"
FT                   /protein_id="ACB89787.1"
FT                   /translation="MQPTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAEK
FT                   QSRGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHKEL
FT                   FQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYATLT
FT                   QADVVKQIQHFISGIWQIHPFREGNTRTVTVFLIQYLREFGFDIDNTPFQQHSKYFRDA
FT                   LVLDNAKILQRRPEFLTAFFENLLLGGQNDLSSEKMYLDLDLDFS"
FT   gene            complement(528459..529040)
FT                   /locus_tag="SPCG_0536"
FT   CDS_pept        complement(528459..529040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0536"
FT                   /product="IS3-Spn1 transposase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89788"
FT                   /db_xref="GOA:B2IMF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMF8"
FT                   /protein_id="ACB89788.1"
FT                   /translation="MRQKRKYSSHKGDVGKKAENLIQGQFEGSKTMEQCYTDVTEFAIP
FT                   ASTQKLYLSPVLDGFNSEIIAYNLSTSPNLEQVQTMLEQAFTEKHYENTILHSDQGWQY
FT                   RHDSYHRFLESKGVQASMSRKGNSQDNGMMESFFGILKSEMFYGYEKSFQSLKQLEQAI
FT                   VDYIDYYNNKRIKVKLKGLSPVQYRTKSFG"
FT   gene            complement(529517..529729)
FT                   /locus_tag="SPCG_0537"
FT   CDS_pept        complement(529517..529729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0537"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89789"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP3"
FT                   /protein_id="ACB89789.1"
FT                   /translation="MKLTYDDKVQIYELRKQGYILEKLSNKFGINNSNLRYMIKLIDRY
FT                   GIEFVKKGKNRYYSPDLKQEMIHKV"
FT   gene            530200..531348
FT                   /locus_tag="SPCG_0538"
FT   CDS_pept        530200..531348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89790"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP4"
FT                   /protein_id="ACB89790.1"
FT                   /translation="MMERSRFEEMFQLQSSHLTTQEKLQLFTSVFAGRYDVYAKNFINE
FT                   QGKIQYFPSYDYGWKQLPPEKRSFQTLTNSVLKSHFRGEAAIGIFPMHLDDSCYFLVLD
FT                   LDEGDWKEAGLTIRRIARERQMEAHLEISRSGYGLHIWFFFEEAILSRKARLFGKKLLE
FT                   LAMQESMQLSFDSFDRMFPNQDVLPKGGFGNLISFPFQGEAYHQGRTVFVDEHFQPYGD
FT                   QWRYLQGIQKISTAKVALLIQEELGKQELDKELKVVLSNMIQLKKSSVTPKTLFFLKNM
FT                   ASFSNPEFYLKQAMRQPTYQIPERMYLFGESDYYLWLPRGLLYPLQDKFKQVVVEDRRK
FT                   VQRSIRVAFKGELTLEQELALSDMNSKENGLLHAGQVLERAF"
FT   gene            531444..531539
FT                   /locus_tag="SPCG_0539"
FT   CDS_pept        531444..531539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89791"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP5"
FT                   /protein_id="ACB89791.1"
FT                   /translation="MTFEEAEATRYTPSGRERVIGYVGQYGGAKK"
FT   gene            531564..532106
FT                   /locus_tag="SPCG_0540"
FT   CDS_pept        531564..532106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89792"
FT                   /db_xref="GOA:B2IMP6"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP6"
FT                   /protein_id="ACB89792.1"
FT                   /translation="MIQSLFKLENSQSLLDEYEMMIVDECHHISALMFEKVVAQFRGKY
FT                   LYGLTATPERKNGHEPIVFQRIGEILHTADKRETDFKRQLQLRFTSFGHLEIEKTKASN
FT                   FIQLSDWIATDSARNQLILKDILAQVAEGRNILVLVNRIQQIDVFEKLLKEKEVDDCYI
FT                   ISGKTNVRERERVYWRR"
FT   gene            532130..532762
FT                   /locus_tag="SPCG_0541"
FT   CDS_pept        532130..532762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89793"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP7"
FT                   /protein_id="ACB89793.1"
FT                   /translation="MLFTGKYIGEGFDLPQLDTLILAAPFSWKNNLIQYAGRIHRNYKD
FT                   KSLVRIFDYVDIHVPYLEKMFQKRQVAYRKMDYRAIEGEEKQFVYVDSRYEKVLREDLA
FT                   GERQECMLILPYVHQTKLMNFLKEFRISQIEICIPETVANKAWLDQLKSQKIKVSFTQS
FT                   KIVTPILLVNKTIVWYGAMPLLGKVDEMTILRLESASIVSELVAGLR"
FT   gene            533062..533901
FT                   /gene="licT"
FT                   /locus_tag="SPCG_0542"
FT   CDS_pept        533062..533901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="SPCG_0542"
FT                   /product="transcription antiterminator Lict"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89794"
FT                   /db_xref="GOA:B2IMP8"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP8"
FT                   /protein_id="ACB89794.1"
FT                   /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDIE
FT                   KSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHISSS
FT                   IERYKEGIIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHFVNA
FT                   NLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVENTTYC
FT                   DDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTKNLD"
FT   gene            533919..535757
FT                   /locus_tag="SPCG_0543"
FT   CDS_pept        533919..535757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0543"
FT                   /product="PTS system, beta-glucosides-specific IIABC
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89795"
FT                   /db_xref="GOA:B2IMP9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMP9"
FT                   /protein_id="ACB89795.1"
FT                   /translation="MSYKDKVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDDV
FT                   KKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVVQGHKGNILERIIEYIA
FT                   GSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAYSAS
FT                   QKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGVPVTPASYGSSVVPILIMVWLMK
FT                   YIEKMIAKLTPAVTKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMYGVAGW
FT                   LTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVALK
FT                   SKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFAGLTSVKA
FT                   YLFAVPSLIALPQFIYSDAPSNIVNALIVAVISVVITFVLAYIFGIDEEESSSNLEVEA
FT                   GVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFDGKITNIFPT
FT                   KHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEMDLNLIKTKGY
FT                   ETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLVIL"
FT   gene            535770..537185
FT                   /locus_tag="SPCG_0544"
FT   CDS_pept        535770..537185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0544"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89796"
FT                   /db_xref="GOA:B2IMQ0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ0"
FT                   /protein_id="ACB89796.1"
FT                   /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEAT
FT                   ENPTEDNLKLLGIDFYHKYKEDITLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKY
FT                   YDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKV
FT                   KYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEF
FT                   KVGCMVLAMPAYPMTPNPKDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIE
FT                   FAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQI
FT                   DPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQV
FT                   AEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWY
FT                   KGVIESNGESLFK"
FT   gene            537695..538822
FT                   /gene="pheS"
FT                   /locus_tag="SPCG_0545"
FT   CDS_pept        537695..538822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="SPCG_0545"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89797"
FT                   /db_xref="GOA:B2IMQ1"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ1"
FT                   /protein_id="ACB89797.1"
FT                   /translation="MVPRVNAPSGVFGMWFSFYLRETDGGNMSTIEEQLKALREETLTS
FT                   LKQITAGNEKEMQDLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAF
FT                   EETAKLLEEKKVAAQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDG
FT                   FEVEQDYYNFERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLK
FT                   MISPGRVFRRDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLR
FT                   PSYFPFTEPSVEVDVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSG
FT                   FAFGLGQERVAMLRYGINDIRGFYQGDVRFSEQFK"
FT   gene            538822..539331
FT                   /locus_tag="SPCG_0546"
FT   CDS_pept        538822..539331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0546"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89798"
FT                   /db_xref="GOA:B2IMQ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ2"
FT                   /protein_id="ACB89798.1"
FT                   /translation="MIRKVEMADVEVLAKIAKQTFRETFAYDNTEEQLQEYFEEAYSLK
FT                   TLSTELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGL
FT                   GKQLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWL
FT                   LRKKLR"
FT   gene            539408..541813
FT                   /gene="pheT"
FT                   /locus_tag="SPCG_0547"
FT   CDS_pept        539408..541813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="SPCG_0547"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89799"
FT                   /db_xref="GOA:B2IMQ3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ3"
FT                   /protein_id="ACB89799.1"
FT                   /translation="MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVESVESPAADLSKI
FT                   VVGEVLSCEDVPETHLHVCQVNVGEEEARQIVCGAPNVRAGIKVMVALPGARIADNYKI
FT                   KKGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPENAVPGEEVFSYLDLDDEII
FT                   ELSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETNEAAADALSVSIETDKAPYY
FT                   AARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDTFEGTD
FT                   IRVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKSSRVVLE
FT                   AAVFNGKTIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGATVRKGIV
FT                   SAGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFTVRVPRRRW
FT                   DITIEADLFEEIARIYGYDLLPTSLPKDDGTAGELTATQKLRRQVRTIAEGAGLTEIIT
FT                   YALTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNVARKNKNLALY
FT                   EIGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYAKGILEALFTRL
FT                   GLQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIPETYVAELNLSAI
FT                   EGALQPAVPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVKRLTDIKLFDVFSG
FT                   EKLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNAEVR"
FT   gene            complement(541881..542882)
FT                   /locus_tag="SPCG_0548"
FT   CDS_pept        complement(541881..542882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89800"
FT                   /db_xref="GOA:B2IMQ4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ4"
FT                   /protein_id="ACB89800.1"
FT                   /translation="MIKTFLSALSVILFSIPIITYSFFPSSNLNIWLSTQPILAQIYAF
FT                   PLATATMAAILSFLFFFLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSASNKTKT
FT                   LKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGLSMA
FT                   NYDIFTSPPTNSGIAPVTVIVKKSYGFYTEAETFHTTRFGTIVLHSRKQDIPDIIALHT
FT                   APPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRDALNALPP
FT                   FERGTWNSQSPKLFNATIDHILLPKNHYYVKDLDIVSFQNSDHRCIFTEITF"
FT   gene            543038..543532
FT                   /locus_tag="SPCG_0549"
FT   CDS_pept        543038..543532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0549"
FT                   /product="IS1239 transposase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89801"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ5"
FT                   /protein_id="ACB89801.1"
FT                   /translation="MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREIASLLGKAPQTIH
FT                   TEIKYGTVRKCLGKGRFKEVYSADYAQQSYENNRKHSVKRSSLTKELKEKILHYHNQKF
FT                   LPEMMVMAKGVNVGISTIYYWIHHGKLGLSKQDLLYPRKGKSVKKQVSPNFKPADQSIE
FT                   S"
FT   gene            543611..543877
FT                   /locus_tag="SPCG_0550"
FT   CDS_pept        543611..543877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0550"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89802"
FT                   /db_xref="GOA:B2IMQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ6"
FT                   /protein_id="ACB89802.1"
FT                   /translation="MEGCLSELFSKEEILESDMRVAIMSELIEARNKQGISQKKLEEVS
FT                   GVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLEQGKS"
FT   gene            543958..546387
FT                   /gene="metE"
FT                   /locus_tag="SPCG_0551"
FT   CDS_pept        543958..546387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="SPCG_0551"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89803"
FT                   /db_xref="GOA:B2IMQ7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ7"
FT                   /protein_id="ACB89803.1"
FT                   /translation="MEYSCKVRITKDLRRLLQVFFFCPKQIYSFKLYQTLIFYNYTDAF
FT                   FSVKIVSTTNFGGHIMSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAK
FT                   HWNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQGE
FT                   KGDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVGPF
FT                   TFLQLSDFEEGVKADDFVDSLVAAYQEVFAKLAELGATRIQLDEAALVKDLTAEEKALF
FT                   LNLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVKGGFP
FT                   ADKTLYVGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEEFEPAL
FT                   LNHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIADLTDADY
FT                   TRLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKEYDAFLAE
FT                   TIDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGMRGVKPPII
FT                   WGDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKDSTLQIALAI
FT                   KDEVLDLEVAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVHSTVAPDTQIH
FT                   THMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVGPGVYDIHSPRV
FT                   PNEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVEAAKAAREKL"
FT   gene            546451..547317
FT                   /gene="metF"
FT                   /locus_tag="SPCG_0552"
FT   CDS_pept        546451..547317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SPCG_0552"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89804"
FT                   /db_xref="GOA:B2IMQ8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMQ8"
FT                   /protein_id="ACB89804.1"
FT                   /translation="MSRQTPSLSFEVFPPNPAVGNGNIISALQYMQELTPYFISVTASN
FT                   NKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGD
FT                   IIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAG
FT                   CSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRK
FT                   FKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHAL
FT                   FNHQSLG"
FT   gene            547888..550215
FT                   /gene="pnpA"
FT                   /locus_tag="SPCG_0553"
FT   CDS_pept        547888..550215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpA"
FT                   /locus_tag="SPCG_0553"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89805"
FT                   /db_xref="GOA:B2IMQ9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMQ9"
FT                   /protein_id="ACB89805.1"
FT                   /translation="MSSSKTSSVSYFYFAFDVLGILIFVGKAYNFINPKGIKMAKQVFQ
FT                   TTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAVMSKKMATGDFFPLQVNYEEKMY
FT                   AAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSYDENASAP
FT                   MAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQIIINPSQEQAEQSLLELTVAGTKHAI
FT                   NMVESGAKELSEEIMLEALLKGHEAVKELIAFQEEIVAAVGKEKAEVELLHVDAELQAE
FT                   IIAAYNSDLQKAVQVEEKLAREAATQVVKDQVTAVYEEKYADHEEFDRIMRDVAEILEQ
FT                   MEHAEVRRLITEDKVRPDGRKVDEIRPLDAVVDFLPRVHGSGLFTRGQTQALSVLTLAP
FT                   MGETQIIDGLDPEYKKRFMHHYNFPQYSVGETGRYGAPGRREIGHGALGERALAQVLPS
FT                   LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGNNYT
FT                   VLTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIQGITAEILTEALAQAKKARFEILD
FT                   VIEATIPEVRLELAPTAPKIDTIKIDVDKIKIVIGKGGETIDKIIAETGVKIDIDEEGN
FT                   VSIYSSDQDAINRAKEIIAGLVREAKVDEVYRAKVVRIEKFGAFVNLFDKTDALVHISE
FT                   MAWTRTNRVEDLVEIGDEVDVKVIKIDEKGRIDASMKALLPRPPKPEHDEKGEKSERPH
FT                   RPRHHKDHKPKKEFTETPKDSE"
FT   gene            550231..550848
FT                   /gene="cysE"
FT                   /locus_tag="SPCG_0554"
FT   CDS_pept        550231..550848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="SPCG_0554"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89806"
FT                   /db_xref="GOA:B2IMR0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR0"
FT                   /protein_id="ACB89806.1"
FT                   /translation="MGWWRETIDIVKENDPAARTTLEVLLTYPGVKALAAHRLSHFLWK
FT                   YDFKLLARMHSQFWRFWTQIEIHPGAQIDSGVFIDHGSGLVIGETAIVEKGVLLYHGVT
FT                   LGGTGKDCGKRHPTVRKGALISAHAQVIGPVEIGENAKVGAAAVVVADVPSDVTVVGIP
FT                   AKIVRLHGKKDEPVIHEVEEKREYYVNKLEQAKDASHRSSGL"
FT   gene            550860..551744
FT                   /locus_tag="SPCG_0555"
FT   CDS_pept        550860..551744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0555"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89807"
FT                   /db_xref="GOA:B2IMR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR1"
FT                   /protein_id="ACB89807.1"
FT                   /translation="MIQARNKLSQEELSEAKKVINCCQNYDGTYRDPYLSNMLNFDPNM
FT                   PAFFLYYEKGELVGLLTVYADDQDVEVTILVHPGHRRQGIARALFTSFERETASFPIRS
FT                   VTFQTERIFLENHPDFASNWGLIEDEETETWLGKDRRPYQLAKLSNLEVLLADSSYQEQ
FT                   ISQLKFQAFSGEHESREVVDRYVAEALKDPESRLYILLKDGQVIGTCTVDLSSDTNYFY
FT                   GLAISEPERGKGYGSYLAKSLVNQLIEQNDKEFQIAVEDSNVGAKRLYEKIGFVKQTQV
FT                   VYLNEKGARDSEV"
FT   gene            551831..553174
FT                   /gene="cysS"
FT                   /locus_tag="SPCG_0556"
FT   CDS_pept        551831..553174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SPCG_0556"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89808"
FT                   /db_xref="GOA:B2IMR2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR2"
FT                   /protein_id="ACB89808.1"
FT                   /translation="MIKIYDTMSRDLREFVPIEDGKIKMYVCGPTVYNYIHVGNARSTV
FT                   AFDTIRRYFEYRGYKVAYISNFTDVDDKIINRAREEGITPQEVADKYIAAFREDVTALG
FT                   VKPATRHPRVVEFMADIIRFVEDLIEKGFAYESQGDVYFRVEKSHNYAKLANKTLEDLE
FT                   LGASGRTDEETARKENPVDFALWKSSKPGEISWDSPWGPGRPGWHIECSVMSTEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKAFANYWMHNGFVNIDNVKMSKSLGNFITVHD
FT                   ALKTLDGQVLRFFFATQHYRKPINFTEKAVRDAETNLKYLKNTYEQPFTGNVDAQELQN
FT                   FKDKFVAAMDEDFNAANGITVVFEMAKWINSGNYDASVKQALADMLEIFGIVFVEEVLD
FT                   ADIEDLIQKRQEARANRDFATADQIRDQLVTQGIKLLDTKDGVRWTRD"
FT   gene            553167..553553
FT                   /locus_tag="SPCG_0557"
FT   CDS_pept        553167..553553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89809"
FT                   /db_xref="GOA:B2IMR3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR3"
FT                   /protein_id="ACB89809.1"
FT                   /translation="MIDVNLINGIALAFEGDAVYSMYIRRHLILKGMTKPNKLHQEATK
FT                   YVSAKAQARLIALMLEEQVLTEKEEEIYKRGRNTNSHTKAKNADVVTYRMSTGFEAVMG
FT                   YLHMTENLERLESLVSWCIQKVEG"
FT   gene            553557..554441
FT                   /locus_tag="SPCG_0558"
FT   CDS_pept        553557..554441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0558"
FT                   /product="leucine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89810"
FT                   /db_xref="GOA:B2IMR4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR4"
FT                   /protein_id="ACB89810.1"
FT                   /translation="MREKELQDWFPEARISDQPVEKEGYLTLPLASQQWILLEEAGLSE
FT                   REKQLVALLTQQEQARSLNPWYSYLVEGKGQAPQVFKKIQLVYCHLSYFQQENLASWLD
FT                   MMRTLFPNCQTVLQVGAQDYVFVLQQDKYTSVRDILSDMIEAVEYDFGLRLSIMLGQVW
FT                   SQTGHQALSDLIKAERDLFKTWWRQGHQGVHTFSQLYLWSMGERLVDLKPIKECLHQMI
FT                   LDQDQIQEIILSLWENSAVLTKTAQQLYLHRNSLQYKIDKWEELTGLQLKELTDLTLCY
FT                   QLILGSLSTIVGL"
FT   gene            554905..555282
FT                   /locus_tag="SPCG_0559"
FT   CDS_pept        554905..555282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89811"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR5"
FT                   /protein_id="ACB89811.1"
FT                   /translation="MKLKLNNVNNQPATEVPSSGITVKLNAKDNAGNWTSASNKKEVTV
FT                   KIVSAKPTYPDKILVKNPDNIKDTEKNAIIEKLKEANKNHPTGAPTFAKGEGEHANDIV
FT                   ATYSDGTTYYVPLNDVTKYAR"
FT   gene            555953..557230
FT                   /locus_tag="SPCG_0560"
FT   CDS_pept        555953..557230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0560"
FT                   /product="transmembrane protein Vexp1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89812"
FT                   /db_xref="GOA:B2IMR6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR6"
FT                   /protein_id="ACB89812.1"
FT                   /translation="MNPIQRSWAYVSRKRLRSFILFLILLVLLAGISACLTLMKSNKTV
FT                   ESNLYKSLNTSFSIKKIENGQTFKLSDLASVSKIKGLENVSPELETVAKLKDKEAVTGE
FT                   QSVERDDLSAADNNLVSLTALEDSSKDVTFTSSAFNLKEGRHLQKGDSKKILIHEELAK
FT                   KNGLSLHDKIGLDAGQSESGKGQTVEFEIIGIFSGKKQEKFTGLSSDFSENQVFTDYES
FT                   SQTLLGNSEAQVSAARFYVENPKEMDGLMKQVENLALENQGYQVEKENKAFEQIKDSVA
FT                   TFQTFLTIFLYGMLIAGAGALILVLSLWLRERVYEVGILLALGKGKSSIFLQFCLEVVL
FT                   VSLGALLPAFVAGNGITTYLLQTLLASGDQASLQDTLAKASSLSTSILSFAESYVFLVL
FT                   LSCLSVALCFLFLFRKSPKEILSSIS"
FT   gene            557243..557890
FT                   /locus_tag="SPCG_0561"
FT   CDS_pept        557243..557890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0561"
FT                   /product="ABC transporter, ATP-binding protein Vexp2"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89813"
FT                   /db_xref="GOA:B2IMR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR7"
FT                   /protein_id="ACB89813.1"
FT                   /translation="MTLLQLQDVTYRYKNTAEAVLYQIDYNFEPGKFYSIIGESGAGKS
FT                   TLLSLLAGLDSPVEGSILFQGEDIRKKGYSYHRMHHISLVFQNYNLIDYLSPLENIRLV
FT                   NKKASKDTLLELGLDESQIKRNVLQLSGGQQQRVAIARSLVSEAPVILADEPTGNLDPK
FT                   TAGDIVELLKSLAQKTGKCVIVVTHSKEVAQASDITLELKDKKLTETRNTSK"
FT   gene            557942..559321
FT                   /locus_tag="SPCG_0562"
FT   CDS_pept        557942..559321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0562"
FT                   /product="transmembrane protein Vexp3"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89814"
FT                   /db_xref="GOA:B2IMR8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR8"
FT                   /protein_id="ACB89814.1"
FT                   /translation="MLHNAFAYVTRKFFKSIVIFLIILLMASLSLVGLSIKGATAKASQ
FT                   ETFKNITNSFSMQINRRVNQGTPRGAGNIKGEDIKKITENKAIESYVKRINAIGDLTGY
FT                   DLIETPETKKNLTADRAKRFGSSLMITGVNDSSKEDKFVSGSYKLVEGEHLTNDDKDKI
FT                   LLHKDLAAKHGWKVGDKVKLDSNIYDADNEKGAKETVEVTIKGLFDGHNKSAVTYSQEL
FT                   YENTAITDIHTAAKLYGYTEDTAIYGDATFFVTADKNLDDVMKELNGISGINWKSYTLV
FT                   KSSSNYPALEQSISGMYKMANLLFWGSLSFSVLLLALLLSLWINARRKEVGILLSIGLK
FT                   QASILGQFIIESILIAIPALVSAYFLANYTARAIGNTVLANVTSGVAKQASKAAQASNL
FT                   GGGAEVDGFSKTLSSLDISIQTSDFIIIFVLALVLVVLVMALASSNLLRKQPKELLLDG
FT                   E"
FT   gene            559492..559584
FT                   /gene="pep27"
FT                   /locus_tag="SPCG_0563"
FT   CDS_pept        559492..559584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pep27"
FT                   /locus_tag="SPCG_0563"
FT                   /product="pep27 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89815"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMR9"
FT                   /protein_id="ACB89815.1"
FT                   /translation="MEFMRKEFHNVLSSGQLLADKRPARDYNRK"
FT   gene            559633..560289
FT                   /gene="vncR"
FT                   /locus_tag="SPCG_0564"
FT   CDS_pept        559633..560289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncR"
FT                   /locus_tag="SPCG_0564"
FT                   /product="DNA-binding response regulator VncR"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89816"
FT                   /db_xref="GOA:B2IMS0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS0"
FT                   /protein_id="ACB89816.1"
FT                   /translation="MKILIVEDEEMIREGVSDYLTDCGYETIEAADGQEALEQFSSYEV
FT                   ALVLLDIQMPKLNGLEVLAEIRKTSQVPVLMLTAFQDEEYKMSAFASLADGYLEKPFSL
FT                   SLLKVRVDAIFKRYYDTGRIFSYKDTKVDFESYSASLAGQEVPINAKELEILDYLVKNE
FT                   GRALTRSQIIDAVWKATDEVPFDRVIDVYIKELRKKLDLDCILTVRNVGYKLERK"
FT   gene            560286..561614
FT                   /gene="vncS"
FT                   /locus_tag="SPCG_0565"
FT   CDS_pept        560286..561614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vncS"
FT                   /locus_tag="SPCG_0565"
FT                   /product="sensor histidine kinase VncS"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89817"
FT                   /db_xref="GOA:B2IMS1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS1"
FT                   /protein_id="ACB89817.1"
FT                   /translation="MKRTGLFAKIFIYTFSIFSVLVICLHLAIYFLFPSTYLSHRQETI
FT                   GQKATAIAQSLEGKDRQSIEQVLDLYSQTSDIKGTVKGEMTEDKLEVKDSLPLDTDRQT
FT                   TSLFIEEREVKTQDGATMILQFLASMDLQKEAEQISLQFLPYTLLASFLISLLVAYIYA
FT                   RTIVAPILEIKRVTRRMMYLDAQVRLRVDSKDEIGNLKEQINSLYQHLLTVIADLHEKN
FT                   EAILQLEKMKVEFLRGASHELKTPLASLKILIENMRENIGRYKDRDQYLGVALGIVDEL
FT                   NHHVLQILSLSSVQELRDDRETIDLLQMTQNLVKDYALLAKERELQIDNSLTHQQAYLN
FT                   PSVMKLILSNLISNAIKHSVPGGLVRIGEREGELFIENSCSSEEQEKLAQSFSDNASRK
FT                   VKGSGMGLFVVKSLLEHEKLAYRFEMEENRLTFFIDFPKVAQD"
FT   gene            561755..562636
FT                   /gene="fba"
FT                   /locus_tag="SPCG_0566"
FT   CDS_pept        561755..562636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SPCG_0566"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89818"
FT                   /db_xref="GOA:B2IMS2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS2"
FT                   /protein_id="ACB89818.1"
FT                   /translation="MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPV
FT                   LIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAI
FT                   KLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVE
FT                   ERIDVFGSEGKA"
FT   gene            complement(562957..564159)
FT                   /locus_tag="SPCG_0567"
FT   CDS_pept        complement(562957..564159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0567"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89819"
FT                   /db_xref="GOA:B2IMS3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS3"
FT                   /protein_id="ACB89819.1"
FT                   /translation="MEFSMKSVKGLLFIIASFILTLLTWMNTSPQFMIPGLALTSLSLT
FT                   FILATRLPLLESWFHGLEKVYTVHKFTAFLSIILLIFHNFSMGGLWGSRLAAQFGNLAI
FT                   YIFASIILVAYLGKYIQYEAWRWIHRLVYLAYILGLFHIYMIMGNRLLTFNLLSFLVGS
FT                   YALLGLLAGFYIIFLYQKISFPYLGKITHLKRLNHDTREIQIHLSRPFNYQSGQFAFLK
FT                   IFQEGFESAPHPFSISGGHGQTLYFTVKNSGDHTKNIYDNLQAGSKVTLDRAYGHMIIE
FT                   EGRENQVWIAGGIGITPFISYIREHPILDKQVHFYYSFRGDENAVYLDLLRNYAQKNPN
FT                   FELHLIDSTKDGYLNFEQKEVPEHATVYMCGPISMMKALAKQIKKQNPKTELIYEGFKF
FT                   K"
FT   gene            complement(564442..565101)
FT                   /locus_tag="SPCG_0568"
FT   CDS_pept        complement(564442..565101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0568"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89820"
FT                   /db_xref="GOA:B2IMS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS4"
FT                   /protein_id="ACB89820.1"
FT                   /translation="MESILEVLTPDNLVFIFKGFGLTLYISLIAIILSTIIGTVLAVMR
FT                   NGKNPILRIISSIYIEFVRNVPNLLWIFTIFLVFKIKSTPAGITAFTLFTSAALAEIIR
FT                   GGLNAVDKGQYEAGMSQGFTSAQILYYIILPQAIRKMLPAIISQFVTVIKDTSLLYSVI
FT                   ALQELFGASQILMGRYFEPEQVFSLYILIALIYFSFNLAISSLSHMLAKRWQQAAE"
FT   gene            complement(565111..565788)
FT                   /locus_tag="SPCG_0569"
FT   CDS_pept        complement(565111..565788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0569"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89821"
FT                   /db_xref="GOA:B2IMS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS5"
FT                   /protein_id="ACB89821.1"
FT                   /translation="MTDLSSWTAYFQDFGQFFNGFLFTLALAIGSFILAMVLGIFFGAM
FT                   STSKRPILRILARIFVEFYQNTPLLVQFVIVFYGLPLISDHIIMIPIYWTAVLCVGLYH
FT                   GAYIAEVIRSGIQSIPSGQMEAALSQGFTYISAMRLITLPQAFRIILPPLTNQIVNLIK
FT                   NTSTVAIISGVDLMFVTKSWSALNGNYIPAFLGAALLYFALCFPVAQFGRKMEQANKKA
FT                   YSL"
FT   gene            complement(565801..566682)
FT                   /locus_tag="SPCG_0570"
FT   CDS_pept        complement(565801..566682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0570"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89822"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS6"
FT                   /protein_id="ACB89822.1"
FT                   /translation="MTIQANLVPNNSSAKLSTTKVTKSNKEAPMKKKFFLSALLISLFG
FT                   LAAAKPVQADTSIADIQKRGELVVGVKQDVPNFGYKDPKTGTYSGIETDLAKIVADELK
FT                   VKIRYVPVTAQTRGPLLDNEQVDMDIATFTITDERKKLYNFTSPYYTDASGFLVNKSAK
FT                   IKKIEDLNGKTIGVAQGSITQRLITELGKKKGLTFKFVELGSYPELITSLHAHRIDAFS
FT                   VDRSILSGYTSKRTELLDDSFKPSDYGIVTKKSNTELNDYLDTLVTKWSKDGSLQKLYD
FT                   RYKLKPSSHTAD"
FT   gene            complement(566606..567376)
FT                   /locus_tag="SPCG_0571"
FT   CDS_pept        complement(566606..567376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0571"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89823"
FT                   /db_xref="GOA:B2IMS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS7"
FT                   /protein_id="ACB89823.1"
FT                   /translation="MRSLMALVEFKNVEKYYGDYHALRNINLRFEKGQVVVLLGPSGSG
FT                   KSTLIRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHLNLYPHKTVLEN
FT                   VTLAPIKVLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPE
FT                   LLLFDEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVL
FT                   VDTTDVDNFFDNPSKPRAQQFLSKIINHESDKVK"
FT   gene            567629..569863
FT                   /gene="recJ"
FT                   /locus_tag="SPCG_0572"
FT   CDS_pept        567629..569863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="SPCG_0572"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89824"
FT                   /db_xref="GOA:B2IMS8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR018779"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS8"
FT                   /protein_id="ACB89824.1"
FT                   /translation="MDVFLITPTYEWQFALQVEDADFTKIAKKAGLGPEVARLLFERGI
FT                   QNQESLKKFLEPSLEDLHDAYLLHDMDKAVERIRQAIEEGENILVYGDYDADGMTSASI
FT                   VKESLEQLGAECRVYLPNRFTDGYGPNASVYKYFIEQEGISLIVTVDNGVAGHEAIALA
FT                   QSMGVDVIVTDHHSMPETLPDAYAIVHPEHPDADYPFKYLAGCGVAFKLACALLEEVQV
FT                   ELLDLVAIGTIADMVSLTDENRILVQYGLEMLGHTQRIGLQEMLDMAGIAANEVTEETV
FT                   GFQIAPRLNALGRLDDPNPAIDLLTGFDDEEAHEIALMIHQKNEERKEIVQSIYEEAKT
FT                   MVDPEKKVQVLAKEGWNPGVLGIVAGRLLEELGQTVIVLNIEDGRAKGSARSVEAVDIF
FT                   EALDPHRDLFIAFGGHAGAAGMTLEVEQLSDLSQVLEDYVREKGADAGGKNKLNLDEEL
FT                   DLEALSLETVKSFERLAPFGMDNQKPIFYIKNFQVESARTMGAGNAHLKLKISKGEASF
FT                   EVVAFGQGRWATEFSQTKNLELAVKLSVNQWNGQTALQLMMVDARVEGVQLFNIRGKNA
FT                   VLPEGVPVLDFPGELPNFAASEAIVVKNIPEDITQLKTIFQEQHFSAVYFKNDIDKAYY
FT                   LTGYGTRDQFAKLYKTIYQFPEFDIRYKLKDLAAYLNIQQILLVKMIQVFEELGFVTIK
FT                   DGVMTVNKEAPKREIGESQIYQNLKQTVKDQEMMALGTVQEIYDFLMEKE"
FT   gene            570038..571699
FT                   /locus_tag="SPCG_0573"
FT   CDS_pept        570038..571699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0573"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89825"
FT                   /db_xref="GOA:B2IMS9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMS9"
FT                   /protein_id="ACB89825.1"
FT                   /translation="MSNISLTTLGGVRENGKNMYIAEIGESIFVLNVGLKYPENEQLGV
FT                   DVVIPNMDYLFENSDRIAGVFLTHGHADAIGALPYLLAEAKVPVFGSELTIELAKLFVK
FT                   GNDAVKKFNDFHVIDENTEIDFGGTVVSFFPTTYSVPESLGIVLKTSEGSIVYTGDFKF
FT                   DQTASESYATDFARLAEIGRDGVLALLSDSANADSNIQVASESEVRDEITQTIADWEGR
FT                   IIVAAVSSNLSRIQQIFDAADKTGRRIVLTGFDIENIVRTAIRLKKLSLANEILLIKPK
FT                   DMSRFEDHELIILETGRMGEPINGLRKMSIGRHRYVEIKDGDLVYIATAPSIAKEAFVA
FT                   RVENMIYQAGGVVKLITQSLHVSGHGNVRDLQLMINLLQPKYLFPVQGEYRELDAHAKA
FT                   AMAVGMLPERIFIPKKGTTMAYENGDFVPAGSVSAGDILIDGNAIGDVGNVVLRDRKVL
FT                   SEDGIFIVAITVNRREKKIVARARVHTRGFVYLKKSRDILRESSELINQTVEEYLQGDD
FT                   FDWADLKGKVRDNLTKYLFDQTKRRPAILPVVMEAK"
FT   gene            571768..572547
FT                   /gene="estA"
FT                   /locus_tag="SPCG_0574"
FT   CDS_pept        571768..572547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="SPCG_0574"
FT                   /product="tributyrin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89826"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT0"
FT                   /protein_id="ACB89826.1"
FT                   /translation="MAVMKIEYYSQVLDMEWGVNVLYPDANRVEEPECEDIPVLYLLHG
FT                   MSGNHNSWLKRTNVERLLRGTNLIVVMPNTSNGWYTDTQYGFDYYMALAEELPQVLKRF
FT                   FPNMTSKREKTFIAGLSMGGYGCFKLALTTNRFSHAASFSGALSFQNFSPESQNLGSPA
FT                   YWRGVFGEIRDWTTSPYSLESLAKKSDKKTKLWAWCGEQDFLYEANNLAVKNLKKLGFD
FT                   VTYSHSAGTHEWYYWEKQLEVFLTTLPIDFKLEERLT"
FT   gene            572660..573880
FT                   /gene="murM"
FT                   /locus_tag="SPCG_0575"
FT   CDS_pept        572660..573880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="SPCG_0575"
FT                   /product="beta-lactam resistance factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89827"
FT                   /db_xref="GOA:B2IMT1"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT1"
FT                   /protein_id="ACB89827.1"
FT                   /translation="MYRYQIGIPTLEYDQFVKEHELANVLQSSAWEEVKSNWQHEKFGV
FT                   YREEKLLATASILIRTLPLGYKMFYIPRGPILDYGDKELLNFAIQSIKSYARSKRAVFV
FT                   TFDPSICLSQSLINQEKTEFPENLAIIDSLQQMGVRWSGKTEEMGDTIQPRIQAKIYKE
FT                   NFEEDKLSKSTKQAIRTARNKGLEIQYGGLELLDSFSELMKKTEKRKEIHLRNEAYYKK
FT                   LLDNFKDKAYITLATLDVSKRSQELEEQLAKNRALEETFTESTRTSKVEAQKKEKERLL
FT                   EELTFLQEYIDVGQARVPLAATLSLEFGTTSVNIYAGMDDDFKRYNAPILTWYETARYA
FT                   FERGMVWQNLGGVENSLNGGLYHFKEKFNPTIEEYLGEFTMPTHPLYPLLRLALDFRKT
FT                   LRKKHRK"
FT   gene            573885..575117
FT                   /gene="murN"
FT                   /locus_tag="SPCG_0576"
FT   CDS_pept        573885..575117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murN"
FT                   /locus_tag="SPCG_0576"
FT                   /product="beta-lactam resistance factor"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89828"
FT                   /db_xref="GOA:B2IMT2"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT2"
FT                   /protein_id="ACB89828.1"
FT                   /translation="MALTTLTKEEFQTYSDQVSSRSFMQSVQMGDLLEKRGARIVYLAL
FT                   KQEGEIQVAALVYSLPMLGGLHMELNSGPIYTQQDALPVFYAELKEYAKQNGVLELLVK
FT                   PYETYQTFDSQGNPIDAEKKSIIQGLTDLGYQFDGLTTGYPGGEPDWLYYKDLTELTEK
FT                   SLLKSFSKKGKPLVKKAETFGIRLKKLKREELSIFKNITKETSERREYSDKSLEYYEHF
FT                   YDTFGEQAEFLIASLNFSEYMSKLQGEQSKLEEKLDKLRLDLSKNPHSEKKQNQLREYS
FT                   SQFETFEVRKAEARDLIEKYGEEDIVLAGSLFVYMPQETTYLFSGSYTEFNKFYAPALL
FT                   QKYVMLESIKRGIPKYNFLGIQGIFDGSDGVLRFKQNFNGYIVRKAGTFRYHPSPLKYK
FT                   AIQLLKKIVGR"
FT   gene            575175..575897
FT                   /locus_tag="SPCG_0577"
FT   CDS_pept        575175..575897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89829"
FT                   /db_xref="GOA:B2IMT3"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT3"
FT                   /protein_id="ACB89829.1"
FT                   /translation="MLERWRDMRWLFRLIGAFFSFVWRLFWRLVWIVVLLCVLAFGLLW
FT                   YLNGDFQGALKQAERSVKIGQQSIDQWEKTGQLPKLSQTDSHQHSEGRWAQASARIYLD
FT                   PQMDSRFQEAYLEAIQNWNQTGAFNFELVTESSKADITATEMNDGGTPVAGEAESQTNL
FT                   LTGQFLSVTVRLNHYYLSNPYYGYSYERLVHTAEHELGHAIGLDHTDEKSVMQPAGSFY
FT                   GIQEEDVANLRKIYETSE"
FT   gene            575937..577784
FT                   /gene="uvrC"
FT                   /locus_tag="SPCG_0578"
FT   CDS_pept        575937..577784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="SPCG_0578"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89830"
FT                   /db_xref="GOA:B2IMT4"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMT4"
FT                   /protein_id="ACB89830.1"
FT                   /translation="MNNLIKSKLELLPTSPGCYIHKDKNGTIIYVGKAKNLRNRVRSYF
FT                   RGSHDTKTEALVSEIVDFEFIVTESNIEALLLEINLIKENKPKYNIMLKDDKSYPFIKI
FT                   TNERYPRLIITRQVKKDGGLYFGPYPDVGAANEIKRLLDRIFPFRKCTNPPSKVCFYYH
FT                   IGQCMAHTICKKDEIYFKSMAQEVSDFLKGQDNKIIDELKGKMAAAAQTMEFERAAEYR
FT                   DLIQAIGTLRTKQRVMAKDLQNRDVFGYYVDKGWMCVQVFFVRQGKLIERDVNLFPYFN
FT                   DPDEDFLTYVGQFYQEKSHLVPNEVLIPQDIDEEAVKALVDSKILKPQRGEKKQLVNLA
FT                   IKNARVSLEQKFNLLEKSVEKTQGAIENLGRLLQIPTPVRIESFDNSNIMGTSPVSAMV
FT                   VFVNGKPSKKDYRKYKIKTVVGPDDYASMREVIRRRYGRVQREALTPPDLIVIDGGQGQ
FT                   VNIAKQVIQEELGLDIPIAGLQKNDKHQTHELLFGDPLEVVDLSRNSQEFFLLQRIQDE
FT                   VHRFAITFHRQLRSKNSFSSQLDGIDGLGPKRKQNLMRHFKSLTKIKEASVDEIVEVGV
FT                   PRAVAEAVQTKLNPQETEILLQVAEERVDYQTEGNHNKP"
FT   gene            577834..578271
FT                   /locus_tag="SPCG_0579"
FT   CDS_pept        577834..578271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89831"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT5"
FT                   /protein_id="ACB89831.1"
FT                   /translation="MIADAKTQGASEYWLMGDIFLPGPGANDLVALLKELPITASVRGN
FT                   WDDCVLEALDGQYGLEDPQEVQLLRMTQYLMERMDPATIVWLRSLPLLEKKEIDGLRFS
FT                   ISHNLPDKNYGGDLLVENDTEKFDQLLDAETDVAVYGHVHK"
FT   gene            578272..578607
FT                   /locus_tag="SPCG_0580"
FT   CDS_pept        578272..578607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89832"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT6"
FT                   /protein_id="ACB89832.1"
FT                   /translation="MLRYGSQGQQIINPGSIGMPYFNWEALKNHRAQYAVIEVEDGELV
FT                   NILFRKVAYDYEAELEFAKSKGFPFIEMYEELRREDNYQRHNLELLASLIEKHRYVEDV
FT                   KNFFDFL"
FT   gene            complement(578791..579606)
FT                   /locus_tag="SPCG_0581"
FT   CDS_pept        complement(578791..579606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0581"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89833"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT7"
FT                   /protein_id="ACB89833.1"
FT                   /translation="MNGDSMKKFSLLLAILPFLVACGNQATPKETSAQKTIVLATAGDV
FT                   PPFDYEDKGNLTGFDIEVLKAVDEKLSDYEIQFQRTAWESIFPGLDSGHYQAAANNLSY
FT                   TKERAEKYLYSLPISNNPLVLVSNKKNPLTSLDQIAGKTTQEDTGTSNAQFINNWNQKH
FT                   TDNPATINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDLSVVDLPSADSPS
FT                   NYIIFSSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYLPDQSQLQ"
FT   gene            579665..579775
FT                   /locus_tag="SPCG_0582"
FT   CDS_pept        579665..579775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89834"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT8"
FT                   /protein_id="ACB89834.1"
FT                   /translation="MSVIEKLNHEKSLQALSNYGRMEAVELEKEIDYEIS"
FT   gene            579762..580367
FT                   /gene="nrd"
FT                   /locus_tag="SPCG_0583"
FT   CDS_pept        579762..580367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrd"
FT                   /locus_tag="SPCG_0583"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89835"
FT                   /db_xref="GOA:B2IMT9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMT9"
FT                   /protein_id="ACB89835.1"
FT                   /translation="MKFLELNKKRHATKHFTDKPVDPKDVRTAIEIATLAPSAHNSQPW
FT                   KFVVVREKNAELAKLAYGSNFEQVSSAPVTIALFTDTDLAKRARKIARVGGANNFSEEQ
FT                   LQYFMKNLPAEFARYSEQQVSDYLALNAGLVAMNLVLALTDQGIGSNIILGFDKSKVNE
FT                   VLEIEDRFRPELLITVGYTDEKLEPSYRLPVDEIIEKR"
FT   gene            580380..581780
FT                   /gene="pepV"
FT                   /locus_tag="SPCG_0584"
FT   CDS_pept        580380..581780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepV"
FT                   /locus_tag="SPCG_0584"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89836"
FT                   /db_xref="GOA:B2IMU0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011291"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU0"
FT                   /protein_id="ACB89836.1"
FT                   /translation="MTAIDFTAEVEKRKEDLLADLFSLLEINSERDDSKADAQHPFGPG
FT                   PVKALEKFLEIADRDGYPTKNVDNYAGHFEFGDGEEVLGIFAHMDVVPAGSGWDTDPYT
FT                   PTIKDGRLYARGASDDKGPTTACYYGLKIIKELGLPTSKKVRFIVGTDEESGWADMDYY
FT                   FEHVGLAKPDFGFSPDAEFPIINGEKGNITEYLHFAGENTGVARLHSFTGGLRENMVPE
FT                   SATAVVSGDLADLQAKLDAFVAEHKLRGELQEEAGKYKVTIIGKSAHGAMPASGVNGAT
FT                   YLALFLSQFGFAGPAKDYLDIAGKILLNDHEGENLKIAHVDEKMGALSMNAGVFRFDET
FT                   SADNTIALNIRYPKGTSPEQIKSILENLPVVSVSLSEHGHTPHYVPMEDPLVQTLLNIY
FT                   EKQTGLKGHEQVIGGGTFGRLLERGVAYGAMFPDSIDTMHQANEFIALDDLFRAAAIYA
FT                   EAIYELIK"
FT   gene            581834..582412
FT                   /locus_tag="SPCG_0585"
FT   CDS_pept        581834..582412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89837"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU1"
FT                   /protein_id="ACB89837.1"
FT                   /translation="MSQIERIKQAIMADSQNASYTERGIEPLFAAPKTARINIIGQAPG
FT                   LKTQEAGLYWKDKSGDRLRDWLGVDEDTFYNSGYFAVLPMDFYFPGHGKSGDLPPRTGF
FT                   AEKWHPQLLQELPDIQLTLLIGQYAQAYYLQEKISGKVTERVKHYKDYLPAYFPLVHPS
FT                   PRNQIWMAKNPWFEAEVVPDLKKRIKTIL"
FT   gene            582536..582724
FT                   /locus_tag="SPCG_0586"
FT   CDS_pept        582536..582724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89838"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU2"
FT                   /protein_id="ACB89838.1"
FT                   /translation="MKRFSKSIRRKRMKEIAFDAFYQLYQNDQLSLVDVREVDEFAALH
FT                   LEGAHNLPLSQLTDSYD"
FT   gene            583015..584355
FT                   /gene="brnQ"
FT                   /locus_tag="SPCG_0587"
FT   CDS_pept        583015..584355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SPCG_0587"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89839"
FT                   /db_xref="GOA:B2IMU3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU3"
FT                   /protein_id="ACB89839.1"
FT                   /translation="MKEIFMAKKGTLTGLLLFGIFFGAGNLIFPPSLGALSGEHFLPAI
FT                   AGFVFSGVGIAVLTLIIGTLNPKGYIYEISTKIAPWFATLYLSVLYLSIGPFFATPRTA
FT                   TTAYEVGISPLLSDANKGLGLIVFTVLYFAAAYLISLNPSKILDRIGRILTPVFAILIV
FT                   ILVVLGAIKYGGTSPQAASAAYQASAFGTGFLEGYNTLDALASVAFSVIAVQTLKQLGF
FT                   SSKKEYISTIWVVGIVVALAFSALYIGLGFLGNHFPVPAEAMKGGTPGVYILSQATQEI
FT                   FGSTAQLFLAAMVTVTCFTTTVGLIVSTAEFFNERFPQISYKVYATAFTLIGFAIANLG
FT                   LDAIIKYSIPVLVILYPITIAIVMIVIVNKFVALSKPGMQLTIAVVTVIAIASVLGSSF
FT                   KVEFLANLVSVLPFAKASLPWLVPAIVGILLSLVLPNKQESDVFEME"
FT   gene            584559..585596
FT                   /locus_tag="SPCG_0588"
FT   CDS_pept        584559..585596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89840"
FT                   /db_xref="GOA:B2IMU4"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU4"
FT                   /protein_id="ACB89840.1"
FT                   /translation="MNQTVEYIKELTAIASPTGFTREIADYLVKTLEGFGYQPVRTSKG
FT                   GVNVTIKGQNDEQHRYVTAHVDTLGAIVRAVKPDGRLKMDRIGGFPWNMIEGENCTIHV
FT                   ASTGEKVSGTILIHQTSCHVYKDAGTAERTQDNMEVRLDAKVTSEKETRALGIEVGDFI
FT                   SFDPRTVVTETGFIKSRHLDDKVSAAILLNLLRIYKEEKIELPVTTHFAFSVFEEVGHG
FT                   ANSNIPAQVVEYLAVDMGAMGDDQQTDEYTVSICVKDASGPYHYDFRQHLVALAKEQDI
FT                   PFKLDIYPFYGSDASAAMSAGAEVKHALLGAGIESSHSYERTHIDSVIATERMVDAYLK
FT                   STLVD"
FT   gene            585565..586068
FT                   /locus_tag="SPCG_0589"
FT   CDS_pept        585565..586068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0589"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89841"
FT                   /db_xref="GOA:B2IMU5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU5"
FT                   /protein_id="ACB89841.1"
FT                   /translation="MLILRARWWTNMCLICQRIDLIKKEENPYFVKELETGYLVVGDHQ
FT                   YFEGYSLFLAKEHVSELHHLKKETRLRFLEEMSLVQEAVAKAFAAEKMNIELLGNGDAH
FT                   LHWHLFPRRTGDMNGHGLKGRGPVWWVPFEEMTAETCQAKPDEIKRLVKRLSSEVDKLL
FT                   EIKE"
FT   gene            586071..586787
FT                   /locus_tag="SPCG_0590"
FT   CDS_pept        586071..586787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89842"
FT                   /db_xref="GOA:B2IMU6"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU6"
FT                   /protein_id="ACB89842.1"
FT                   /translation="MKKRYLVLTALLALSLAACSQEKTKNEDGETKTEQTAKADGTVGS
FT                   KSQGAAQKKAEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLIKA
FT                   MQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKAAADRYSARPGYSEHQTGLAFDVIG
FT                   TDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYMAEEWHLRYVGKEAKEIAASG
FT                   LSLEEYYGFEGGDYVD"
FT   gene            587096..587521
FT                   /gene="rplK"
FT                   /locus_tag="SPCG_0591"
FT   CDS_pept        587096..587521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SPCG_0591"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89843"
FT                   /db_xref="GOA:B2IMU7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMU7"
FT                   /protein_id="ACB89843.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFTFVTKTPPAAVLLKKAAGVEKGSGTPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANVESAMRMIEGTARSMGFTVVD"
FT   gene            587729..588418
FT                   /gene="rplA"
FT                   /locus_tag="SPCG_0592"
FT   CDS_pept        587729..588418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SPCG_0592"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89844"
FT                   /db_xref="GOA:B2IMU8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMU8"
FT                   /protein_id="ACB89844.1"
FT                   /translation="MAKKSKQLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVA
FT                   YNLNIDVKKADQQIRGAMVLPNGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NDGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADRAGNVQAIIGKVSFEAEKLVENFKAFNETIQKVKPATAKGTYVTNLTITTTQGVGI
FT                   KVDVNSL"
FT   gene            589020..589532
FT                   /locus_tag="SPCG_0593"
FT   CDS_pept        589020..589532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89845"
FT                   /db_xref="GOA:B2IMU9"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMU9"
FT                   /protein_id="ACB89845.1"
FT                   /translation="MKISSNHVNVALPCVWLLTSSVLSTTSKQCFEQPAASFLVCSLVF
FT                   IEYNTLLEVGLNFLISLFTFTFDILYPIVKVGHTDDYSHGAVKLSVSLVDKDAMKKISV
FT                   TVIGYFEINIDENITDILYVNGTAILYPYLRSIVSIVSAIDSSEAMLLPTINVLELLDK
FT                   SQPFEEE"
FT   gene            590577..591569
FT                   /locus_tag="SPCG_0594"
FT   CDS_pept        590577..591569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0594"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89846"
FT                   /db_xref="GOA:B2IMV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV0"
FT                   /protein_id="ACB89846.1"
FT                   /translation="MAMIEVEHLQKHFVKIVKEPGLKGALRSFIHPEKQTFEAVKDLTF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGFCRINGKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYTVLKEIYDVPNSLFHKRMDFLNEVLDLKDFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIFMIDKGQKIFDGTVSQLKETFGKMKTLSFELLPGQSHLVSHYEGLSDMTIDRQG
FT                   NSLNIEFDSSRYQSADIIKQTLSDFEIRDLKMVDTDIEDIIRRFYRKEL"
FT   gene            591529..592389
FT                   /locus_tag="SPCG_0595"
FT   CDS_pept        591529..592389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0595"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89847"
FT                   /db_xref="GOA:B2IMV1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV1"
FT                   /protein_id="ACB89847.1"
FT                   /translation="MRILSVASTERSSRMIKLWRRYKPFINAGVQELITYRVNFILYRI
FT                   GDVMGAFVAFYLWKAVFDSSQESLIQGFSMADITLYIIMSFVTNLLTRSDSSFMIGEEV
FT                   KDGSIIMRLLRPVHFAASYLFTELGSKWLIFISVGLPFLSVIVLMKIISGQGIVEVLGL
FT                   TVLYLFSLTLAYLINFFFNICFGFSAFVFKNLWGSNLLKTSIVAFMSGSLIPLAFFPKV
FT                   VSDILSFLPFSSLIYTPVMIIVGKYDASQILQALLLQFFWLLVMVGLSQLIWKRVQSFI
FT                   TIQGG"
FT   gene            592391..593176
FT                   /locus_tag="SPCG_0596"
FT   CDS_pept        592391..593176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89848"
FT                   /db_xref="GOA:B2IMV2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV2"
FT                   /protein_id="ACB89848.1"
FT                   /translation="MKKYQRMHLIFIRQYIKQIMEYKVDFVVGVLGVFLAQGLNLLFLN
FT                   VIFQHIPFLEGWTFQEIAFIYGFSLIPKGMDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   NPLFHILVETFQIDALGELLVGGILLGTTVTSIVWTLPKFLLFLVCIPFATLIYTSLKI
FT                   ATASIAFWTKQSGAMIYIFYMFNDFAKYPISIYNSLLRWLISFIVPFAFTAYYPASYFL
FT                   QEKDVFFNVGGLMLISLVFFVISLKLWDKGLDFYESAGS"
FT   gene            593274..593492
FT                   /locus_tag="SPCG_0597"
FT   CDS_pept        593274..593492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89849"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV3"
FT                   /protein_id="ACB89849.1"
FT                   /translation="MKDLPEWFGIPESTQAYIEGTTTLQVWTAYQESDLTGFVRLSYSS
FT                   EDCAEIDCLGVKKLIKVEKLGANCLLL"
FT   gene            593429..593638
FT                   /locus_tag="SPCG_0598"
FT   CDS_pept        593429..593638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89850"
FT                   /db_xref="GOA:B2IMV4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV4"
FT                   /protein_id="ACB89850.1"
FT                   /translation="MSRRKKAYQGRKIGSQLLATLESEARKKVGYLQVKTVAEGSNKDY
FT                   DRTNDFYRGLGFKKLEIFSQLWNP"
FT   gene            594362..600796
FT                   /gene="prtA"
FT                   /locus_tag="SPCG_0599"
FT   CDS_pept        594362..600796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prtA"
FT                   /locus_tag="SPCG_0599"
FT                   /product="serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89851"
FT                   /db_xref="GOA:B2IMV5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034216"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV5"
FT                   /protein_id="ACB89851.1"
FT                   /translation="MKKSTVLSLTTAAVILAAYAPNEVVLADTSSSEDALNISDKEKVV
FT                   LDKETENKEKHEDIHNAIETSKDTEEKKTTVIEEKEVVSKNPVIDTKTSNEEARIKEDS
FT                   NQSQGDNAHSSANKGTENPKKEDRLVYIAEFKDKESGEKAIKQLSNLKNTKVLYTYDRI
FT                   FNGSAIETTPDNLDKIKQIEGITSVERAQKVQPMMNHARKEIGVEEAIDYLKSINAPFG
FT                   KNFDGRGMVISNIDTGTDYRHKAMRIDDDAKASMRFKKEDLKGTDKNYWLSDKIPHAFN
FT                   YYNGGKITVEKYDDGRDYFDPHGMHIAGILAGNDTEQDIKNFNGIDGIAPNAQIFSYKM
FT                   YSDAGSGFAGDETMFHAIEDSIKHNVDVVSVSSGFTGTGLVGEKYWQAIRALRKAGIPM
FT                   VVATGNYATSASSSSWDLVANNHLKMTDTGNVTRTAAHEDAIAVASAKNQTVEFDKVNI
FT                   GGESFKYRNIGAFFDKNKITTNEDGTKAPSKLKFVYIGKGQDQDLIGLDLRGKIAVMDR
FT                   IYTKDLKNAFKKAMDKGARAIMVVNTVNYYNRDNWTELPAMGYEADEGTKSQVFSISGD
FT                   DGVKLWNMINPNKKTEVKRNNKEDFKDKLEQYYPIDMESFNSNKPNVGDEKEIDFKFAP
FT                   DTDKELYKEDIIVPAGSTSWGPRIDLLLKPDVSAPGKNIKSTLNVINGKSTYGYMSGTS
FT                   MATPIVAASTVLIRPKLKEMLERPVLKNLKGDDKIDLTSLTKIALQNTARPMMDATSWK
FT                   EKSQYFASPRQQGAGLINVANALRNEVVATFKNTDSKGLVNSYGSISLKEIKGDKKYFT
FT                   IKLHNTSNRPLTFKVSASAITTDSLTDRLKLDETYKDEKSPDGKQIVPEIHPEKVKGAN
FT                   ITFEHDTFTIGANSSFDLNAVINVGEAKNKNKFVESFIHFESVEEMEALNSNGKKINFQ
FT                   PSLSMPLMGFAGNWNHEPILDKWAWEEGSRSKTLGGYDDDGKPKIPGTLNKGIGGEHGI
FT                   DKFNPAGVIQNRKDKNTTSLDQNPELFAFNNQGINAPSSSGSKIANIYPLDSNGNPQDA
FT                   QLERGLTPSPLVLRSAEEGLISIVNTNKEGENQRDLKVISREHFIRGILNSKSNDAKGI
FT                   KSSKLKVWGDLKWDGLIYNPRGREENAPESKDNQDPATKIRGQFEPIAEGQYFYKFKYR
FT                   LTKDYPWQVSYIPVKIDNTAPKIVSVDFSNPEKIKLITKDTYHKVKDQYKNETLFARDQ
FT                   KEHPEKFDEIANEVWYAGAALVNEDGEVEKNLEVTYAGEGQGRNRKLDKDGNTIYEIKG
FT                   AGDLRGKIIEVIALDGSSNFTKIHRIKFANQADEKGMISYYLVDPDQDSSKYQKLGEIA
FT                   ESKFKNLGNGKEGSLKKDTTGVEHHHQENEESIKEKSSFTIDRNISTIRDFENKDLKKL
FT                   IKKKFREVDDFTSETGKRIEEYDYKYDDKGNIIAYDDGSALQYETEKLDEIKSKIYGVL
FT                   SPSKDGHFEILGKISNVSKNAKVYYGNSYKSIEIKATKYDSHSKTMTFDLYANINDIVD
FT                   GLAFAGDMRFFVKDDNRIKAETKIRMPEKNKETKAEYPYVSSYGNVIELGEGDLSKNKP
FT                   DNLTKMESGKIYSDSEKQQYLLKDNIILRKGYALKVTTYNPGKTDMLEGNGVYSKEDIA
FT                   KIQKANPNLRVLSETTIYADSRNVEDGRSTQAVLMSALDGFNIIRYQVFTFKMNDKGEA
FT                   IDKDGNLVTDSSKLVLFGKDDKEYTGEDKSNVEAIKEDGSMLFIDTKPVNLSMDKNYFN
FT                   PSKSNKIYVRNPEFYLRGKISDKGGFNWELRVNESVVDNYLIYGDLHIDNTRDFNIKLN
FT                   VKDGDIMDWGMKDYKANGFPDKVTDMDGNVYLQTGYSDLNAKAVGVHYQFLYDNVKPEV
FT                   NIDPKGNTSIEYADGKSVVFNINDKRNNGFDGEIQEQHIYVNGKEYTSFDDIKQITDKT
FT                   LNIKIVVKDFARNTTVKEFILNKDTGEVSELKPHRVTVTIQNGKEMSSTIVSEEDFILP
FT                   VYKGELEKGYQFDGWEISGFEGKKDAGYVINLSKDTFIKPVFKKIEEKKEEENKPTFDV
FT                   SKKKDNPQVNHSQLNESHRKEDLQREDHSQKSDSTKDVTATVLDKNNISSKSTTNNPNK
FT                   LPKTGTASGAQTLLAAGIMFIVGIFLGLKKKNQD"
FT   gene            601407..601904
FT                   /locus_tag="SPCG_0600"
FT   CDS_pept        601407..601904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0600"
FT                   /product="PTS system IIA component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89852"
FT                   /db_xref="GOA:B2IMV6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV6"
FT                   /protein_id="ACB89852.1"
FT                   /translation="MERREKLMVLDYFFDKNLVFCLEADNQEHLFDQVATLLEEREIVT
FT                   PTYREALITREKSFPTGLDMEFLGKDLPNVAIPHTDIVHNLAEKVVVVRLEKPVTFHNM
FT                   IAPDKEVEVSLLFFIINNSSSSQTNILAQLMDFFTGNGHLEDLSKISEPEKLYAYIAEA
FT                   TA"
FT   gene            601942..602247
FT                   /locus_tag="SPCG_0601"
FT   CDS_pept        601942..602247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0601"
FT                   /product="PTS system, IIB component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89853"
FT                   /db_xref="GOA:B2IMV7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV7"
FT                   /protein_id="ACB89853.1"
FT                   /translation="MIKILAACGAGVNSSHQIKSALEEELSNRGYDVHCDAVMVKDVNE
FT                   DLMKGYDIFTPIAATDLGFEPGIPVIEAGPILFRIPAMSAPVFDNIEAAIKEHGLS"
FT   gene            602295..603770
FT                   /locus_tag="SPCG_0602"
FT   CDS_pept        602295..603770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0602"
FT                   /product="PTS system, IIC component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89854"
FT                   /db_xref="GOA:B2IMV8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV8"
FT                   /protein_id="ACB89854.1"
FT                   /translation="MDAIFDLIGKVFNPILEMGGPVIMLIILTVLALLFGVKFSKALEG
FT                   GIKLAIALTGIGAIIGMLNGAFSASLAKFVENTGIQLSITDVGWAPLATITWGSAWTLY
FT                   FLLIMLIVNVVMLAMKKTDTLDVDIFDIWHLSITGLLIKWYADNNGVSQGVSLFIATAA
FT                   IVLVGVLKIINSDLMKPTFDDLLNAPSSSPMTSTHMNYMMNPVIMVLDKIFEKFFPGLD
FT                   KYDFDAAKLNKKIGFWGSKFFIGFILGIVIGIMGTPHPIAGVADADKWRLVIKGWLSLG
FT                   LTAGVSLELFSLIGSWFIAAVEPLSQGITNVATKRLRGRKFNIGLDWPFIAGRAEIWAC
FT                   ANVLAPIMLIEAVLLSKVGNGILPLAGIIAMGVTPALLVVTRGKLLRMIIFGTLLLPLF
FT                   LLSGTLIAPFATELAKGVGAFPEGVSQTQLITHSTLEGPIEKLLGWTIGNTTTGDIKAI
FT                   LGAVVFLVFYIGIFAWYRKQMIKRNEEYAAKAK"
FT   gene            604120..610821
FT                   /gene="bgaA"
FT                   /locus_tag="SPCG_0603"
FT   CDS_pept        604120..610821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bgaA"
FT                   /locus_tag="SPCG_0603"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89855"
FT                   /db_xref="GOA:B2IMV9"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR032311"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR040605"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMV9"
FT                   /protein_id="ACB89855.1"
FT                   /translation="MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYA
FT                   DETLITHTAEKPKEEKMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTP
FT                   KEEKVSAKPEEKAPRIESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWHFKLN
FT                   ANSKEAIKPDADVSTWKKLDLPYDWSIFNNFDHESPAQNEGGQLNGGEAWYRKTFKLDE
FT                   KDLKKNVRLTFDGVYMDSQVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAV
FT                   NKQPSSRWYSGSGIYRDVTLQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNT
FT                   DDKDHELVAEYQIVERGGHAVTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKP
FT                   ALYELITRVYRDGQLVDAKKDLFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGA
FT                   EENYKAEYRRLKQMKEMGVNSIRTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPY
FT                   DYGRFFEKDATHPEARKGEKWSDFDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLA
FT                   TVKRLVKVIKDVDKTRYVTMGADKFRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAK
FT                   HPKWLIYGSETSSATRTRGSYYRPERELKHSNGPERNYEQSDYGNDRVGWGKTATASWT
FT                   FDRDNAGYAGQFIWTGTDYIGEPTPWHNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQW
FT                   VSVKKKPMVHLLPHWNWENKELASKVADSEGKIPVRAYSNASSVELFLNGKSLGLKTFN
FT                   KKQTSDGRTYQEGANANELYLEWKVAYQPGTLEAIARDESGKEIARDKITTAGKPAAVR
FT                   LIKEDHAIAADGKDLTYIYYEIVDSQGNVVPTANNLVRFQLHGQGQLVGVDNGEQASRE
FT                   RYKAQADGSWIRKAFNGKGVAIVKSTEQAGKFTLTAHSDLLKSSQVTVFTGKKEGQEKT
FT                   VLGTEVPKVQTIIGEAPEMPTTVPFLYSDGSRAERPVTWSSVDVSKPGIVTVKGMADGR
FT                   EVEARVEVIALKSELPVVKRIAPNTDLNSVDKSVSYVLTDGSVQEYEVDSWEITEVDKA
FT                   KLSVAGSRIQMTGQLAGETIHATLVVEEGNAAAPVVPTVTVGGEAVTGLTSRQPMQYRT
FT                   LSYGAQLPEVTASAENADVTVLQASAANGMRASIFVQPKDGGPLQTYAIQLLEEAPKIA
FT                   HLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLPADKVTFSTSGEGEVAIRKGMLELH
FT                   KPGAVTLKAEYEGAKGQVELTIQANTEKKIAQSIRPVNVVTDLHQKPTLPTTVTVEYDK
FT                   GFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEARAKVSVEGIVSVEEVSVTTPIA
FT                   EAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGVFTVNGRLEGTQLTTKLHVRVS
FT                   AQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKLISYNNQPANRWTNWNRTNPE
FT                   ASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIEYYVGKTVPTAPKNPSFVGN
FT                   EDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAVRIRMVRADNKLGTSITEV
FT                   QIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGKVTAVTASVSNNGLATVV
FT                   PSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAVKQARLLQVGQALELPT
FT                   KVPVYFTGKDGYETKNLTVEWEEVPAENLIKAGQFTVRGHVLGSNLVAEITVRVTDKLG
FT                   ETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRRWTNWSPTPSSNPEV
FT                   SAGVIFRENGKIVERTVAQGKVQFFADSGTDAPSKLVLERYVGPEFEVPTYYSNYQAYD
FT                   ADHPFNNPENWEAVPYRADKDIAAGDEINVTFKDIKAKAMRWRMERKADKSGVAMIEMT
FT                   FLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEENNQVASTVVDS
FT                   GEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSDKTVAAVQEDLPKLEFVEKDLAYKTV
FT                   EKKDSTLYLGETRVEQEGKVGKERIFTAINPDGSKEEKLREVVEVPTDRIVLVGTKPVA
FT                   QEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAAGQAAVAAGLALLGLSAGLVVTK
FT                   GKKED"
FT   gene            complement(611131..611685)
FT                   /locus_tag="SPCG_0604"
FT   CDS_pept        complement(611131..611685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0604"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89856"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW0"
FT                   /protein_id="ACB89856.1"
FT                   /translation="MEELVTLDCLFIDGTKIEANANKYSFVWKKTTEKFSAKLQEQIQV
FT                   YFQEEITPLLIKYAMFDKEQKRGYKESAKNLANWHYNDKEDSYTHPDGWYYRFHHTKHQ
FT                   KTQTDFQQEIKVYYADEPESAPQKGLYMNERYQNLKAKECQALLSPQGRQIFAQRKIDV
FT                   EPVFGQIKASLGYKRCNLRGK"
FT   gene            complement(611673..611918)
FT                   /locus_tag="SPCG_0605"
FT   CDS_pept        complement(611673..611918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0605"
FT                   /product="degenerate transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89857"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW1"
FT                   /protein_id="ACB89857.1"
FT                   /translation="MHIHYNTNQTTLPLEISSFLPQDHLVFTIEKVVNTLEDCHFHAFY
FT                   HAFDRLSYHLKMLVSTLLFAYSQGIFSGRKIEKWKS"
FT   gene            complement(612129..612449)
FT                   /locus_tag="SPCG_0606"
FT   CDS_pept        complement(612129..612449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89859"
FT                   /db_xref="GOA:B2IMW2"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW2"
FT                   /protein_id="ACB89859.1"
FT                   /translation="MILTLVVCIILTKLFRLKKLGRNFADLAFPVLVFEYYLITTKTFT
FT                   HNFLPRLGLALSILAIILVFFFLLKKRSFYYPKFIKFFWRAGFLLTLIMYIEMIVELFL
FT                   MK"
FT   gene            612424..613089
FT                   /locus_tag="SPCG_0607"
FT   CDS_pept        612424..613089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89858"
FT                   /db_xref="GOA:B2IMW3"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW3"
FT                   /protein_id="ACB89858.1"
FT                   /translation="MQTTKVSINNKIDANFIKIIPILYHKKRLMETRNRGIYRKVRLLR
FT                   LWVIFVIMKVIKSYDTLNDYYRKLFGEKTFKVPIDAGFDCPNRDGTVAHGGCTFCTVSG
FT                   SGDAIVAPDPPIREQFYKEIDFIHRKWPDVQKYLVYFQNFTNTHEKVEVIRERYEQAIN
FT                   EPGVVGINIGTRPDCLPDETIEYLAELSECMHVTVELGLQTTYEATSDLINRAHSYEL"
FT   gene            613090..613536
FT                   /locus_tag="SPCG_0608"
FT   CDS_pept        613090..613536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0608"
FT                   /product="Predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89860"
FT                   /db_xref="GOA:B2IMW4"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW4"
FT                   /protein_id="ACB89860.1"
FT                   /translation="METVKRLRKYPKIEIVSHLINGLPGETHEMMVENVRRCVTDNDIQ
FT                   GIKLHLLHLMTNTRMQRDYHEGRLQLMSQDEYVRVICDQLEIIPKHIVIHRITGDAPRD
FT                   MLIGPMWSLNKWEVLNSIEMEMRRRGSVQGCKAVKQEFENEKTT"
FT   gene            613514..614077
FT                   /locus_tag="SPCG_0609"
FT   CDS_pept        613514..614077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89861"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW5"
FT                   /protein_id="ACB89861.1"
FT                   /translation="MKMKRPLEMAHDFLAEVVTKEDVVVDATMGNGHDTLFLAKLAKQV
FT                   YAFDIQKQALEKTQERLHQAGLTNAQLILQGHETLDQFVTKAKAGIFNLGYLPSADKSV
FT                   ITRPQTTIEALEKLCGLLVKGGRIAIMIYYGHEGGDLERDAVLDFVIQLNQQEYTAAIY
FT                   RTLNQVNNPPFLVMIEKLERYRHG"
FT   gene            614101..614325
FT                   /locus_tag="SPCG_0610"
FT   CDS_pept        614101..614325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89862"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW6"
FT                   /protein_id="ACB89862.1"
FT                   /translation="MPCARILFESTYHERAVGVLDQAHMSKKMLKIKKKLVALEMERCQ
FT                   RKIEHKDCSKIDQKIKEQKEIFESCCKKD"
FT   gene            614300..614401
FT                   /locus_tag="SPCG_0611"
FT   CDS_pept        614300..614401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89863"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW7"
FT                   /protein_id="ACB89863.1"
FT                   /translation="MNPVVKKIKEDVRGITDLPHPIFTGLDCLKYNQ"
FT   gene            614376..616391
FT                   /locus_tag="SPCG_0612"
FT   CDS_pept        614376..616391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0612"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89864"
FT                   /db_xref="GOA:B2IMW8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW8"
FT                   /protein_id="ACB89864.1"
FT                   /translation="MIVSSTTNKLLPFLPLPLVQILLGIVIGLFLPNTDFHLNTELFLA
FT                   LVIGPLLFREAEEADVTAILKHWRIIVYLIFPVIFISTLSLGGLAHLLWFSLPLAACLA
FT                   VGAALGPTDLVAFASLSERFSFPKRVSNILKGEGLLNDASGLVAFQVALTAWTTGAFSL
FT                   GQASSSLIFSILGGFLIGFLTAMTNRFLHTFLLSVRATDIASELLLELSLPLVTFFLAE
FT                   EVHVSGIIAVVVAGILKASRFKKITLLEAQVDTVTETVWHTVTFMLNGSVFVILGMELE
FT                   MIAEPILTNPIYNPLLLLLSLIALTFVLFVIRFIMIYGYYAYRTRRLKKKLNKYMKDMF
FT                   LLTFSGVKGTVSIATILLIPSNLEQEYPLLLFLVAGVTLVSFLTGLLVLPHLSDEEEES
FT                   KDYLMHIAILNEVTLELEKELEDTRNKLSLYAAIDNYHGRIENLILSQENQDDQEDWAA
FT                   LKLLILSIESDGLEQAYEEGNISNRAYRVYQRYLKNIEQGINRKLASRLTYYFLVSLRI
FT                   LRFLLHEVFTLGKTFRSWKNKEQSRLRALDYDQIAELYLANTEMIIESLENLKGVYRRS
FT                   LISFMQESRLRETAIISSGAFVERVINRVKPNNIDEMLRGYYLERKLIFEYEEKRLITT
FT                   KYAKKLRQNVNNLENYSLKEAANTLPYDMVELVRRN"
FT   gene            616555..617430
FT                   /locus_tag="SPCG_0613"
FT   CDS_pept        616555..617430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0613"
FT                   /product="ribonuclease BN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89865"
FT                   /db_xref="GOA:B2IMW9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMW9"
FT                   /protein_id="ACB89865.1"
FT                   /translation="MKEYDMKKWWKELIDKPLLKAFLHYYQASDSELTSVAVAYYWLIS
FT                   IFPLLLVVVNILPYFQIPVGEFLGFMKDVLPPSLYEGVEKIAREVLTQPSTGLLSFSVL
FT                   SALWSFSKSMNFLQKAFNKAYGVEKSRGLISHQMLSLLVSFGLQLLFAFALFLILFGQM
FT                   ILALLAHYWTKDGIIYQALQGLAGPLIYALLFAILVMLYYFLPNLSNRKISYTLPGSAF
FT                   VLLVILGLLTLFSSYLNYYVHHLVDVRILGSVLLVVMMFWFILIAKIVILGAVINASMQ
FT                   SLKDPVFKKD"
FT   gene            617641..618351
FT                   /gene="ccdA"
FT                   /locus_tag="SPCG_0614"
FT   CDS_pept        617641..618351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="SPCG_0614"
FT                   /product="cytochrome c-type biogenesis protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89866"
FT                   /db_xref="GOA:B2IMX0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX0"
FT                   /protein_id="ACB89866.1"
FT                   /translation="MGHIFFFLSVFLAGILSFFSPCILPLLPVYTGVLLDDKDGAQASS
FT                   GKFSISVTSLLRTLAFIAGISFIFILLGYGAGFLGDLLYASWFQYLTGAIIILLGLHQM
FT                   EILHFKGLYKEKRLQLQGQGQNGKGYSQAFLLGLTFSFAWTPCVGPVLGSVLALAASGG
FT                   SGAWQGAGLMLVYTLGLALPFLLLALTSSYVLKHFRKLHPYLGILKKVGGFLIIVMGLL
FT                   VLFGNASILSQLFE"
FT   gene            618344..618937
FT                   /locus_tag="SPCG_0615"
FT   CDS_pept        618344..618937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0615"
FT                   /product="thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89867"
FT                   /db_xref="GOA:B2IMX1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX1"
FT                   /protein_id="ACB89867.1"
FT                   /translation="MNKMERNINMKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMK
FT                   TEQTASKTSAAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTD
FT                   EIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRS
FT                   YPTQAFIDKEGKLVKTHPGFMEKDAILQTLKELA"
FT   gene            618948..620060
FT                   /gene="msrA"
FT                   /locus_tag="SPCG_0616"
FT   CDS_pept        618948..620060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SPCG_0616"
FT                   /product="bifunctional methionine sulfoxide reductase A/B
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89868"
FT                   /db_xref="GOA:B2IMX2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX2"
FT                   /protein_id="ACB89868.1"
FT                   /translation="MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQG
FT                   GKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRVPGVTDAVSGYANGRGETTKYELIN
FT                   QTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDKDLE
FT                   VINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVID
FT                   ASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSK
FT                   DKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDKGGL
FT                   RYCINSLSIRFIPKDQMEEKGYAYLLDYVD"
FT   gene            620400..621155
FT                   /locus_tag="SPCG_0617"
FT   CDS_pept        620400..621155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0617"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89869"
FT                   /db_xref="GOA:B2IMX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX3"
FT                   /protein_id="ACB89869.1"
FT                   /translation="MVKEQIMTYTILIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGR
FT                   QAWELIQKQVPDIILTDINMPHLNGIQLASLVRETYPQVHLVFLTGYDDFDYALSAVKL
FT                   GVDDYLLKPFSRQDIEEMLGKIKQKLDKEEKEEQLQDLLTNRFEGNMAQKIQSHLADSQ
FT                   FSLKSLASDLGFSPTYLSSLIKKELGLPFQDYLVRERVKQAKLLLLTTDLKIYEIAEKV
FT                   GFEDMNYFTQRFKQIAGVTPRQFKKGEDR"
FT   gene            621152..622843
FT                   /locus_tag="SPCG_0618"
FT   CDS_pept        621152..622843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0618"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89870"
FT                   /db_xref="GOA:B2IMX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX4"
FT                   /protein_id="ACB89870.1"
FT                   /translation="MKRSSLLVRMVISIFLVFLILLALVGTFYYQSSSSAIEATIEGNS
FT                   QTTISQTSHFIQSYIKKLETTSTGLTQQTDVLAYAENPSQDKVEGIRDLFLTILKSDKD
FT                   LKTVVLVTKSGQVISTDDSVQMKTSSDMMAEDWYQKAIHQGAMPVLTPARKSDSQWVIS
FT                   VTQELVDAKGANLGVLRLDISYETLEAYLNQLQLGQQGFAFIINENHEFVYHPQHTVYS
FT                   SSSKMEAMKPYIETGQGYTPGHKSYVSQEKIAGTDWTVLGVSSLEKLDQVRSQLLWTLL
FT                   GASVTSLLVCLCLVWFSLKRWIAPLKDLRETMLEIASGAQNLRAKEVGAYELREVTRQF
FT                   NAMLDQIDQLMVAIRSQEETTRQYQLQALSSQINPHFLYNTLDTIIWMAEFHDSQRVVQ
FT                   VTKSLATYFRLALNQGKDLICLSDEINHVRQYLFIQKQRYGDKLEYEINENVAFDNLVL
FT                   PKLVLQPLVENALYHGIKEKEGQGHIKLSVQKQDSGLVIRIEDDGVGFQDAGDSSQSQL
FT                   KRGGVGLQNVDQRLKLHFGANYQMKIDSRPQKGTKVEIYINRIETS"
FT   gene            622938..623522
FT                   /locus_tag="SPCG_0619"
FT   CDS_pept        622938..623522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89871"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX5"
FT                   /protein_id="ACB89871.1"
FT                   /translation="MTTEVTEMNETQIQRETRQVVEDVLEKTNLKQGVLFVLGLSSSEV
FT                   LGGQIGKESSQEIGELIVETILGILGSRGIHLAVQGCEHVNRALVVERQVAEQFDLEIV
FT                   SVHPTLHAGGSGQLAAFKFMQDPVEVEFIKAHAGLDIGDTAIGMHVKHVQVPIRPILRE
FT                   IGHAHVTALASRPKLIGGARAHYPQDAIRKS"
FT   gene            623544..629486
FT                   /gene="zmpB"
FT                   /locus_tag="SPCG_0620"
FT   CDS_pept        623544..629486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zmpB"
FT                   /locus_tag="SPCG_0620"
FT                   /product="zinc metalloprotease ZmpB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89872"
FT                   /db_xref="GOA:B2IMX6"
FT                   /db_xref="InterPro:IPR008006"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX6"
FT                   /protein_id="ACB89872.1"
FT                   /translation="MFKKDRFSIRKIKGVVGSVFLGSLLMAPSVVDAATYHYVNKEIIS
FT                   QEAKDLIQTGKPDRNEVVYGLVYQKDQLPQTGTEASVLTAFGLLTVGSLLLIYKRKKIA
FT                   SVFLVGAMGLVVLPSAEAVDPVATLALASREGVVEMDGYRYVGYLSGDILKTLGLDTVL
FT                   EETSAKPGEVTVVEVETPQSTTNQEQARTENQVVETEEAPKEEAPKTEESPKEEPKSEV
FT                   KPTDDTLPKVEEGKEDSAEPAPVEEVGGEVESKSEEKVAVKPESQPSDKPAEESKVEQA
FT                   GEPVAPREDEKAPVEPEKQPEAPEEEKAVEETPKQEDTQPEVVETKDEAANQPVEEPKV
FT                   ETPAVEKQTEPTEEPKVEQVGEPVEPREDEKAPVSPEKQPEAPEEEKTAEETPKQEDKI
FT                   KGIGTKEPVDKSELNNQIDKASSVSPTDYSTASYNALGPVLETAKGVYASEPVKQPEVN
FT                   SETKAEKVAANTDAKQSEVNSETASLKTAISGLNTDKVELENQLKIAQGKTETDFSMES
FT                   WTVLSTAKNKAQEVKDNGTATQEQINEAEKSLKTALADLSVDKTALGSAIDTATKKNKE
FT                   NYTNQTWAELETVLTAAKSVNTNESKQSEVNEAVEKLTATIEKLVELSEKPRLTLSIEK
FT                   RDIDRKVTVTYTLENPANTQIKSITATLKKGEEVVKDFVLTEENLKTNHLTALFEKLDY
FT                   YKEYTLSTDMVYNRGNDDETESISEELIQLNLKKLELKDIQTVSLMKFENGQESQVTHL
FT                   SDKPTDLSKLYLKVTSSTSKDAVLAVSSIEEEIVENKKIFKIHADTPELVVRKKDGSLS
FT                   KGFDYYMERVIPHDGDIYYDFKDLISAMTSNPTGTFILGRDISSRNVKPDGNGKSYIKG
FT                   EFKGKLLGTNDNVRHSIFDLEYPLFDTIKSGVVKDIDFKHVNMVFPDSNQGDNVATIAR
FT                   VIKDKTKIENVNVEGYLEGRDHVAGLVNNLEGNSEIENISFTGKIKSKGGNSITAGIAG
FT                   RNILSRVKRAYVNANIEVLGSTNSSMLVAVNGTTLNASGGWGAWGRLTESVAKGTLEIK
FT                   RSGQAGGVTATVWPYGAIDKVVSYAKVTKGKELFGSDGDLNNNWFMQKINNIFGVQGIS
FT                   SGDSGNDSKFKRISEEEAKQKVASYNITAPNLMSDSSLLVDRLNESWKNTDQFESIQDY
FT                   QSQNQLIYQNLTKFTPYYNKEFIVHEGNALTPEQEILKTKKIKSIVGLKGTEFVVDGSD
FT                   IDTIMLHFEDGSQKRYKVTSTGKFSITNLPEYQVEDLNVVYTSEHIVHPLDSSLINNLV
FT                   EELKKVELYTESTYQVLGIDKDNANKLNRTKRLFLDESLDAVKTQLPTFVKTMFENEWL
FT                   HINGESSGAVAALRQKIMDNKTAILLALTYINRYYDVKFSDYNIKKLMLFKPTFHGEKI
FT                   DLLDRLIRLGSSGENRLKGSENAETFKQLFASETKQKDLVTYLDYNRSLLTNYQTTGEW
FT                   FKETTKDYIQFEERPSLVEEIKDAKYRVYDNLTAPYYQGYILPLLTLKNTHLAILSNYS
FT                   TMTFVSREKRPNWKNEDFDKWVKYVATAHRNHVDTWYKILPDNIKGKMVKENVTAVWEG
FT                   LSIPGSEWVDQNAVDRKGRDYAPAREFFNLVGGPMGGWYAYHGYGAHAGGRNRVNYEVF
FT                   DVLSEYGISVFTHELTHVNDTWIYLGGYGRRENMGPEAYAQGLFQSPVPGQPGWGALGL
FT                   NMAFERKNDGDLIYNASPTQFENRKELDSYMKNYNDTLMMVDYLEGDAVISKGKEAITK
FT                   WFKKVEPKVVSQTAQYDTVRQLTAEEKEKLSVSSVDDLVDQGLMSDRAVGNNTYNPADF
FT                   ETSYIAIDYMTGIYGGGKNSVGSPGALMFKHNTFRMWGYYGFEEGVLGYASNKFKQASR
FT                   DEGHAGLSDNFIISKISKGEFLTMEAFKKGYFKKVVEELKTKGIRPVTINQKTYSTFEE
FT                   LQEGFKQAVERDLKKNQLDERETRNFKFQVFRQLLQQTDSFKTSIFR"
FT   gene            629547..631268
FT                   /locus_tag="SPCG_0621"
FT   CDS_pept        629547..631268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0621"
FT                   /product="chorismate binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89873"
FT                   /db_xref="GOA:B2IMX7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX7"
FT                   /protein_id="ACB89873.1"
FT                   /translation="MHRKTVIDFRTLGERYTFTQPIKELKTRNVEEVADLLAQVESYQE
FT                   QGYYVVGYVSYEAAPAFEEKLAVHKDPLLGEYLLYFTVHDSVETSPIPLTYEDIDLPSN
FT                   WQEVTSAADYEKAIAQIHHHLRQGDTYQVNYTVQLKQKLSANPFAIYNRMVVEQEAGYN
FT                   AYVEHDEMAVISMSPELFFEQNDRELTTRPMKGTTQRGVTDQEDLEQASWLEQDPKNRS
FT                   ENMMIVDLLRNDMNRISEVGSEHVERLCQVEQYSTVWQMTSTIKSQLREDVDLVEIFRS
FT                   LFPCGSITGAPKIATMEIIKNLEPQPRGVYCGTIGLLLPNGRRIFNVAIRTIQLHKGQA
FT                   IYGVGGGITWDSTWESEYREVHQKAAVLYRKQARFQLITTGEISQKNLLFEDQHLERLR
FT                   KASRYFAFPFDAEDLGHKIEEECQDCEANQDYRLRISLSKSGEIEVNRQVLTPLSTSFC
FT                   QAQVCLQEAALNQSFTYFKTTHRPHLSLGEQEKIYHNKSGELLETSIGNLVLKIAGKLY
FT                   TPPIRLGILPGIYRQHLLETGQVEEKVLTLADLTQAEAIYGCNAVRGLYELSLEEN"
FT   gene            631269..631877
FT                   /locus_tag="SPCG_0622"
FT   CDS_pept        631269..631877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89874"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX8"
FT                   /protein_id="ACB89874.1"
FT                   /translation="MKLIFLHGLGQSAESWKEVRNLLTDYPSEAIELFPSGVSNYQQAK
FT                   ERVYQHLAQETEPFVLIGLSLGAALTLELSSYDLPNLRALILSGCPLKLAGNILFYLQL
FT                   LIFKLLPKRVFEKQGADKTLMVGVSEELKTLDLTDIAGTCSYPTLLICGSKDKPNLSFM
FT                   KALHRLLTDSQFQIIPDGPHVLNKAKPKEFVEKTRSFLE"
FT   gene            631936..632934
FT                   /locus_tag="SPCG_0623"
FT   CDS_pept        631936..632934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0623"
FT                   /product="pneumococcal surface protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89875"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMX9"
FT                   /protein_id="ACB89875.1"
FT                   /translation="MNKRLFLKMSLVTLPILALFSQPVLAEENIHFSSCKEAWANGYSD
FT                   IHEGEPGYSAKLDRDHDGVACELKNAPKGAFKAKQSTAIQINTSSATTSGWVKQDGAWY
FT                   YFDGNGNLVKNAWQGSYYLKADGKMAQSEWIYDSSYQAWYYLKSDGSYAKNAWQGAYYL
FT                   KSNGKMAQGEWVYDSSYQAWYYLKSDGSYARNAWQGNYYLKSDGKMAKGEWVYDATYQA
FT                   WYYLTSDGSYAYSTWQGNYYLKSDGKMAVNEWVDGGRYYVGADGVWKEGQASTVSSSND
FT                   SNSEYSAALGKAKSYNSLFHMSKKRMYRQLTSDFDKFSNDAAQYAIDHLDD"
FT   gene            633043..634020
FT                   /gene="glcK"
FT                   /locus_tag="SPCG_0624"
FT   CDS_pept        633043..634020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="SPCG_0624"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89876"
FT                   /db_xref="GOA:B2IMY0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY0"
FT                   /protein_id="ACB89876.1"
FT                   /translation="MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDE
FT                   GSHIVDDMIESIQHRLDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIK
FT                   QKIEKALGIPFFIDNDANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGV
FT                   AGAAGELGHITVDFDQPISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLID
FT                   NGEEVTAKTVFDLAKEGDDLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGE
FT                   FLLQGVQKVYDENSFPQVRTSTKLALATLGNDAGVIGAASLVLQ"
FT   gene            634117..634956
FT                   /gene="thyA"
FT                   /locus_tag="SPCG_0625"
FT   CDS_pept        634117..634956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SPCG_0625"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89877"
FT                   /db_xref="GOA:B2IMY1"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY1"
FT                   /protein_id="ACB89877.1"
FT                   /translation="MTKADTIFKENIERILKEGVFSEQARPKYKDGTVANSKYVTGAFS
FT                   EYDLSKGEFPITTLRPIAIKSAIKEVLWIYQDQSNSLEVLNDKYNVHYWNDWEVGDTGT
FT                   IGERYGAVVKKHDIINKLLKQLETNPWNRRNIISLWDYQAFEETDGLLPCAFQTMFDVR
FT                   RIDGEIYLDATLTQRSNDMLVAHHINAMQYVALQMMIAKHFGWKVGKFFYFINNLHIYD
FT                   NQFEQAQELLRREPSNCQPRLVLNVPDGTNFFDIKAEDFELVDYDPVKPQLKFDLAI"
FT   gene            complement(635004..635174)
FT                   /locus_tag="SPCG_0626"
FT   CDS_pept        complement(635004..635174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89879"
FT                   /db_xref="InterPro:IPR021402"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY2"
FT                   /protein_id="ACB89879.1"
FT                   /translation="MAKGFAKGLVTGVAGTVAAVAGAVYAFKKKVIEPEEQKAAFIEEN
FT                   RKKAARRRVSR"
FT   gene            635050..635238
FT                   /locus_tag="SPCG_0627"
FT   CDS_pept        635050..635238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89878"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY4"
FT                   /protein_id="ACB89878.1"
FT                   /translation="MKAAFCSSGSITFFLNAYTAPATAATVPATPVTRPLANPLAMSLP
FT                   PLYSQSASLLKRSHFSD"
FT   gene            635244..636179
FT                   /gene="miaA"
FT                   /locus_tag="SPCG_0628"
FT   CDS_pept        635244..636179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SPCG_0628"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89880"
FT                   /db_xref="GOA:B2IMY5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMY5"
FT                   /protein_id="ACB89880.1"
FT                   /translation="MCYNNSNEKMGIFQGKKMKTKIIVIVGPTAVGKTALAIEVAKRFN
FT                   GEVVSGDSQQVYRGLDIGTAKASPEEQAAVPHHLIDVREITESYSAFDFVSEAKMTIEG
FT                   IHNRGKLAIIAGGTGLYIQSLLEGYHLGGETPHEEILAYRASLEPYSDEELAHLVDQAG
FT                   LEIPQFNRRRAMRALEIAHFGQDLENQETLYEPLIICLDDERSQLYERINHRVDLMFEA
FT                   GLLDEAKWLFDHSPNVQAAKGIGYKELFPYFRGEQTLEEASESLKQATRRFAKRQLTWF
FT                   RNRMQVTFYQIGESGVQDRILSQIEEFLDD"
FT   gene            636172..637410
FT                   /locus_tag="SPCG_0629"
FT   CDS_pept        636172..637410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0629"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89881"
FT                   /db_xref="GOA:B2IMY6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY6"
FT                   /protein_id="ACB89881.1"
FT                   /translation="MIETEKKEERVLLIGVELQGMDSFDLSMEELASLAKTAGAVVVDS
FT                   YRQKREKYDSKTFVGSGKLEEIALMVDAEEITTVIVNNRLTPRQNVNLEEVLGVKVIDR
FT                   MQLILDIFAMRARSHEGKLQVHLAQLKYLLPRLVGQGIMLSRQAGGIGSRGPGESQLEL
FT                   NRRSVRNQITDIERQLKVVEKNRATVREKRLESSTFKIGLIGYTNAGKSTIMNILTSKT
FT                   QYEADELFATLDATTKSIHLGGNLQVTLTDTVGFIQDLPTELVSSFKSTLEESKHVDLL
FT                   VHVIDASNPYHEEHEKTVLSIMKDLDMEDIPHLTLYNKADLVEDFTPTQTPYTLISAKS
FT                   EDSRENLQALLLDKIKEIFEAFTLRVPFSKSYKIHDLESVAILEERDYQEDGEVITGYI
FT                   SEKNKWRLEEFYD"
FT   gene            637403..638026
FT                   /locus_tag="SPCG_0630"
FT   CDS_pept        637403..638026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89882"
FT                   /db_xref="UniProtKB/TrEMBL:B2IMY7"
FT                   /protein_id="ACB89882.1"
FT                   /translation="MTDIKTLALKYGGYTSLDKVYLDQLLAGKTEQEQLTLITPPPSVV
FT                   NAYFAELYQKKSPQAATDYFAELSQELNLYNTEPSFTLENKPFIRLNLSGKSFGFCYES
FT                   DGFGRIFSENEEKISDDLLFEIAQIFSHQLVFEESGKIYMKPVKDEEVVSLESLTALTD
FT                   LERLADGRKRLKGYSQEDLLQEAAAFSGKRYFRSENRTAMLYID"
FT   gene            638041..638970
FT                   /locus_tag="SPCG_0631"
FT   CDS_pept        638041..638970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0631"
FT                   /product="ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89883"
FT                   /db_xref="GOA:B2IMY3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IMY3"
FT                   /protein_id="ACB89883.1"
FT                   /translation="MDIQFLGTGAGQPSKARNVSSLALKLLDEINEVWLFDCGEGTQNR
FT                   ILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAFQANEEQTDLEIYGPQGIKSFVLT
FT                   SLRVSGSRLPYRIHFHEFDQDSLGKILETDKFTVYAEELDHTIFCVGYRVMQKDLEGTL
FT                   DAEKLKAAGVPFGPLFGKIKNGQDLVLEDGTEIKAADYISAPRPGKIITILGDTRKTDA
FT                   SVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLS
FT                   KDISKLKKDAATIFENVHVVKDLEEVEI"
FT   gene            638991..639746
FT                   /locus_tag="SPCG_0632"
FT   CDS_pept        638991..639746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0632"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89884"
FT                   /db_xref="GOA:B2IN65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN65"
FT                   /protein_id="ACB89884.1"
FT                   /translation="MPTILITGASGGLAQEMVKLLPNDQLILLGRNKEKLAQLYGNYSH
FT                   AELIEIDITDDSALEALVTDLYLRYGKIDVLINNAGYGIFEGFDQIADKDIHQMFEVNT
FT                   FALMNLSRHLAARMKESSKGHIINIVSMAGLIATGKSSLYSATKFAAIGFSNALRLELM
FT                   PYGVYVTTVNPGPIRTGFFDQADPDGTYLKSVDRFLLEADAVAKKIVKIIGKNKRELNL
FT                   PILLNLAHKFYTLFPKLADKLAGETFNYK"
FT   gene            complement(639800..640798)
FT                   /locus_tag="SPCG_0633"
FT   CDS_pept        complement(639800..640798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0633"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89886"
FT                   /db_xref="GOA:B2IN66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN66"
FT                   /protein_id="ACB89886.1"
FT                   /translation="MCFFQEETHTMLLIFLSSLAILRQVWYNKNMRIQQLHYIIKIVET
FT                   GSMNEAAKQLFITQPSLSNAVRDLENEMGIEIFIRNPKGITLTRDGMEFLSYARQVVEQ
FT                   TQLLEERYKNPVAHRELFSVSSQHYAFVVNAFVSLLKKSDMEKYELFLRETRTWEIIDD
FT                   VKNFRSEVGVLFLNSYNRDVLTKMLDDNHLLAHHLFTAQPHIFVSKTNPLAKKDKVKLS
FT                   DLENFPYLSYDQGTHNSFYFSEEILSQEHHKKSIVVSDRATLFNLLIGLDGYTIATGIL
FT                   NSNLNGDNIVSIPLDIDDPIELVYIQHEKTSLSKMGERFIDYLLEEVQFDS"
FT   gene            640772..641041
FT                   /locus_tag="SPCG_0634"
FT   CDS_pept        640772..641041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89885"
FT                   /db_xref="InterPro:IPR009256"
FT                   /db_xref="InterPro:IPR023164"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN67"
FT                   /protein_id="ACB89885.1"
FT                   /translation="MSLFLKKTQNFARMSLMKTFYDVQQFLKRFGIIVYMGKRLYDIEL
FT                   MKLELSRIYDAGLMDKLDYLEAEAVLRREHKVELDYIEKNGEKN"
FT   gene            641041..641421
FT                   /locus_tag="SPCG_0635"
FT   CDS_pept        641041..641421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89887"
FT                   /db_xref="GOA:B2IN68"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN68"
FT                   /protein_id="ACB89887.1"
FT                   /translation="MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQL
FT                   IDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQ
FT                   GFSEIYILSYGLDSWKGKVKTS"
FT   gene            641540..641737
FT                   /locus_tag="SPCG_0636"
FT   CDS_pept        641540..641737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89888"
FT                   /db_xref="GOA:B2IN69"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN69"
FT                   /protein_id="ACB89888.1"
FT                   /translation="MGILSIILGLLFPIVGLILGIIGLVLAISYQKESQLDYKIEKILN
FT                   ILGIVISVVNWIVAIALIFR"
FT   gene            complement(641777..642502)
FT                   /gene="rsuA"
FT                   /locus_tag="SPCG_0637"
FT   CDS_pept        complement(641777..642502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="SPCG_0637"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89889"
FT                   /db_xref="GOA:B2IN70"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN70"
FT                   /protein_id="ACB89889.1"
FT                   /translation="MRLDNLLAQEKVSRKAMKQALLRGEILVDGCPARSLAQNIDTGLQ
FT                   ELLFQDRIIQGYEHTYLMLHKPAGVVTANKDKELPTVMDLLPSDIQSDKLYAVGRLDRD
FT                   TTGLLLLTDNGPLGFQLLHPQYHVDKTYQVEVNGLLTPDHIQAFQKGIVFLDGTVCKPA
FT                   KLEILSASPSLSQASITISEGKFHQIKKMFLSVGVKVTSLKRIQFGDFTLNPDLAEGNY
FT                   RPLNQKELQIIKNYLEMSR"
FT   gene            642643..644505
FT                   /locus_tag="SPCG_0638"
FT   CDS_pept        642643..644505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0638"
FT                   /product="elongation factor Tu family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89890"
FT                   /db_xref="GOA:B2IN71"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN71"
FT                   /protein_id="ACB89890.1"
FT                   /translation="MNIIEEIMTKLREDIRNIAIIAHVDHGKTTLVDELLKQSETLDAR
FT                   TELAERAMDSNDIEKERGITILAKNTAVAYNGTRINIMDTPGHADFGGEVERIMKMVDG
FT                   VVLVVDAYEGTMPQTRFVLKKALEQDLVPIVVVNKIDKPSARPAEVVDEVLELFIELGA
FT                   DDDQLDFPVVYASAINGTSSLSDDPADQEATMAPIFDTIIDHIPAPVDNSDEPLQFQVS
FT                   LLDYNDFVGRIGIGRVFRGTVKVGDQVTLSKLDGTTKNFRVTKLFGFFGLERREIQEAK
FT                   AGDLIAVSGMEDIFVGETITPTDAVEALPILHIDEPTLQMTFLVNNSPFAGKEGKWVTS
FT                   RKVEERLQAELQTDVSLRVDPTDSPDKWTVSGRGELHLSILIETMRREGYELQVSRPEV
FT                   IVKEIDGVKCEPFERVQIDTPEEYQGSVIQSLSERKGEMLDMISTGNGQTRLVFLVPAR
FT                   GLIGYSTEFLSMTRGYGIMNHTFDQYLPLIPGEIGGRHRGALVSIDAGKATTYSIMSIE
FT                   ERGTIFVNPGTEVYEGMIIGENSRENDLTVNITKAKQMTNVRSATKDQTAVIKTPRILT
FT                   LEESLEFLNDDEYMEVTPESIRLRKQILNKAEREKANKKKKSAE"
FT   gene            644525..644779
FT                   /locus_tag="SPCG_0639"
FT   CDS_pept        644525..644779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89891"
FT                   /db_xref="GOA:B2IN72"
FT                   /db_xref="InterPro:IPR021506"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN72"
FT                   /protein_id="ACB89891.1"
FT                   /translation="MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLS
FT                   FLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR"
FT   gene            645326..645442
FT                   /locus_tag="SPCG_0640"
FT   CDS_pept        645326..645442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89892"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN73"
FT                   /protein_id="ACB89892.1"
FT                   /translation="MSRWDGHSDKGEAPAGKTSYAWIWTKWGEQVAFYCDYD"
FT   gene            645513..647534
FT                   /locus_tag="SPCG_0641"
FT   CDS_pept        645513..647534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89893"
FT                   /db_xref="GOA:B2IN74"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="InterPro:IPR016976"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN74"
FT                   /protein_id="ACB89893.1"
FT                   /translation="MKKLFILLSTFFLSFFLAWIIVLRAPQYLYASYDSVSLLRVKKDT
FT                   QEPTREVFEQELENFANSEQSLIARRIVEPSKDGTTHFTYATYGQGTLPKEFQEASQES
FT                   RERSDPLNSYLLLSGSLTKEKLADKLGDLGYKASADRKIPPYFLAFRILLNPLILISLA
FT                   IFGLSFFALVIITRIKEMRAAGIKLFSGQTLLSIMGHSLSTDIKWLLLSTLLSFLGGGV
FT                   VLFSQGLFYPILLATYGFGISFYLLFLLAISILLMLLYLMSLNYKALVPVIKGRLPLKR
FT                   LMILTLLCQLVAVFTVGYAVKTGLTSYQRLKELEISKQAWQDRADYYQISFGLGDRGKD
FT                   TENQSKWYAFAKEAIEEEQALYVKDNLLHFANPQGKNEQGETLDTYSPDANTLYVSPSY
FT                   LDKEKVVVDAETKQKLAHLQKGEFILLLPEHLRSREAELKKVFEERLSYYGKSGEEASA
FT                   PLDYEMKAHVSYLSMGEKRFVYNNGENPVSTQYLTDPILVVFTPTSTGDSFISLSSWSI
FT                   NAGKQLFIKGYESGLELLKKVGIYEQVSYLKEGRSVYLTRYNEVQTETATLILGAIVGI
FT                   ASSLLLFYSVNLLYFEQFRRDILIKRISGLRFFETHAQYMVSQFASFVFGASLFILSSR
FT                   DLVIGLLTLLVFLASAVLTLYRQAQKESRVSMTIMKGK"
FT   gene            647536..648177
FT                   /locus_tag="SPCG_0642"
FT   CDS_pept        647536..648177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0642"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89894"
FT                   /db_xref="GOA:B2IN75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN75"
FT                   /protein_id="ACB89894.1"
FT                   /translation="MIELKNISKKFGSRQLFSDTNLHFEGGKIYALIGTSGCGKTTLLN
FT                   MIGRLEPYDKGQIIYDGTSLKDIKPSIFFRDYLGYLFQDFGLIESQTVKENLNLGLVGK
FT                   KLKEKEKISLMKQALNRVNLSYLDLKQPIFELSGGEAQRVALAKIILKDPPLILADEPT
FT                   ASLDPKNSEELLSILESLKNPNRTIIIATHNPLIWEQVDQVIRVTDLSHR"
FT   gene            648281..649633
FT                   /gene="murD"
FT                   /locus_tag="SPCG_0643"
FT   CDS_pept        648281..649633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SPCG_0643"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89895"
FT                   /db_xref="GOA:B2IN76"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IN76"
FT                   /protein_id="ACB89895.1"
FT                   /translation="MKVIDQFKNKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFED
FT                   NPAAQSLLEEGIKVITGGHPLELLDEEFALMVKNPGIPYNNPMIEKALAKGIPVLTEVE
FT                   LAYLISEAPIIGITGSNGKTTTTTMIGEVLTAAGQHGLLSGNIGYPASQVAQTASDKDT
FT                   LVMELSSFQLMGVQEFHPEIAVITNLMPTHIDYHGSFSEYVAAKWNIQNKMTAADFLVL
FT                   NFNQDLAKDLTSKTEATVVPFSTLEKVDGAYLEDGQLYFRGEVVMAANEIGVPGSHNVE
FT                   NALATIAVAKLRDVDNQTIKETLSAFGGVKHRLQFVDDIKGVKFYNDSKSTNILATQKA
FT                   LSGFDNSKVVLIAGGLDRGNEFDELVPDITGLKKMVILGQSAERVKRAADKAGVAYVEA
FT                   TDIADATRKAYELATQGDVVLLSPANASWDMYANFEVRGDLFIDTVAELKE"
FT   gene            649635..650693
FT                   /gene="murG"
FT                   /locus_tag="SPCG_0644"
FT   CDS_pept        649635..650693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SPCG_0644"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89896"
FT                   /db_xref="GOA:B2IN77"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IN77"
FT                   /protein_id="ACB89896.1"
FT                   /translation="MKKIVFTGGGTVGHVTLNLLLMPKFIEDGWEVHYIGDKRGIEHQE
FT                   ILKSGLDVTFHSIATGKLRRYFSWQNMLDVFKVGWGIVQSLFIMLRLRPQTLFSKGGFV
FT                   SVPPVIAARVSGVPVFIHESDLSMGLANKIAYKFATKMYSTFEQASSLSKVEHVGAVTK
FT                   VSDQKNPEPDELVDIQTHFNPKLPTVLFVGGSAGARVFNQLVTDHKKELTERYNIINLT
FT                   GDSSLNELSQNLFRVDYVTDLYQPLMELADIVVTRGGANTIFELLAIAKLHVIVPLGRE
FT                   ASRGDQIENAAYFVKKGYAEDLQESDLTLDSLEEKLSHLLSHKEDYQAKMKASKELKSL
FT                   ADFYQLLKKDLS"
FT   gene            650703..651902
FT                   /gene="divIB"
FT                   /locus_tag="SPCG_0645"
FT   CDS_pept        650703..651902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIB"
FT                   /locus_tag="SPCG_0645"
FT                   /product="cell division protein DivIB"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89897"
FT                   /db_xref="GOA:B2IN78"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN78"
FT                   /protein_id="ACB89897.1"
FT                   /translation="MSKDKKNEDKETLEELKELSEWQKRNQEYLKKKAEEEAALAEEKE
FT                   KERQARMGEESEKSEDKQDQESETDQEDSESAKEESEEKVASSEADKEKEEKEEPESKE
FT                   KEEQDKKLAKKATKEKPAKAKIPGIHILRAFTILFPSLLLLIVSAYLLSPYATMKDIRV
FT                   EGTVQTTADDIRQASGIQDSDYTINLLLDKAKYEKQIKSNYWVESAQLVYQFPTKFTIK
FT                   VKEYDIVAYYISGENHYPILSSGQLETSSVSLNSLPETYLSVLFNDSEQIKVFVSELAQ
FT                   ISPELKAAIQKVELAPSKVTSDLIRLTMNDSDEVLVPLSEMSKKLPYYSKIKPQLSEPS
FT                   VVDMEAGIYSYTVADKLIMEAEEKAKQEAKEAEKKQEEEQKKQEEESNRNQTNQRSSRR
FT                   "
FT   gene            652012..652158
FT                   /locus_tag="SPCG_0646"
FT   CDS_pept        652012..652158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89898"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN79"
FT                   /protein_id="ACB89898.1"
FT                   /translation="MMKKVTHMSDEVFLFEEIEEIVAPTDGEFLGEVLLGTGVVLLIGV
FT                   ACC"
FT   gene            652170..652301
FT                   /locus_tag="SPCG_0647"
FT   CDS_pept        652170..652301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89899"
FT                   /db_xref="GOA:B2IN80"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN80"
FT                   /protein_id="ACB89899.1"
FT                   /translation="MIIMQDNFLFEEIEEISVPVSDFSAGLATGIGFGLAILALAGC"
FT   gene            652642..653490
FT                   /locus_tag="SPCG_0648"
FT   CDS_pept        652642..653490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89900"
FT                   /db_xref="GOA:B2IN81"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN81"
FT                   /protein_id="ACB89900.1"
FT                   /translation="MLVGKKYYLRFYIVLSKMGLIDSMKSRKKINIFKISWDFNITLSE
FT                   KLNYKRFNKNFEKILFGIFPLALILQCFIMYIYRADILTNFQNFPITLNILLFWLLVVI
FT                   ISATIHEFSHAIIANNYQIEIPNCGIMLLLFNLAFFVDLSGVQFLKNKKQFLKIMLAGI
FT                   ASNSILSFTGLLVLLFTSYKLLGLLFFIINLGMIFINSIPFFQYDSGIILRYLNSNNNN
FT                   LNFQYIVQLLIAFVIIYFPLSQLLQFLTPNIIVRSIGGVVVSILLSILYMIGRTKYVLR
FT                   K"
FT   gene            653820..654560
FT                   /locus_tag="SPCG_0649"
FT   CDS_pept        653820..654560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0649"
FT                   /product="HesA/MoeB/ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89901"
FT                   /db_xref="GOA:B2IN82"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN82"
FT                   /protein_id="ACB89901.1"
FT                   /translation="MYGVRKLIVADYDIIEPSNLNRQILYTESDVGKEKINVLSEKIHK
FT                   YNSDVQVVPISIKVSSLEELEKIVAEYGSIDFIVKAIDTPIDIIKIVNQFAVSHKISYI
FT                   SGGFNGCYLIIDNIYIPTIGSCFGCRNINKDINKYTLSDKTKWPTTPEMPAILGGIMTN
FT                   LIIKIFLGCYNETLIDNAYVYNMRNHALSQEKYVLENGECPICKKNNKVKDNNIRAKTF
FT                   IRSVCFCLLSGGVAFYLLLGSSLL"
FT   gene            655000..655875
FT                   /locus_tag="SPCG_0650"
FT   CDS_pept        655000..655875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0650"
FT                   /product="ABC transporter ATP-binding protein-unknown
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89902"
FT                   /db_xref="GOA:B2IN83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN83"
FT                   /protein_id="ACB89902.1"
FT                   /translation="MLSKNVEYKGGAMSMIEVSHLSKSFGDKIALNDISFTVKEGQIFG
FT                   FLGPSGSGKTTTINILTGQLLADKGQSIILGQKSQNLTSGELKRIGLVSDTSGFYEKMS
FT                   LYNNLLFYSKFYNISKLRVDNLLKRVGLYDSCKMVAGKLSTGMRQRMLLARALINKPAV
FT                   LFLDEPTSGLDPTTSRTIHELILELKTAGTTIFLTTHDMNEATLLCDYVALLNKGKLVE
FT                   QGAPSELIQRYNKDKKIKVTDYNGNQITFDFTSLEQVSQADLENIFSIHSCEPTLEDIF
FT                   ITLTGGKLNA"
FT   gene            655868..656581
FT                   /locus_tag="SPCG_0651"
FT   CDS_pept        655868..656581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89903"
FT                   /db_xref="GOA:B2IN84"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN84"
FT                   /protein_id="ACB89903.1"
FT                   /translation="MLKRFLALVWLRCQIILSNKSILLQVLVPFAFTYFYKYLMETQGK
FT                   VNDQQALVLLMMCLPFSLALAVGSPITIILSEEKEKYNLQTLLLSGVKGSEYILSTMFL
FT                   PFLLTFVIMGTTPLILGVTIVHTFNYITIVLLTSLSIILFYLLIGLTAKSQVVAQVISL
FT                   PAMILVAFLPMLSGLDKTVAKITDYSFMGLFTKFFTKWEGFSWNETLIPNLTLLIWIVL
FT                   LLTLITITIRKKKIS"
FT   gene            complement(656855..656998)
FT                   /locus_tag="SPCG_0652"
FT   CDS_pept        complement(656855..656998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89904"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN85"
FT                   /protein_id="ACB89904.1"
FT                   /translation="MGILFYFADAYSSWQRGSNENANGLLREYFLKPIWQQLPKKSLMV
FT                   LC"
FT   gene            657316..658017
FT                   /gene="pyrF"
FT                   /locus_tag="SPCG_0653"
FT   CDS_pept        657316..658017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="SPCG_0653"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89905"
FT                   /db_xref="GOA:B2IN86"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IN86"
FT                   /protein_id="ACB89905.1"
FT                   /translation="MREHRPIIALDFPSFEAVKEFLALFPAEESLYLKVGMELYYAAGP
FT                   EIVSYLKGLGHSVFLDLKLHDIPNTVKSAMKILSQLGVDMTNVHAAGGVEMMKAAREGL
FT                   GSQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVCSAQEVQVI
FT                   KQATNPDFICLTPGIRPAGVAVGDQKRVMTPADAYQIGSDYIVVGRPITQAEEPVAAYH
FT                   AIKDEWTQDWN"
FT   gene            658051..658683
FT                   /gene="pyrE"
FT                   /locus_tag="SPCG_0654"
FT   CDS_pept        658051..658683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="SPCG_0654"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89906"
FT                   /db_xref="GOA:B2IN87"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN87"
FT                   /protein_id="ACB89906.1"
FT                   /translation="MTLAKDIASHLLKIQAVYLKPEEPFTWASGIKSPIYTDNRVTLAY
FT                   PETRTLIENGFVEAIKEAFPEVEVIAGTATAGIPHGAIIADKMDLPFAYIRSKPKDHGA
FT                   GNQIEGRVAQGQKMVVVEDLISTGGSVLEAVAAAKREGADVLGVVAIFSYQLPKADKNF
FT                   ADAGVKLVTLSNYSDLIHLAQEEGYITPEGLYLLKRFKEDQENWQEG"
FT   gene            659362..660126
FT                   /locus_tag="SPCG_0655"
FT   CDS_pept        659362..660126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89907"
FT                   /db_xref="GOA:B2IN88"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN88"
FT                   /protein_id="ACB89907.1"
FT                   /translation="MEFFICNLVRVVQSPRFYMSLFLTLLCMSLGNFLAFNGIYKIEGL
FT                   SIFFAASSIRGFSPISLVAALICTLPYSSQIIEDAESHFLTAQLCRISKKRYLAIVGST
FT                   AIISSFLVFFLPYLLLLGINLLVTPYQEIYIGDYSGALKELFDSNQLLYSLVTTLWYGV
FT                   WGAVFSIFGLASALLVKKKLGAIFIPVAYMMVGGILWAILGLSYLEPVTTLALGYQKDI
FT                   SLSLVSAHLAFILFVSCLVVYGTFFLHSEDYV"
FT   gene            660881..661585
FT                   /locus_tag="SPCG_0656"
FT   CDS_pept        660881..661585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89908"
FT                   /db_xref="GOA:B2IN89"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN89"
FT                   /protein_id="ACB89908.1"
FT                   /translation="MEMGKLSSHMWRLNQIIYTKYFWGYVLFWILICLGLWYWLEGNDR
FT                   LVIEILKGPNLSQNSFLVLSIWLLHWFIIHTFFLAVVYRRRASDFFMEVIRFSSIKLWI
FT                   RYQIWTCFLYGLILIMVKVLVIQFMLQLPNWDIGVLFIVDSLNACVLVLFCFMLYALGA
FT                   NVQMNFACVSFFLLMIVFGGLFVGNRTNYLFYILNRGNGDIGRDLFLQLLFLVFLFKSI
FT                   FYFTRQKRRFIE"
FT   gene            661582..662229
FT                   /locus_tag="SPCG_0657"
FT   CDS_pept        661582..662229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0657"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89909"
FT                   /db_xref="GOA:B2IN90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN90"
FT                   /protein_id="ACB89909.1"
FT                   /translation="MNEIIILKNIELKLKKTCVFQNLNFSCKQGEIIGITGANGSGKSV
FT                   LFKLIAGLYSPSYGEVLINGENIVPERKIPANLGALIEEPGFINYYSGFKNLQYLASIR
FT                   GVVGNQEINDTLKIVGLYEQKDQKVKTYSLGMRKKLGIAQAIMENPSILLLDEPMNALD
FT                   KSSVENMRTLFRKLSSEKGTTILIASHSEEDIRILCDKVYAIEDKVCTLCSD"
FT   gene            complement(662309..663169)
FT                   /locus_tag="SPCG_0658"
FT   CDS_pept        complement(662309..663169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0658"
FT                   /product="amino acid (glutamine) ABC transporter substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89910"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN91"
FT                   /protein_id="ACB89910.1"
FT                   /translation="MKLFKPLLTVLALAFALIFITACSSGGNAGSSSGKTTAKARTIDE
FT                   IKKSGELRIAVFGDKKPFGYVDNDGSYQGYDIELGNQLAQDLGVKVKYISVDAANRAEY
FT                   LISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGLITDVKQLEGKTLIVTK
FT                   GTTAETYFEKNHPEIKLQKYDQYSDSYQALLDGRGDAFSTDNTEVLAWALDNKGFEVGI
FT                   TSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHPTYGDAAKADDLV
FT                   VEGGH"
FT   gene            complement(663181..663939)
FT                   /locus_tag="SPCG_0659"
FT   CDS_pept        complement(663181..663939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0659"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89911"
FT                   /db_xref="GOA:B2IN92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN92"
FT                   /protein_id="ACB89911.1"
FT                   /translation="MSETILEIKELKKSFGDNPILQGLSLEIKKGEVVVILGPSGCGKS
FT                   TLLRCLNGLESIQGGDIFLDGQSIVENKKDFHLVRQKIGMVFQSYELFPHLDVLQNLIL
FT                   GPIKTQGRDKKEVTEEALQLLDRVGLLDKQHSFARQLSGGQKQRVAIVRALLMHPEIIL
FT                   FDEVTASLDPEMVREVLELINDLAQEGRTMILVTHEMQFAQAIADRIIFLDQGKIAEEG
FT                   TAQAFFTNPQTKRAQEFLNVFDFSQFGSYL"
FT   gene            complement(663940..664857)
FT                   /locus_tag="SPCG_0660"
FT   CDS_pept        complement(663940..664857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0660"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89912"
FT                   /db_xref="GOA:B2IN93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN93"
FT                   /protein_id="ACB89912.1"
FT                   /translation="MYIAVWGSLGSFLLGLIVSIIRHYRIPVLAQVATAYIELSRNTPL
FT                   LIQLFFLYFGLPRIGIVLSSEVYATLGLVFLGGSAMQDSGIQVLFQGNNLLRILQGLGV
FT                   TIGISILSVLLSMMFGTVMGIIMTSHSRIIRFLTRLYLEFIRIMPQLVLLFIVYFGLAR
FT                   NFNINISGETSVIIVFTLWGTAEMGDLVRGAITSLPKHQFESGQALGLTNVQLYYHIII
FT                   PQVLRRLLPQAINLVTRMIKTTSLVVLIGVVEVTKVGQQIIDSNRLTIPTTSFWIYGTI
FT                   LILYFAVCYPISKLSTHLEKHWRN"
FT   gene            664890..665036
FT                   /locus_tag="SPCG_0661"
FT   CDS_pept        664890..665036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89913"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN94"
FT                   /protein_id="ACB89913.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   SFQ"
FT   gene            665164..666654
FT                   /gene="lysS"
FT                   /locus_tag="SPCG_0662"
FT   CDS_pept        665164..666654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SPCG_0662"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89914"
FT                   /db_xref="GOA:B2IN95"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IN95"
FT                   /protein_id="ACB89914.1"
FT                   /translation="MSTEHMEELNDQQIVRREKMAALREQGIDPFGKRFERTANSQELK
FT                   DKYANLDKEQLHDKNETATIAGRLVTKRGKGKVGFAHLQDREGQIQIYVRKDAVGEENY
FT                   EIFKKADLGDFLGVEGEVMRTDMGELSIKATHITHLSKALRPLPEKFHGLTDVETIYRK
FT                   RYLDLISNRESFERFVTRSKIISEIRRYLDQKGFLEVETPVLHNEAGGAAARPFITHHN
FT                   AQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADF
FT                   QDIMDLTEGIIQHAAKSVKGDGPVNYQGTEIKINKPFKRVHMVDAIKEITGVDFWQDMT
FT                   LEEAKAIAAEKKVPVEKHYTEVGHIINAFFEEFVEETLIQPTFVYGHPVAVSPLAKKNP
FT                   EDQRFTDRFELFIMTKEYGNAFTELNDPIDQLSRFEAQAKAKELGDDEATGIDYDYIEA
FT                   LEYGMPPTGGLGIGIDRLCMLLTDTTTIRDVLLFPTMK"
FT   gene            667278..668414
FT                   /gene="lctO"
FT                   /locus_tag="SPCG_0663"
FT   CDS_pept        667278..668414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctO"
FT                   /locus_tag="SPCG_0663"
FT                   /product="lactate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89915"
FT                   /db_xref="GOA:B2IN96"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN96"
FT                   /protein_id="ACB89915.1"
FT                   /translation="MSYKTSNAEGHVDFINTYDLEPMAQQVIPKAAFGYIASGAEDTFT
FT                   LRENIRAFNHKLIVPHTLCDVENPSTEIEFAGEKLSSPIIMAPVAAHKLANEQGEVATA
FT                   RGVHEFGSLYTTSSYSTVDLPEISEALQGTPHWFQFYFSKDDGINRHIMDRVKAEGYKA
FT                   IVLTADATVGGNREVDKRNGFVFPVGMPIVEEYLPEGAGKSMDFVYKSAKQRLSPRDVE
FT                   FIAEYSGLPVYVKGPQCREDVERSLAAGASGIWVTNHGGRQIDGGPAAFDSLQEVAEAV
FT                   DKRVPIVFDSGVRRGQHVFKALASGADLVAIGRPVIYGLALGGSVGVRQVFEHLNAELK
FT                   TVMQLSGTQTIEDVKHFKLRHNPYNPTFPVDPRDLKLY"
FT   gene            668971..669639
FT                   /locus_tag="SPCG_0664"
FT   CDS_pept        668971..669639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0664"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89916"
FT                   /db_xref="GOA:B2IN97"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN97"
FT                   /protein_id="ACB89916.1"
FT                   /translation="METQDYAFQPGLTVGELLKSSQKDWQAAINHRFVKELFAGTIENK
FT                   VLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKELK
FT                   VAENDYLEVTLHPVTKAFQDLMYWAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVY
FT                   IHSEWINLHRGPFFAEWVQFLVDELNRVGKNREDLTELQQRWNQAVALELAFFDIGYDV
FT                   "
FT   gene            complement(669636..669881)
FT                   /locus_tag="SPCG_0665"
FT   CDS_pept        complement(669636..669881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89917"
FT                   /db_xref="UniProtKB/TrEMBL:B2IN98"
FT                   /protein_id="ACB89917.1"
FT                   /translation="MNDLYSMKIKEQTRKLTADCSKHCFEPVDKTDEVSSKHCFEVVDR
FT                   TDEVSNHTYGKVKLTWFEEIFEESYLIKFVNIMSLL"
FT   gene            669944..670747
FT                   /gene="thiM"
FT                   /locus_tag="SPCG_0666"
FT   CDS_pept        669944..670747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SPCG_0666"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89918"
FT                   /db_xref="GOA:B2IN99"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IN99"
FT                   /protein_id="ACB89918.1"
FT                   /translation="MKRKDFNMTSLKLLKEKAPLVICITNDVVKNFTANGLVALGASPA
FT                   MSEFPADLEDLLKYAGGLLINIGTLTDENWKLYQAALKIAEKYNVPVVLDPVACGAGEY
FT                   RKKVADDLINNYKLAAIRGNAGEIASLVGIDVASKGVDSAGVDNIDEIALAANEKFNIP
FT                   IVVTGEVDAIAVNGEVVTIHNGSAMMPKVIGTGCLLGAVVASFIGLEKGQELKSLETAM
FT                   LVYNIAGEMAEKRPNGHLPGTFKVEFINALYEITDEDVKEFKRVK"
FT   gene            670749..671378
FT                   /gene="thiE"
FT                   /locus_tag="SPCG_0667"
FT   CDS_pept        670749..671378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="SPCG_0667"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89919"
FT                   /db_xref="GOA:B2INA0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA0"
FT                   /protein_id="ACB89919.1"
FT                   /translation="MFHKELLKLYFICGTTTCQGKNLYTVVEEALRGGITLFQFREKGE
FT                   GALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLM
FT                   PDKIIGLSIKNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGVKLMRKLLPQM
FT                   PLVAIGGIQTKHIKDIMKTNVDGVSIISAISYAKNIEKTVREMSEQ"
FT   gene            671937..672497
FT                   /locus_tag="SPCG_0668"
FT   CDS_pept        671937..672497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89920"
FT                   /db_xref="GOA:B2INA1"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA1"
FT                   /protein_id="ACB89920.1"
FT                   /translation="MLKKWQLKDVILLAFLSIFFGGVFVGSGYVYNILSLLLTPLGLQA
FT                   FANEILFGLWCMAAPIAAIFVPRVGSATIGEVLAALAEVLYGSQFGLGALLSGLVQGLG
FT                   SEFGFIVTKNRYESWLSLTANSIGITLVSFVYEYIKLGYYAFSLPFVLSLLVVRFISVY
FT                   FFCTILVRAIVKLYHQFATGGKA"
FT   gene            672498..673883
FT                   /locus_tag="SPCG_0669"
FT   CDS_pept        672498..673883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0669"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89921"
FT                   /db_xref="GOA:B2INA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA2"
FT                   /protein_id="ACB89921.1"
FT                   /translation="MGLELRAIQSPIFSEPFDFTFHAQAFTLLVGSSGSGKSSLFQVIA
FT                   QVSSLPYSGQVLIDGSEVSQLSIVERVQTVGILLQNPNHQFTMESLFEELVFTMENIGY
FT                   HLQEIDSKIAEVVQQCRCKDILHRLIHHLSGGEKQKAALAVLFAMNPRVYLLDEPFASI
FT                   DRKSRIEILEILKELALDGKTVILCDHDLSDYKAYIDYMVELRDGKLREVFQIPSYEMT
FT                   QVASKEVAASPELFHMNRVTGELGNRPLFSIADFTFYQGISCILGDNGVGKSTLFRSIL
FT                   QFQKYKGRIAWKGTVLKKKKSLYRDLTGVVQEAEKQFIRVSLREELQLDGPDSERNQRI
FT                   FQALRYFDLEQAVDKSPYQLSGGQQKILQLLTILTSKASVILLDEPFAGLDDRACHYFC
FT                   KWIVEERNQGRSFLLISHRLDPLISVVDYWIEMTSQGLRHVKEVTITKPLTSQSSNTQG
FT                   EVR"
FT   gene            673885..674535
FT                   /locus_tag="SPCG_0670"
FT   CDS_pept        673885..674535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89922"
FT                   /db_xref="GOA:B2INA3"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA3"
FT                   /protein_id="ACB89922.1"
FT                   /translation="MVKVATQTPIISLFLLILSLETSFIPSIALNLSVVAFCILFMFYY
FT                   RRFKMLAWMIILAILPSFANYWAVQLHGDASQAVMLGTRAFVTVCIGLVFVSSISLKEL
FT                   LLYLAQKGLSRSWSYALIVVFNSFPLIQQEIKSLKEACLLRGQELHFWSPLIYSKVLMT
FT                   VFRWRHLYLRALSAHGYDEHAQLKNSYRTFYIPKKTKLIYLLFFLLLQTSLFL"
FT   gene            674546..675238
FT                   /gene="tenA"
FT                   /locus_tag="SPCG_0671"
FT   CDS_pept        674546..675238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="SPCG_0671"
FT                   /product="transcriptional activator TenA"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89923"
FT                   /db_xref="GOA:B2INA4"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA4"
FT                   /protein_id="ACB89923.1"
FT                   /translation="MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDA
FT                   YYLKVFSEIYHLLADKTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEINDQEMEQHP
FT                   IAPTCYHYISHIYRQFAEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETY
FT                   ITDELEQQIREEGALVNQLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDL
FT                   QSLEKGEE"
FT   gene            675243..675767
FT                   /locus_tag="SPCG_0672"
FT   CDS_pept        675243..675767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89924"
FT                   /db_xref="GOA:B2INA5"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA5"
FT                   /protein_id="ACB89924.1"
FT                   /translation="MRKHQLQVHKLTILSMMIALDVVLTPIFRIEGMAPMSSVVNILAG
FT                   IMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAGLFYKYGRKFYFSALGEIV
FT                   GTGIIGSIVSYPVMVLFTGSAAKLSWFIYTPRFFGATLIGTAISFIAFRFLIKQEFFKK
FT                   VQGYFFAERIE"
FT   gene            675764..676570
FT                   /gene="thiM"
FT                   /locus_tag="SPCG_0673"
FT   CDS_pept        675764..676570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="SPCG_0673"
FT                   /product="hydroxyethylthiazole kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89925"
FT                   /db_xref="GOA:B2INA6"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2INA6"
FT                   /protein_id="ACB89925.1"
FT                   /translation="MMQALTNPFPIGSSSLIHCMTNEISCEMLANGILALGCKPVMADD
FT                   PREVLDFTKQSQALFINLGHLSAEKEKAIRMAALYANQSSLPMVVDAVGVTTSSIRKSL
FT                   VKDLLDYRPTVLKGNMSEIRSLVGLKHHGVGVDASAKDQETEDLLQVLKDWCQTYPGMS
FT                   FLVTGPKDLVVSKNQVAVLENGCTELDWITGTGDLVGALTAVFLSQGKTGFEASCLAVS
FT                   YLNIAAEKIVVQGMGLEEFRYQVLNQLSLLRRDENWLDTIKGEAYE"
FT   gene            676563..677195
FT                   /gene="thiE"
FT                   /locus_tag="SPCG_0674"
FT   CDS_pept        676563..677195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="SPCG_0674"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89926"
FT                   /db_xref="GOA:B2INA7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA7"
FT                   /protein_id="ACB89926.1"
FT                   /translation="MNREALRLYLVTNRYQDSVESFLAKVETACRSGVTIVQLREKNLT
FT                   TNQYYQLAKQVKEITDAYQVPLIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEK
FT                   ILGVTAKTVKRALEAEKSGADYLGTGAIFPTTTKENAPITLISTLKTICQTVAIPVVAI
FT                   GGLTSENIDQLMDTGIAGVAVVRDLMQAEDIEAKTQAFLTKLHDILS"
FT   gene            complement(677405..678196)
FT                   /gene="thiD"
FT                   /locus_tag="SPCG_0675"
FT   CDS_pept        complement(677405..678196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SPCG_0675"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89927"
FT                   /db_xref="GOA:B2INA8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA8"
FT                   /protein_id="ACB89927.1"
FT                   /translation="MTYLPVALTIAGTDPSGGAGIMADLKSFQARDVYGMAVVTSLVAQ
FT                   NTRGVQLIEHVSPQMLKAQLESVFSDIPPQAVKTGMLATTEIMEIIHPYLKKLDCPYVL
FT                   DPVMVATSGDALIDSSARDYLKTNLLPLATIITPNLPEAEEIVGFSIHDPEDMQRAGRL
FT                   ILKEFGPQSVVIKGGHLKGGAKDFLFTKNEQFVWESPRIQTCHTHGTGCTFAAVITAEL
FT                   AKGKSLYQAVDKAKAFITKAIQDAPQLGHGSGPVNHTTFKD"
FT   gene            678532..678957
FT                   /gene="copY"
FT                   /locus_tag="SPCG_0676"
FT   CDS_pept        678532..678957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SPCG_0676"
FT                   /product="transcriptional repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89928"
FT                   /db_xref="GOA:B2INA9"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2INA9"
FT                   /protein_id="ACB89928.1"
FT                   /translation="MTNVDFGGMVMQISDAEWQVMKIIWMQGEQTSTDLIRVLAERFDW
FT                   SKSTVQTLLARLVEKECLTRKKEGKSFVYSALLTLDQSRDLLVQDIKDKVCSRRIRNLL
FT                   ADLIVECEFTQTDLEDLEAVISEKKSSAVTEVRCNCM"
FT   gene            678968..679339
FT                   /locus_tag="SPCG_0677"
FT   CDS_pept        678968..679339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89929"
FT                   /db_xref="GOA:B2INB0"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB0"
FT                   /protein_id="ACB89929.1"
FT                   /translation="MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEV
FT                   MGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQA
FT                   GEFGFACGMNMMHGKMIVE"
FT   gene            679340..681592
FT                   /gene="ctpA"
FT                   /locus_tag="SPCG_0678"
FT   CDS_pept        679340..681592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="SPCG_0678"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89930"
FT                   /db_xref="GOA:B2INB1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB1"
FT                   /protein_id="ACB89930.1"
FT                   /translation="METMTEIVKASLENGIQKIRIRAEKGYHPAHIQLQKGIPAEITFH
FT                   RATPSNCYKEILFEEEGILEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKT
FT                   RKSLSLLQRFWITSIFTVPLVILMIGMLAGSISHQVMHWGTFLATTPIMLVAGKPYIQS
FT                   AWASFKKHNANMDTLVALGTLVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKM
FT                   RKNTSQAVEKLLDLQAKTAEVLSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGV
FT                   SSIDESMVTGESLPVDKTVGDTVIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQT
FT                   SRAPIQDLTDKISGIFVPVVVILGIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLII
FT                   ACPCALGLATPTALMVGTGRSAKMGVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVT
FT                   DIIGDEVEVFGLAASLEDASQHPLAEAIVKRASEAGLEFQTVENFQALHGKGVSGRING
FT                   KQVLLGNAKMLDGMDISNTYQDKLEELEKEAKTVVFLAVDNEIKGLLALQDIPKENAKL
FT                   AISQLKKRGLRTVMLTGDNAGVARAIADQIGIEEVIAGVLPEEKAHEIHKLQQSGKVAF
FT                   VGDGINDAPALSVADVGIAMGAGTDIAIESADLVLTTNNLLGVVRAFDMSKKTFHRILL
FT                   NLFWAFIYNVVGIPIAAGVFSGVGLALNPELAGLAMAFSSVSVLTSSLLLNFSKID"
FT   gene            681799..683574
FT                   /gene="spxB"
FT                   /locus_tag="SPCG_0679"
FT   CDS_pept        681799..683574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxB"
FT                   /locus_tag="SPCG_0679"
FT                   /product="pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89931"
FT                   /db_xref="GOA:B2INB2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB2"
FT                   /protein_id="ACB89931.1"
FT                   /translation="MTQGKITASAAMLNVLKTWGVDTIYGIPSGTLSSLMDALAEDKDI
FT                   RFLQVRHEETGALAAVMQAKFGGSIGVAVGSGGPGATHLINGVYDAAMDNTPFLAILGS
FT                   RPVNELNMDAFQELNQNPMYNGIAVYNKRVAYAEQLPKVIDEACRAAISKKGPAVVEIP
FT                   VNFGFQEIDENSYYGSGSYERSFIAPALNEVEIDKAVEILNNAERPVIYAGFGGVKAGE
FT                   VITELSRKIKAPIITTGKNFEAFEWNYEGLTGSAYRVGWKPANEVVFEADTVLFLGSNF
FT                   PFAEVYEAFKNTEKFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWW
FT                   RANVKNNQNWRDYMNKLEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHL
FT                   HMTPKNMWRTSPLFATMGIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYD
FT                   LPVINLVFSNAEYGFIKNKYEDTNKHLFGVDFTNADYAKIAEAQGAVGFTVDRIEDIDA
FT                   VVAEAVKLNKEGKTVVIDARITQHRPLPVEVLELDPKLHSEEAIKAFKEKYEAEELVPF
FT                   RLFLEEEGLQSRAIK"
FT   gene            683685..684032
FT                   /locus_tag="SPCG_0680"
FT   CDS_pept        683685..684032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89932"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB3"
FT                   /protein_id="ACB89932.1"
FT                   /translation="MNLNQLDIIVSNVPQVCADLEHILDKKADYADDGFAQFTIGSHCL
FT                   MLSQNHLVPLENFQSGIIIHIEVEDVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGP
FT                   AGLVLDFYRMK"
FT   gene            complement(684244..684660)
FT                   /locus_tag="SPCG_0681"
FT   CDS_pept        complement(684244..684660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89933"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB4"
FT                   /protein_id="ACB89933.1"
FT                   /translation="MMYQDEAGFGRISKLGSCWAPIGVGPHVHSHYIREFHYCYGAVDA
FT                   HTGESFFLIAGGCNTEWMNAFLEELSQAYPDDYLLLVMDNAIWHKSSTLKIPTNIGFTF
FT                   IPPYTPEMNPLNKCGKRFVNVDLRIRPFELWKMS"
FT   gene            complement(684689..684955)
FT                   /locus_tag="SPCG_0682"
FT   CDS_pept        complement(684689..684955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89934"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB5"
FT                   /protein_id="ACB89934.1"
FT                   /translation="MTIEEKKVFLARHLKATEAGEFVTIDALFQAYKKELGRSYTRDAF
FT                   YQLLKRHGWRNIMPRPEHPRKADAQTIVASKNKISIQEEKKAL"
FT   gene            complement(685292..685387)
FT                   /locus_tag="SPCG_0683"
FT   CDS_pept        complement(685292..685387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89935"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB6"
FT                   /protein_id="ACB89935.1"
FT                   /translation="MKSTKEEIQTIKTLLKDSRTAKYYKRLQIVL"
FT   gene            685452..685733
FT                   /locus_tag="SPCG_0684"
FT   CDS_pept        685452..685733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0684"
FT                   /product="6-phospho-beta-glucosidase, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89936"
FT                   /db_xref="GOA:B2INB7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB7"
FT                   /protein_id="ACB89936.1"
FT                   /translation="MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWSC
FT                   IDPVSAGTGEMNKRYGFIYVDRDNVGNGTLKRSKKKSFYWYMSFIAMV"
FT   gene            685811..686809
FT                   /locus_tag="SPCG_0685"
FT   CDS_pept        685811..686809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0685"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89937"
FT                   /db_xref="GOA:B2INB8"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB8"
FT                   /protein_id="ACB89937.1"
FT                   /translation="MELFFCYNEGRKIRQEIKMSEPLFLQSVMQEKIWGGTKLRDEFGY
FT                   DIPSEKVGEYWAISAHLNGVSKVANGRYEGTDLATLYAEHRELFGNRPEPVFPLLTKIL
FT                   DANDWLSVQVHPDDAYGLEHEGELGKTECWYIIAADEGSEIIYGHNAKSKEELRQQIED
FT                   KNWDALLTKVPVKAGDFFYVPSGTMHAIGAGILILETQQSSDTTYRVYDFDRKDDKGNL
FT                   RELHLEKSIDVLNIGEPANSRPVTIKADDLRSTLLVSNDFFAVYKWEITGKVNFEKTAD
FT                   YSLLSVLAGQGQLTVDGKNYPIQKGSHFILPSDVEAWTLEGQGLELIVSHP"
FT   gene            686793..686996
FT                   /locus_tag="SPCG_0686"
FT   CDS_pept        686793..686996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89938"
FT                   /db_xref="UniProtKB/TrEMBL:B2INB9"
FT                   /protein_id="ACB89938.1"
FT                   /translation="MLAIHKKKGPEFTTQVLFDYINWAMKTTMMMIGMTKRRNEEGRAR
FT                   LGTVLVSMLFHRDGVPPLQEPF"
FT   gene            complement(686830..688089)
FT                   /locus_tag="SPCG_0687"
FT   CDS_pept        complement(686830..688089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0687"
FT                   /product="sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89939"
FT                   /db_xref="GOA:B2INC0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC0"
FT                   /protein_id="ACB89939.1"
FT                   /translation="MTAANGGGGFLLIFLISTILIGFPLLLAEFALGRSAGVSAIKTFG
FT                   KLGKNNKYNFIGWIGAFALFILLSFYSVIGGWILVYLGIEFGKLFQLGGTGDYAQLFTS
FT                   IISNPAIALGAQAAFILLNIFIVSRGVQKGIERASKVMMPLLFIVFVFIISRSLSLPNA
FT                   MEGVLYFLKPDFSKLTSAGLLYALGQSFFALSLGVTVMLTYASYLDKKTNLVQSGISIV
FT                   AMNISISIMAGLAIFQARSPFNIQSEGGPSLLFIVLPQLFDKMPFGTIFYVRSLFATVT
FT                   SSVVMLEINVGNITNQDNSKRAKWSVILGILTFVFGIPSALSYGVMADVHIFGKTFFDA
FT                   MDFLVSNLLMPFGALYLSLFTGYIFKKALAMEELHLDERAWKQGLFQVWLFLLRFFVSS
FT                   FQSSSLWSSLPNLCNQKGLE"
FT   gene            complement(688086..688313)
FT                   /locus_tag="SPCG_0688"
FT   CDS_pept        complement(688086..688313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89940"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC1"
FT                   /protein_id="ACB89940.1"
FT                   /translation="MKMIFLTDLRKHDRIVKSINQTEGYLTTQVAFSYFEKGDQSLTMS
FT                   EKSQWGSKLGFILASAGWPSGLVPFGSFPT"
FT   gene            688412..689152
FT                   /locus_tag="SPCG_0689"
FT   CDS_pept        688412..689152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0689"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89941"
FT                   /db_xref="GOA:B2INC2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC2"
FT                   /protein_id="ACB89941.1"
FT                   /translation="MYHIKEAAQLSGVSVKTLHHYDKIGLLVPLKSENGYRTYSQEDLE
FT                   RLQVILYYKYLGFSLEKIAELLKEERTDLLPHLTRQLDYLTRERQHLDTLISTLQKTIQ
FT                   EQKGERKMTIEEKFTGFSYQDNQKYHQEAVEKYGQEVMGQALERQKGHEDEATAAFNQV
FT                   FQTLAQNLQVGLPATATENQEQAAKLLQAIRTYGFDCSIEVFGHIGKGYVYNPEFKENI
FT                   DKFGSETAQYTSDAIAAYVQTNAE"
FT   gene            complement(689181..689636)
FT                   /locus_tag="SPCG_0690"
FT   CDS_pept        complement(689181..689636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0690"
FT                   /product="mutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89942"
FT                   /db_xref="GOA:B2INC3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC3"
FT                   /protein_id="ACB89942.1"
FT                   /translation="MNRREAVEFVNMCMIKNGDKVLVQDRVSPDWPGITFPGGHVERGE
FT                   SFVDAVIREVKEETGLIISKPQLCGIKNWYDDKDYRYVVLFYKTEHFTGELQSSDEGKV
FT                   WWEDFENLSHLKLATDDMSDMLRVFLEEDLSEFFYYKNGDDWLYDLK"
FT   gene            complement(689656..690849)
FT                   /locus_tag="SPCG_0691"
FT   CDS_pept        complement(689656..690849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89943"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC4"
FT                   /protein_id="ACB89943.1"
FT                   /translation="MWYNRAMKHFDTIVIGGGPAGMMATISSSFYGQKTLLIEKNRKLG
FT                   KKLAGTGGGRCNVTNNGSLDNLLAGIPGNGRFLYSVFSQFDNHDIINFFTENGVKLKVE
FT                   DHGRVFPASDKSRTIIEALEKKITELGGQVATQIEIVSVKKVDDQFVLKSADQTFTCEK
FT                   LIVTTGGKSYPSTGSTGFGHEIARHFKHTITELEAAESPLLTDFPHKALQGISLDDVTL
FT                   SYGKHVITHDLLFTHFGLSGPAALRMSSFVKGGEVLSLDVLPQLSEKDLVTFLEENREK
FT                   SLKNALKTLLPERLAEFFVQGYPEKVKQLTEKEREQLVQSIKELKIPVTGKMSLAKSFV
FT                   TKGGVSLKEINPKTLESKLVPGLHFAGEVMDINAHTGGFNITSALCTGWVAGSLHYD"
FT   gene            complement(690890..691735)
FT                   /locus_tag="SPCG_0692"
FT   CDS_pept        complement(690890..691735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89944"
FT                   /db_xref="GOA:B2INC5"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC5"
FT                   /protein_id="ACB89944.1"
FT                   /translation="MTWKIIADSGCDYRQLPTPAINTTFVSVPLTIQVADQVFVDDASL
FT                   DIDQMMETMYATAEASKSACPSPDDYLRAFEGAKNIFLVTITGTLSGSHNSAQLAKNIY
FT                   LEDHPDTKIHVIDSLSAGGEVDLLVEKLNDLIDQGLSFEEVVEAITAYQEKTKLLFVLA
FT                   KVDNLVKNGRLSKLIGTVVGLLNIRMVGKASETGTLELLQKARGSKKSVQAAYDELVKA
FT                   GYAGGRIVMAQRNNEKCCQQLSERIRETFPQADIKILPTSGLCSFYAEDGGLLMGYEID
FT                   "
FT   gene            691860..692417
FT                   /locus_tag="SPCG_0693"
FT   CDS_pept        691860..692417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0693"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89945"
FT                   /db_xref="GOA:B2INC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC6"
FT                   /protein_id="ACB89945.1"
FT                   /translation="MSERRISEKSLENLRKSNQESNLLTREAIETALLQLLEKKELTKI
FT                   SISELVKRAGVSRAAFYRNYDSKEEILESVFKRTVHNIMEQLHHYDLKTDLYLVWVHLF
FT                   REARKEARVIQLALDYHLEKIFVQAMQEFLEKYHGKSKGVSSYLHSFWSSAIVSVLLKW
FT                   IKDGMKVPAEKIADLGLPFFKK"
FT   gene            692436..692903
FT                   /locus_tag="SPCG_0694"
FT   CDS_pept        692436..692903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0694"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89946"
FT                   /db_xref="GOA:B2INC7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC7"
FT                   /protein_id="ACB89946.1"
FT                   /translation="MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGY
FT                   NGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTK
FT                   QLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM"
FT   gene            692971..693621
FT                   /locus_tag="SPCG_0695"
FT   CDS_pept        692971..693621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0695"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89947"
FT                   /db_xref="GOA:B2INC8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:B2INC8"
FT                   /protein_id="ACB89947.1"
FT                   /translation="MKEGIPKMGKIEVINHPLIQHKLSILRRTDTSTKAFRELVDEIAM
FT                   LMGYEVLRDLPLEDVEIETPITKTVQKQLAGKKLAIVPILRAGIGMVDGLLSLVPAAKV
FT                   GHIGMYRDEETLQPVEYLVKLPEDIDQRQIFIVDPMLATGGSAILAVDSLKKRGASNIK
FT                   FVCLVSAPEGVKALQEAHPDVEIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            693794..694384
FT                   /locus_tag="SPCG_0696"
FT   CDS_pept        693794..694384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0696"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89948"
FT                   /db_xref="GOA:B2INC9"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2INC9"
FT                   /protein_id="ACB89948.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDSTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNTLEKILAENSGQSME
FT                   KVHADAERDNWMSAQETLEYGFIDEIMANNSLN"
FT   gene            complement(694381..694479)
FT                   /locus_tag="SPCG_0697"
FT   CDS_pept        complement(694381..694479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89950"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND0"
FT                   /protein_id="ACB89950.1"
FT                   /translation="MTFSNMINPLSKKSLPIIPKKANPVEFAFYHH"
FT   gene            694463..694711
FT                   /locus_tag="SPCG_0698"
FT   CDS_pept        694463..694711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89949"
FT                   /db_xref="GOA:B2IND1"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2IND1"
FT                   /protein_id="ACB89949.1"
FT                   /translation="MFEKVNRSGLIIYLYYNRDAKKLQDYGDITYHSKKHRYLQLYVPT
FT                   QEVEQLVGRLSKEKFIKKVRVCHIQELETPFVGNLYR"
FT   gene            694813..695973
FT                   /locus_tag="SPCG_0699"
FT   CDS_pept        694813..695973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0699"
FT                   /product="branched-chain amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89951"
FT                   /db_xref="GOA:B2IND2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND2"
FT                   /protein_id="ACB89951.1"
FT                   /translation="MKKKFALSFVALASVALLAACGEVKSGAVNTAGNSVEEKTIKIGF
FT                   NFEESGSLAAYGTAEQKGAQLAVDEINAAGGIDGKQIEVVDKDNKSETAEAASVTTNLV
FT                   TQSKVSAVVGPATSGATAAAVANATKAGVPLISPSATQDGLTKGQDYLFIGTFQDSFQG
FT                   KIISNYVSEKLNAKKVVLYTDNASDYAKGIAKSFRESYKGEIVADETFVAGDTDFQAAL
FT                   TKMKGKDFDAIVVPGYYNEAGKIVNQARGMGIDKPIVGGDGFNGEEFVQQATAEKASNI
FT                   YFISGFSTTVEVSAKAKAFLDAYRAKYNEEPSTFAALAYDSVHLVANAAKGAKNSGEIK
FT                   DNLAKTKDFEGVTGQTSFDADHNTVKTAYMMTMNNGKVEAAEVVKP"
FT   gene            696232..697110
FT                   /locus_tag="SPCG_0700"
FT   CDS_pept        696232..697110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0700"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89952"
FT                   /db_xref="GOA:B2IND3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND3"
FT                   /protein_id="ACB89952.1"
FT                   /translation="MNLMLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDIYMM
FT                   GAFIGYFLINSFQMNFFVALIVAMLATAILGVVIEFLAYRPLRHSTRIAVLITAIGISF
FT                   LLEYGMVYLVGANTRAFPQAIQTVRYDLGPISLTNVQLMILGISLILMILLQVIVQKTK
FT                   MGKAMRAVSVDSDAAQLMGINVNRTISFTFALGSALAGAAGVLIALYYNSLEPLMGVTP
FT                   GLKSFVAAVLGGIGIIPGAALGGFVIGLLETFATAFGMSDFRDAIVYGILLLILIVRPA
FT                   GILGKNVKEKV"
FT   gene            697114..698070
FT                   /locus_tag="SPCG_0701"
FT   CDS_pept        697114..698070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0701"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89953"
FT                   /db_xref="GOA:B2IND4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND4"
FT                   /protein_id="ACB89953.1"
FT                   /translation="MKENLKVNILWLLLLLAGYSLISVLVSVGVLNLFYVQILQQIGIN
FT                   IILAVGLNLIVGFSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGAFFGAMLVGALLSGAV
FT                   ALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYFF
FT                   VVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ
FT                   AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVASVRMII
FT                   YALALVLVMIFRPGGLLGTWELSLSRFFKKSKKEEQN"
FT   gene            698070..698834
FT                   /locus_tag="SPCG_0702"
FT   CDS_pept        698070..698834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0702"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89954"
FT                   /db_xref="GOA:B2IND5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND5"
FT                   /protein_id="ACB89954.1"
FT                   /translation="MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTVTLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFG
FT                   NHHKQHVFTSFLRLPAFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERI
FT                   YVLEYGRLIAQGTPDEIKTNKGVIEAYLGGEA"
FT   gene            698834..699544
FT                   /locus_tag="SPCG_0703"
FT   CDS_pept        698834..699544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPCG_0703"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPCG_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACB89955"
FT                   /db_xref="GOA:B2IND6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:B2IND6"
FT                   /protein_id="ACB89955.1"
FT                   /translation="MSMLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTI
FT                   LRTLSGLVRPSSGKIEFLGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAF
FT                   LKKNREENQANLKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEP
FT                   SMGLAPIFIQEIFDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKE
FT                   LASSEEVRKAYLGG"
FT   gene            699958..700614
FT                   /locus_tag="SPCG_0704"
FT   CDS_