(data stored in ACNUC7421 zone)

EMBL: CP001034

ID   CP001034; SV 1; circular; genomic DNA; STD; PRO; 3165557 BP.
XX
AC   CP001034; ABKR01000000-ABKR01000048;
XX
PR   Project:PRJNA20207;
XX
DT   11-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Natranaerobius thermophilus JW/NM-WN-LF, complete genome.
XX
KW   .
XX
OS   Natranaerobius thermophilus JW/NM-WN-LF
OC   Bacteria; Firmicutes; Clostridia; Natranaerobiales; Natranaerobiaceae;
OC   Natranaerobius.
XX
RN   [1]
RP   1-3165557
RX   DOI; 10.1128/JB.05157-11.
RX   PUBMED; 21642468.
RA   Zhao B., Mesbah N.M., Dalin E., Goodwin L., Nolan M., Pitluck S.,
RA   Chertkov O., Brettin T.S., Han J., Larimer F.W., Land M.L., Hauser L.,
RA   Kyrpides N., Wiegel J.;
RT   "Complete genome sequence of the anaerobic, halophilic alkalithermophile
RT   Natranaerobius thermophilus JW/NM-WN-LF";
RL   J. Bacteriol. 193(15):4023-4024(2011).
XX
RN   [2]
RP   1-3165557
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Lykidis A., Mesbah N.M., Wiegel J.;
RT   "Complete sequence of chromosome of Natranaerobius thermophilus
RT   JW/NM-WN-LF";
RL   Unpublished.
XX
RN   [3]
RP   1-3165557
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Lykidis A., Mesbah N.M., Wiegel J.;
RT   ;
RL   Submitted (04-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 5fa620e64e3716f1e0e80ad5fa18a7b5.
DR   BioSample; SAMN02598430.
DR   EnsemblGenomes-Gn; EBG00001140381.
DR   EnsemblGenomes-Gn; EBG00001140382.
DR   EnsemblGenomes-Gn; EBG00001140383.
DR   EnsemblGenomes-Gn; EBG00001140384.
DR   EnsemblGenomes-Gn; EBG00001140385.
DR   EnsemblGenomes-Gn; EBG00001140386.
DR   EnsemblGenomes-Gn; EBG00001140387.
DR   EnsemblGenomes-Gn; EBG00001140388.
DR   EnsemblGenomes-Gn; EBG00001140389.
DR   EnsemblGenomes-Gn; EBG00001140390.
DR   EnsemblGenomes-Gn; EBG00001140391.
DR   EnsemblGenomes-Gn; EBG00001140392.
DR   EnsemblGenomes-Gn; EBG00001140393.
DR   EnsemblGenomes-Gn; EBG00001140394.
DR   EnsemblGenomes-Gn; EBG00001140395.
DR   EnsemblGenomes-Gn; EBG00001140396.
DR   EnsemblGenomes-Gn; EBG00001140397.
DR   EnsemblGenomes-Gn; EBG00001140398.
DR   EnsemblGenomes-Gn; EBG00001140399.
DR   EnsemblGenomes-Gn; EBG00001140400.
DR   EnsemblGenomes-Gn; EBG00001140401.
DR   EnsemblGenomes-Gn; EBG00001140402.
DR   EnsemblGenomes-Gn; EBG00001140403.
DR   EnsemblGenomes-Gn; EBG00001140404.
DR   EnsemblGenomes-Gn; EBG00001140405.
DR   EnsemblGenomes-Gn; EBG00001140406.
DR   EnsemblGenomes-Gn; EBG00001140407.
DR   EnsemblGenomes-Gn; EBG00001140408.
DR   EnsemblGenomes-Gn; EBG00001140409.
DR   EnsemblGenomes-Gn; EBG00001140410.
DR   EnsemblGenomes-Gn; EBG00001140411.
DR   EnsemblGenomes-Gn; EBG00001140412.
DR   EnsemblGenomes-Gn; EBG00001140413.
DR   EnsemblGenomes-Gn; EBG00001140414.
DR   EnsemblGenomes-Gn; EBG00001140415.
DR   EnsemblGenomes-Gn; EBG00001140416.
DR   EnsemblGenomes-Gn; EBG00001140417.
DR   EnsemblGenomes-Gn; EBG00001140418.
DR   EnsemblGenomes-Gn; EBG00001140419.
DR   EnsemblGenomes-Gn; EBG00001140420.
DR   EnsemblGenomes-Gn; EBG00001140421.
DR   EnsemblGenomes-Gn; EBG00001140422.
DR   EnsemblGenomes-Gn; EBG00001140423.
DR   EnsemblGenomes-Gn; EBG00001140424.
DR   EnsemblGenomes-Gn; EBG00001140425.
DR   EnsemblGenomes-Gn; EBG00001140426.
DR   EnsemblGenomes-Gn; EBG00001140427.
DR   EnsemblGenomes-Gn; EBG00001140428.
DR   EnsemblGenomes-Gn; EBG00001140429.
DR   EnsemblGenomes-Gn; EBG00001140430.
DR   EnsemblGenomes-Gn; EBG00001140431.
DR   EnsemblGenomes-Gn; EBG00001140432.
DR   EnsemblGenomes-Gn; EBG00001140433.
DR   EnsemblGenomes-Gn; EBG00001140434.
DR   EnsemblGenomes-Gn; EBG00001140435.
DR   EnsemblGenomes-Gn; EBG00001140436.
DR   EnsemblGenomes-Gn; EBG00001140437.
DR   EnsemblGenomes-Gn; EBG00001140438.
DR   EnsemblGenomes-Gn; EBG00001140439.
DR   EnsemblGenomes-Gn; EBG00001140440.
DR   EnsemblGenomes-Gn; EBG00001140441.
DR   EnsemblGenomes-Gn; EBG00001140442.
DR   EnsemblGenomes-Gn; EBG00001140443.
DR   EnsemblGenomes-Gn; EBG00001140444.
DR   EnsemblGenomes-Gn; EBG00001140445.
DR   EnsemblGenomes-Gn; EBG00001140446.
DR   EnsemblGenomes-Gn; EBG00001140447.
DR   EnsemblGenomes-Gn; EBG00001140448.
DR   EnsemblGenomes-Gn; EBG00001140449.
DR   EnsemblGenomes-Gn; EBG00001140450.
DR   EnsemblGenomes-Gn; EBG00001140451.
DR   EnsemblGenomes-Gn; EBG00001140452.
DR   EnsemblGenomes-Gn; EBG00001140453.
DR   EnsemblGenomes-Gn; EBG00001140454.
DR   EnsemblGenomes-Gn; EBG00001140455.
DR   EnsemblGenomes-Gn; EBG00001140456.
DR   EnsemblGenomes-Gn; EBG00001140457.
DR   EnsemblGenomes-Gn; EBG00001140458.
DR   EnsemblGenomes-Gn; EBG00001140459.
DR   EnsemblGenomes-Gn; EBG00001140460.
DR   EnsemblGenomes-Gn; Nther_R0001.
DR   EnsemblGenomes-Gn; Nther_R0002.
DR   EnsemblGenomes-Gn; Nther_R0003.
DR   EnsemblGenomes-Gn; Nther_R0004.
DR   EnsemblGenomes-Gn; Nther_R0005.
DR   EnsemblGenomes-Gn; Nther_R0007.
DR   EnsemblGenomes-Gn; Nther_R0008.
DR   EnsemblGenomes-Gn; Nther_R0009.
DR   EnsemblGenomes-Gn; Nther_R0010.
DR   EnsemblGenomes-Gn; Nther_R0011.
DR   EnsemblGenomes-Gn; Nther_R0012.
DR   EnsemblGenomes-Gn; Nther_R0013.
DR   EnsemblGenomes-Gn; Nther_R0014.
DR   EnsemblGenomes-Gn; Nther_R0015.
DR   EnsemblGenomes-Gn; Nther_R0016.
DR   EnsemblGenomes-Gn; Nther_R0017.
DR   EnsemblGenomes-Gn; Nther_R0018.
DR   EnsemblGenomes-Gn; Nther_R0020.
DR   EnsemblGenomes-Gn; Nther_R0021.
DR   EnsemblGenomes-Gn; Nther_R0022.
DR   EnsemblGenomes-Gn; Nther_R0023.
DR   EnsemblGenomes-Gn; Nther_R0024.
DR   EnsemblGenomes-Gn; Nther_R0026.
DR   EnsemblGenomes-Gn; Nther_R0027.
DR   EnsemblGenomes-Gn; Nther_R0028.
DR   EnsemblGenomes-Gn; Nther_R0029.
DR   EnsemblGenomes-Gn; Nther_R0035.
DR   EnsemblGenomes-Gn; Nther_R0037.
DR   EnsemblGenomes-Gn; Nther_R0039.
DR   EnsemblGenomes-Gn; Nther_R0040.
DR   EnsemblGenomes-Gn; Nther_R0041.
DR   EnsemblGenomes-Gn; Nther_R0042.
DR   EnsemblGenomes-Gn; Nther_R0043.
DR   EnsemblGenomes-Gn; Nther_R0044.
DR   EnsemblGenomes-Gn; Nther_R0045.
DR   EnsemblGenomes-Gn; Nther_R0049.
DR   EnsemblGenomes-Gn; Nther_R0050.
DR   EnsemblGenomes-Gn; Nther_R0051.
DR   EnsemblGenomes-Gn; Nther_R0052.
DR   EnsemblGenomes-Gn; Nther_R0053.
DR   EnsemblGenomes-Gn; Nther_R0054.
DR   EnsemblGenomes-Gn; Nther_R0055.
DR   EnsemblGenomes-Gn; Nther_R0056.
DR   EnsemblGenomes-Gn; Nther_R0059.
DR   EnsemblGenomes-Gn; Nther_R0060.
DR   EnsemblGenomes-Gn; Nther_R0061.
DR   EnsemblGenomes-Gn; Nther_R0062.
DR   EnsemblGenomes-Gn; Nther_R0063.
DR   EnsemblGenomes-Gn; Nther_R0064.
DR   EnsemblGenomes-Gn; Nther_R0065.
DR   EnsemblGenomes-Gn; Nther_R0066.
DR   EnsemblGenomes-Gn; Nther_R0067.
DR   EnsemblGenomes-Gn; Nther_R0068.
DR   EnsemblGenomes-Gn; Nther_R0069.
DR   EnsemblGenomes-Gn; Nther_R0070.
DR   EnsemblGenomes-Gn; Nther_R0071.
DR   EnsemblGenomes-Gn; Nther_R0072.
DR   EnsemblGenomes-Gn; Nther_R0073.
DR   EnsemblGenomes-Gn; Nther_R0074.
DR   EnsemblGenomes-Gn; Nther_R0075.
DR   EnsemblGenomes-Gn; Nther_R0077.
DR   EnsemblGenomes-Gn; Nther_R0078.
DR   EnsemblGenomes-Gn; Nther_R0079.
DR   EnsemblGenomes-Gn; Nther_R0080.
DR   EnsemblGenomes-Gn; Nther_R0081.
DR   EnsemblGenomes-Gn; Nther_R0082.
DR   EnsemblGenomes-Tr; EBT00001557008.
DR   EnsemblGenomes-Tr; EBT00001557009.
DR   EnsemblGenomes-Tr; EBT00001557010.
DR   EnsemblGenomes-Tr; EBT00001557011.
DR   EnsemblGenomes-Tr; EBT00001557012.
DR   EnsemblGenomes-Tr; EBT00001557013.
DR   EnsemblGenomes-Tr; EBT00001557014.
DR   EnsemblGenomes-Tr; EBT00001557015.
DR   EnsemblGenomes-Tr; EBT00001557016.
DR   EnsemblGenomes-Tr; EBT00001557017.
DR   EnsemblGenomes-Tr; EBT00001557018.
DR   EnsemblGenomes-Tr; EBT00001557019.
DR   EnsemblGenomes-Tr; EBT00001557020.
DR   EnsemblGenomes-Tr; EBT00001557021.
DR   EnsemblGenomes-Tr; EBT00001557022.
DR   EnsemblGenomes-Tr; EBT00001557023.
DR   EnsemblGenomes-Tr; EBT00001557024.
DR   EnsemblGenomes-Tr; EBT00001557025.
DR   EnsemblGenomes-Tr; EBT00001557026.
DR   EnsemblGenomes-Tr; EBT00001557027.
DR   EnsemblGenomes-Tr; EBT00001557028.
DR   EnsemblGenomes-Tr; EBT00001557029.
DR   EnsemblGenomes-Tr; EBT00001557030.
DR   EnsemblGenomes-Tr; EBT00001557031.
DR   EnsemblGenomes-Tr; EBT00001557032.
DR   EnsemblGenomes-Tr; EBT00001557033.
DR   EnsemblGenomes-Tr; EBT00001557034.
DR   EnsemblGenomes-Tr; EBT00001557035.
DR   EnsemblGenomes-Tr; EBT00001557036.
DR   EnsemblGenomes-Tr; EBT00001557037.
DR   EnsemblGenomes-Tr; EBT00001557038.
DR   EnsemblGenomes-Tr; EBT00001557039.
DR   EnsemblGenomes-Tr; EBT00001557040.
DR   EnsemblGenomes-Tr; EBT00001557041.
DR   EnsemblGenomes-Tr; EBT00001557042.
DR   EnsemblGenomes-Tr; EBT00001557043.
DR   EnsemblGenomes-Tr; EBT00001557044.
DR   EnsemblGenomes-Tr; EBT00001557045.
DR   EnsemblGenomes-Tr; EBT00001557046.
DR   EnsemblGenomes-Tr; EBT00001557047.
DR   EnsemblGenomes-Tr; EBT00001557048.
DR   EnsemblGenomes-Tr; EBT00001557049.
DR   EnsemblGenomes-Tr; EBT00001557050.
DR   EnsemblGenomes-Tr; EBT00001557051.
DR   EnsemblGenomes-Tr; EBT00001557052.
DR   EnsemblGenomes-Tr; EBT00001557053.
DR   EnsemblGenomes-Tr; EBT00001557054.
DR   EnsemblGenomes-Tr; EBT00001557055.
DR   EnsemblGenomes-Tr; EBT00001557056.
DR   EnsemblGenomes-Tr; EBT00001557057.
DR   EnsemblGenomes-Tr; EBT00001557058.
DR   EnsemblGenomes-Tr; EBT00001557059.
DR   EnsemblGenomes-Tr; EBT00001557060.
DR   EnsemblGenomes-Tr; EBT00001557061.
DR   EnsemblGenomes-Tr; EBT00001557062.
DR   EnsemblGenomes-Tr; EBT00001557063.
DR   EnsemblGenomes-Tr; EBT00001557064.
DR   EnsemblGenomes-Tr; EBT00001557065.
DR   EnsemblGenomes-Tr; EBT00001557066.
DR   EnsemblGenomes-Tr; EBT00001557067.
DR   EnsemblGenomes-Tr; EBT00001557068.
DR   EnsemblGenomes-Tr; EBT00001557069.
DR   EnsemblGenomes-Tr; EBT00001557070.
DR   EnsemblGenomes-Tr; EBT00001557071.
DR   EnsemblGenomes-Tr; EBT00001557072.
DR   EnsemblGenomes-Tr; EBT00001557073.
DR   EnsemblGenomes-Tr; EBT00001557074.
DR   EnsemblGenomes-Tr; EBT00001557075.
DR   EnsemblGenomes-Tr; EBT00001557076.
DR   EnsemblGenomes-Tr; EBT00001557077.
DR   EnsemblGenomes-Tr; EBT00001557078.
DR   EnsemblGenomes-Tr; EBT00001557079.
DR   EnsemblGenomes-Tr; EBT00001557080.
DR   EnsemblGenomes-Tr; EBT00001557081.
DR   EnsemblGenomes-Tr; EBT00001557082.
DR   EnsemblGenomes-Tr; EBT00001557083.
DR   EnsemblGenomes-Tr; EBT00001557084.
DR   EnsemblGenomes-Tr; EBT00001557085.
DR   EnsemblGenomes-Tr; EBT00001557086.
DR   EnsemblGenomes-Tr; EBT00001557087.
DR   EnsemblGenomes-Tr; Nther_R0001-1.
DR   EnsemblGenomes-Tr; Nther_R0002-1.
DR   EnsemblGenomes-Tr; Nther_R0003-1.
DR   EnsemblGenomes-Tr; Nther_R0004-1.
DR   EnsemblGenomes-Tr; Nther_R0005-1.
DR   EnsemblGenomes-Tr; Nther_R0007-1.
DR   EnsemblGenomes-Tr; Nther_R0008-1.
DR   EnsemblGenomes-Tr; Nther_R0009-1.
DR   EnsemblGenomes-Tr; Nther_R0010-1.
DR   EnsemblGenomes-Tr; Nther_R0011-1.
DR   EnsemblGenomes-Tr; Nther_R0012-1.
DR   EnsemblGenomes-Tr; Nther_R0013-1.
DR   EnsemblGenomes-Tr; Nther_R0014-1.
DR   EnsemblGenomes-Tr; Nther_R0015-1.
DR   EnsemblGenomes-Tr; Nther_R0016-1.
DR   EnsemblGenomes-Tr; Nther_R0017-1.
DR   EnsemblGenomes-Tr; Nther_R0018-1.
DR   EnsemblGenomes-Tr; Nther_R0020-1.
DR   EnsemblGenomes-Tr; Nther_R0021-1.
DR   EnsemblGenomes-Tr; Nther_R0022-1.
DR   EnsemblGenomes-Tr; Nther_R0023-1.
DR   EnsemblGenomes-Tr; Nther_R0024-1.
DR   EnsemblGenomes-Tr; Nther_R0026-1.
DR   EnsemblGenomes-Tr; Nther_R0027-1.
DR   EnsemblGenomes-Tr; Nther_R0028-1.
DR   EnsemblGenomes-Tr; Nther_R0029-1.
DR   EnsemblGenomes-Tr; Nther_R0035-1.
DR   EnsemblGenomes-Tr; Nther_R0037-1.
DR   EnsemblGenomes-Tr; Nther_R0039-1.
DR   EnsemblGenomes-Tr; Nther_R0040-1.
DR   EnsemblGenomes-Tr; Nther_R0041-1.
DR   EnsemblGenomes-Tr; Nther_R0042-1.
DR   EnsemblGenomes-Tr; Nther_R0043-1.
DR   EnsemblGenomes-Tr; Nther_R0044-1.
DR   EnsemblGenomes-Tr; Nther_R0045-1.
DR   EnsemblGenomes-Tr; Nther_R0049-1.
DR   EnsemblGenomes-Tr; Nther_R0050-1.
DR   EnsemblGenomes-Tr; Nther_R0051-1.
DR   EnsemblGenomes-Tr; Nther_R0052-1.
DR   EnsemblGenomes-Tr; Nther_R0053-1.
DR   EnsemblGenomes-Tr; Nther_R0054-1.
DR   EnsemblGenomes-Tr; Nther_R0055-1.
DR   EnsemblGenomes-Tr; Nther_R0056-1.
DR   EnsemblGenomes-Tr; Nther_R0059-1.
DR   EnsemblGenomes-Tr; Nther_R0060-1.
DR   EnsemblGenomes-Tr; Nther_R0061-1.
DR   EnsemblGenomes-Tr; Nther_R0062-1.
DR   EnsemblGenomes-Tr; Nther_R0063-1.
DR   EnsemblGenomes-Tr; Nther_R0064-1.
DR   EnsemblGenomes-Tr; Nther_R0065-1.
DR   EnsemblGenomes-Tr; Nther_R0066-1.
DR   EnsemblGenomes-Tr; Nther_R0067-1.
DR   EnsemblGenomes-Tr; Nther_R0068-1.
DR   EnsemblGenomes-Tr; Nther_R0069-1.
DR   EnsemblGenomes-Tr; Nther_R0070-1.
DR   EnsemblGenomes-Tr; Nther_R0071-1.
DR   EnsemblGenomes-Tr; Nther_R0072-1.
DR   EnsemblGenomes-Tr; Nther_R0073-1.
DR   EnsemblGenomes-Tr; Nther_R0074-1.
DR   EnsemblGenomes-Tr; Nther_R0075-1.
DR   EnsemblGenomes-Tr; Nther_R0077-1.
DR   EnsemblGenomes-Tr; Nther_R0078-1.
DR   EnsemblGenomes-Tr; Nther_R0079-1.
DR   EnsemblGenomes-Tr; Nther_R0080-1.
DR   EnsemblGenomes-Tr; Nther_R0081-1.
DR   EnsemblGenomes-Tr; Nther_R0082-1.
DR   EuropePMC; PMC3147539; 21642468.
DR   EuropePMC; PMC3236047.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001034.
DR   SILVA-SSU; CP001034.
DR   StrainInfo; 756812; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  4044106
CC   Source DNA and bacteria available from Juergen Wiegel
CC   (jwiegel@uga.edu)
CC   Contacts: Juergen Wiegel (jwiegel@uga.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3165557
FT                   /organism="Natranaerobius thermophilus JW/NM-WN-LF"
FT                   /strain="JW/NM-WN-LF"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Natranaerobius thermophilus"
FT                   /db_xref="taxon:457570"
FT   gene            146..1507
FT                   /locus_tag="Nther_0001"
FT   CDS_pept        146..1507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bcy:Bcer98_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83600"
FT                   /db_xref="GOA:B2A2Y6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A2Y6"
FT                   /protein_id="ACB83600.1"
FT                   /translation="MSENMEELWSKTLEELKQQLSKPSFETWFQSTEPVEMSSTDLYIS
FT                   VPNEFTKDWLNSRYKNSIENSLKKISGKQLKIKFLLPGEKIKMEEQNNENEEKPESTSK
FT                   KSSQGSEHTTWLNPKYTFDTFVIGNANRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKT
FT                   HLMHAIGHYVLSHQPNYRVVYISSEKFTNEFINAIRDNKTVNFRNKYRNVDILLVDDIQ
FT                   FLAGKEQTQEEFFHTFNTLHENDKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDIQAP
FT                   DLETRIAILRKKAYLEKLDIPNDVIVYIANQIDTNIRELEGGLIRVIAYSSMANKKITK
FT                   ETAEEALKDILPNKQPKKMTVEHIQKTVAQYFGLKVDDLKAKKRTRSVAFPRQIAMYLA
FT                   RELTDSSLPKIGDEFGGRDHTTVMHAHDKIASDLKKESHLNETIDEIKNLLHGD"
FT   gene            1780..2892
FT                   /locus_tag="Nther_0002"
FT   CDS_pept        1780..2892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dsy:DSY0002 DNA polymerase III beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83601"
FT                   /db_xref="GOA:B2A2Y7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Y7"
FT                   /protein_id="ACB83601.1"
FT                   /translation="MKIIFQKDELTEALQATQRGISNKNTIPHLNGFFIQTHSDNTLSI
FT                   ITYDLEMGINYYLSTEILEQGSVVVPTKFFDIIKKLPEDQITFSVDQENYLITIESGQV
FT                   YYEIKGLDPEEYPKLPEIEEGKSFSIPEILLKKMIHQTSFAVSKEETKPAFTGVLCKFD
FT                   SDNKLDMVATDSYRLAWRKGKISNDSQISGEYIIPQKAIGQVQRIISEEDKLINLYLAN
FT                   GYFLCETEKVRLFSKLIDEEFPNLDQVIPKNYQTKVMIDRKFLQDSMERASLLASEGAN
FT                   NIVKLNISEENMEITSNSPHTGKLKEDLQLYKEGDNISIALNARFIIEVLKVIEEDQVE
FT                   LEFTGSYSPMIIRPRENDQYFHLILPVRAF"
FT   gene            2912..3133
FT                   /locus_tag="Nther_0003"
FT   CDS_pept        2912..3133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0003"
FT                   /product="S4-like RNA binding protein"
FT                   /note="KEGG: ppe:PEPE_0003 S4-like RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83602"
FT                   /db_xref="GOA:B2A2Y8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Y8"
FT                   /protein_id="ACB83602.1"
FT                   /translation="MSKRKVEINSEYITLGQLLKYVNIVATGGEVKHFLKEEDIEVNGE
FT                   KTEQRGKKLYPGDIVNLKDQEEIIEITK"
FT   gene            3167..4327
FT                   /locus_tag="Nther_0004"
FT   CDS_pept        3167..4327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bcy:Bcer98_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83603"
FT                   /db_xref="GOA:B2A2Y9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A2Y9"
FT                   /protein_id="ACB83603.1"
FT                   /translation="MKLTELCLKNFRNYSNLKLNFKKPIILFFGANAQGKTNLLEAIYY
FT                   LATGKSHRAQKEKELIRWETSGFYLKGELEKEQAQYTLEIITNYQNGKNKNLKVNNLSQ
FT                   TNTRNFLKTMNVVIFSPEDLMLVKGTPDNRRRFIDQEITQVDPSYDFYLKNYFKALRQR
FT                   NKLLKTYQDKNTLAQHLPPWNQQLVHYGSKIILKREEVIHKIRLLARLIYRKITNQTEN
FT                   LELDYSPSLEFEDCKFREQLSGEKLAHKFLNTLNENLQSDIEKRTTSIGPHRDDLIFKI
FT                   NNKDARQFGSQGQQRTTVLALKMAELEMIKGEKGEFPILLLDDVLSELDDNRKKHLLNL
FT                   TEGRVQTFVTSTSMEDFNGDVDIKAKSQVFRIDNGEAVKLNAGNQE"
FT   gene            4308..5210
FT                   /locus_tag="Nther_0005"
FT   CDS_pept        4308..5210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83604"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z0"
FT                   /protein_id="ACB83604.1"
FT                   /translation="MQGIRNDLKKFLAKSGLLKKFYQEKAMNYWVDVVGEEIATNCQPK
FT                   VFQGKKMIVVCSNSIWIQELSMRKKNLIKKLNEKVGKTVVTDIKFVTGQIPNNSGLNLT
FT                   RGRSKYKEIPLETKEKDWVEKTTSEIEDENLQKKLAKLMEQDLKYKKGKKSQGYSECDK
FT                   CGKLTNNKGICQDCIEENERKKLNTLIRILKDSPWLNYNELQEEIPSDMEITRRDYNRA
FT                   KNQFYQRVKDELFKAKQVFKYNQTQKNYDWLKDLLQQYVLIITEEKPEEIDDKTWETAV
FT                   GALGKEYLELANKKLGKDG"
FT   gene            5218..5517
FT                   /locus_tag="Nther_0006"
FT   CDS_pept        5218..5517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83605"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z1"
FT                   /protein_id="ACB83605.1"
FT                   /translation="MFVHIGDNIVLPIKEIVGIFDISVLEDKATRDFLKISEEEGFVKN
FT                   NKYDNRERSFVLTGQNIYFSPITSVTLKKRIEKIYNQQDGDLFEQEEEDEIDNT"
FT   gene            5587..7509
FT                   /locus_tag="Nther_0007"
FT   CDS_pept        5587..7509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0007"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83606"
FT                   /db_xref="GOA:B2A2Z2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z2"
FT                   /protein_id="ACB83606.1"
FT                   /translation="MEENKFVNEQNYDESQIQVLEGLEAVRKRPGMYIGSTDERGLHHL
FT                   VHEVVDNSIDEAMAGYCDDIRIKLEPGNKVRVTDNGRGIPVKDHPKIKKPTLEVIMTYL
FT                   HAGGKFSNDSYKVSGGLHGVGISVVNGLSKWIRVKVYRDGKVYQQEYEKGYPKTEIKEI
FT                   GESDKRGTEIIFLPDEEIFETVEFDYQVLRNRLQQLAFLNRGVSITISDEREDEFKEEH
FT                   FKYEGGIKSFVEYLNENKTTLFTPPVYIEGEQEGCKLEVAIQYNDGYQEMIHSYANNIN
FT                   THEGGTHESGFKISLTRTVNDYARRHNLLKNGDKNLTGEDIREGITAIISVKVEDPQFE
FT                   GQTKTKLGNSEVRRIVEGIVSEHLESYLEENPAVGKKIVNKAINASRAREAARKAKELT
FT                   RRKNALEVTALPGKLADCTTKDASKSELYLVEGDSAGGSAKQGRDREFQAILPLRGKIL
FT                   NVEKARFDKILANEEIKTIITAIGTGIGEEFDISKARYQRIIIMTDADVDGAHIRTLLL
FT                   TFFYRYMRPLIEHGYVYIAQPPLYMVKKKGKHYYTFNDHELDNLLEEIGKEGISLQRYK
FT                   GLGEMNPTQLWETTMNPESRTVLNVNLQDAIEADKIFTVLMGEKVSPRRKFIEENARDV
FT                   RNLDV"
FT   gene            7594..10017
FT                   /locus_tag="Nther_0008"
FT   CDS_pept        7594..10017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0008"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: chy:CHY_2704 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83607"
FT                   /db_xref="GOA:B2A2Z3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z3"
FT                   /protein_id="ACB83607.1"
FT                   /translation="MSDTMRGKVVPIDIQEEMENSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILFAMHDLGITPEKPYKKSARVVGEVLGKYHPHGDVALYDAMVRMAQDFSTRYPLV
FT                   DGHGNFGSVDGDSAAAMRYTEVRMAKISTELLKDIDKETIDYQQNFDETLEEPVVLPSR
FT                   FPNLLVNGSAGIAVGMATNIPPHNLDEVIDGIVAMIENPEIADEDLMNYIKGPDFPTGG
FT                   IILGRNGIKDAYSTGRGKLKIRAKTEIENLKGNKHRILVTEIPYQVNKAKLIESIASLV
FT                   REKKIEGISDLRDESDRDGLRVVIELKRDVNPNVLLNQLYKYTTLEQSFGIILLALVNG
FT                   EPKVLSLREILDHYLEFQKEVIIRRTKYLLRKAEARAHILEGLKIALNNLDAVIKLIRQ
FT                   SKTVKEAKEGLMNNFSLSDKQAQAILDMRLQKLTALERDKIEEEYSELLKKIDYYNRVL
FT                   GDEQLVLNIIKEEIQEIKEKYSDSRRTLITNKTDELDEEDLIPDEEVIITLTHQGYVKR
FT                   VPLSTYRNQKRGGRGISGMTTKNDDFVEHLFATSTHNYILFFTNKGKVYRLKVYEIPEA
FT                   SRQARGTAIVNLLAIDPDEHITAVIPIQEFTEDDYLFFVTKQGVAKKVILSELKAYRKD
FT                   GLIAINLNEDDELIDVHLTDGKQEIILGTEQGLAIKFSEEEVRSMGRNSRGVKGISLKD
FT                   NDRVIGMDIAQENSDLLIVSENGYGKRTPVSEYRTQSRGGKGIYTFKPSEKSGNLAGCI
FT                   VVNEDEEIILVTAQGVINRQQVEGISQMSRRTQGVRLIKLKDDDQVVSLAIPES"
FT   gene            10608..12073
FT                   /locus_tag="Nther_R0001"
FT   rRNA            10608..12073
FT                   /locus_tag="Nther_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            12305..12382
FT                   /locus_tag="Nther_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            12305..12382
FT                   /locus_tag="Nther_R0002"
FT                   /product="tRNA-Ile"
FT   gene            12392..12467
FT                   /locus_tag="Nther_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            12392..12467
FT                   /locus_tag="Nther_R0003"
FT                   /product="tRNA-Ala"
FT   gene            12508..15636
FT                   /locus_tag="Nther_R0004"
FT   rRNA            12508..15636
FT                   /locus_tag="Nther_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            15762..15878
FT                   /locus_tag="Nther_R0005"
FT   rRNA            15762..15878
FT                   /locus_tag="Nther_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            16215..17795
FT                   /locus_tag="Nther_0009"
FT   CDS_pept        16215..17795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0009"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein; KEGG: cdf:CD3498 stage V sporulation
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83608"
FT                   /db_xref="GOA:B2A2Z4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z4"
FT                   /protein_id="ACB83608.1"
FT                   /translation="MEKDSLAKGTIVLGSGMVIAKIFGLVYRLILPNIIGTEAMGLYGM
FT                   AYAVYTVLLTLSMAGIPVAISKIISNELSQGHYVAANDTFKVALLLLLTTGLIFTTVLY
FT                   FGSTIIAHAITGDHRAELSLKAVSPAIILVSVMSALRGYFQGHLVMTYTAVSQLLEQFV
FT                   RVFGILFFAYLLIPYGKIYSAAGAVFGNVVGALTGLGYLIWQYFNSKDIVKRQINNSSI
FT                   SISRIQQTAIQIMVLAFPIIIGNMIMPIMNLIDASLVVNRLMEIGFTQGEATSKFAYLT
FT                   QYAAPLTMFPGTMGMALSMSLVPGISETVTKQNYDQLKGRVRLAIRFSLLIGFPSFFGL
FT                   FVLATPIILLIFPNDPEAATPLRYLSPSVIFLLLKFATTGVLQGLNKPMIPVKNLIIGT
FT                   FLKAILTYWLTAVPYLNVNGAAIGTLISYAVSSMFNLFYIIKITGIKISLVQDILKPAI
FT                   LSLFMGIIAFSTQILTLDLIGIRLAALLAIMAGALFYILLGISFKVIKKNEIQLIPKLG
FT                   PKISPYIKD"
FT   gene            18000..20078
FT                   /locus_tag="Nther_0010"
FT   CDS_pept        18000..20078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0010"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: gur:Gura_2815 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83609"
FT                   /db_xref="GOA:B2A2Z5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z5"
FT                   /protein_id="ACB83609.1"
FT                   /translation="MKSYQPDQIRNVGLCSHGGAGKTSLTEALLYSSNSIDRLGNVEDG
FT                   TTTTDFDKEEVDRGITINTSVAPCEWKGHKLNLVDTPGYFDFIGDVKSSLRIVDGALIV
FT                   VCAASGVQVGTEQVWHYADENDLPRVVFINKMERENASFNRTLEQLRENFGDQVVPVMI
FT                   PIGSEDSFEGVINLVTMKANYHKGDGKEFSEEEIPSEYQEEADNFREMLMEAVAECDDE
FT                   MLEKYLEGESLTEDEVINGVKQFTKEGELIPVLCGSAIQNIGVTQLMDCLKYYIPSPVD
FT                   LNYQGFNPETEEEVKINPSEEGPFSAFVFKTVADPYVGRLNYFRVYSGQLSDDKEAYNS
FT                   NNKTSERIGKLYYLKGKEQIPVNTVSVGDIAAVSKLQKTATGDTLSDSEKPVKLPEVEF
FT                   PDPVISFAVVTQDKGDEEKVGTSLSKFLEEDPILNLEKNDETKETLISGMGELQLEIII
FT                   EKMKKKYGVDVELKTPKVPYKETITKTVNAEEKYKKQSGGRGQYGHVFIEFSPLQEGEG
FT                   FQFENNIVGGVIPKTYIPAVEKGIFEAMETGVLAGYPVIDIKANLYDGSHHSVDSSEMA
FT                   FKVAGANAFKKGMQNAQPVLLEPVMEVEVRVPEKFMGDIMGDINSKRGKIQGMDPDGDY
FT                   QIIKAYVPQAEMLRYAIDLRSMAQGRGTFTSVFSHYERVPDDVRDEIIEETTAEKEA"
FT   gene            20325..21422
FT                   /locus_tag="Nther_0011"
FT   CDS_pept        20325..21422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0011"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /note="TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   D-alanine--D-alanine ligase domain protein; KEGG:
FT                   aoe:Clos_0292 D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83610"
FT                   /db_xref="GOA:B2A2Z6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A2Z6"
FT                   /protein_id="ACB83610.1"
FT                   /translation="MKKLRVGVLFGGRSGEHEVSLKSANSILNALDRELFEVIPIGIRK
FT                   NGEWISGEAPLEELETGIKNQGNYAVSILPDPSKKVLWKLDPFEKISEIDLIFPVLHGT
FT                   FGEDGTVQGFLDLCGIPYVGSGVLGSSLAMDKVMMKKILRRHGLQVANYYSFKRSEWEQ
FT                   DRDEIIFSIEKQLSYPIFVKPANLGSSVGISKVKNREELIQGIDLAVKYDMKCLAEEFI
FT                   PGKEIELSILGNDNPKTSVPGEIIPANEFYDYNAKYINNKSKLVIPAPLSETLKTKIED
FT                   MGVEAFRVLDCYGLSRVDYFVLEDQEEVYINEINTMPGFTEISMYPKLWTESGLSYSQL
FT                   LTDLIYLALARQQEKDRNSTDFSES"
FT   gene            21504..22391
FT                   /locus_tag="Nther_0012"
FT   CDS_pept        21504..22391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0012"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: mta:Moth_0009 pyridoxine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83611"
FT                   /db_xref="GOA:B2A2Z7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A2Z7"
FT                   /protein_id="ACB83611.1"
FT                   /translation="MNIEKGTETVKKGMAQMQKGGVIMDVTTPEQAKIAEKAGAVAVMA
FT                   LEKVPADIRAGGGVARMADPEVIKKIMDAVSIPVMAKARIGHFVEARILENLGVDYIDE
FT                   SEVLTPADEYYHIDKNKFTVPFVCGARNLGEALRRVGEGASMMRTKGEAGTGNVVEAVR
FT                   HIRTVMDGIRKVQNLPDDELMTEAKNIGAPYDLIKQVKEEGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSGDPEKRAKSIVEATLNYDNYDVLADVSSGLGEAMVGINV
FT                   SDLEEQERMQNRGW"
FT   misc_feature    22699..22907
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   106.73; T-box leader sequence"
FT   gene            22970..24238
FT                   /locus_tag="Nther_0013"
FT   CDS_pept        22970..24238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0013"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: aoe:Clos_0014 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83612"
FT                   /db_xref="GOA:B2A2Z8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A2Z8"
FT                   /protein_id="ACB83612.1"
FT                   /translation="MLDVKYIRNNPDEARKACVQKGEDDHVDEILKYDEQRRKILTDLE
FT                   VLKNKRNTVSKEIGQLKKEGHDAQDKIAEMKEVSDKVKEMDDELKKVDEQLNYHLLCIP
FT                   NIPNPDVPVGDDDEDNQVVKQVGEPVKKDYFKPHWEVAENLNLLDFKRAGKVTGTRFVN
FT                   YVGDAARLERALIDFMIDVHVTEHGYVEMMPPFIANRDSMTGTGQLPKFEDDMYKLEDM
FT                   EYFLIPTAEVTLTNLYRDEILPGDFLPRYLVAFTPCFRKEAGAHGRDTRGLIRQHQFNK
FT                   VEMVKFVEPEKSYQELDSLVANAERVLQLLELPYQISLMCTGDLGFAAAKKYDLEVWLP
FT                   SYDTYREISSCSNFEDFQARRANIRYRPEEGEKARFVHTLNGSGLAVGRTLAAILENYQ
FT                   NPDGTVTIPEVLKPYFNGRDVIS"
FT   gene            24325..24416
FT                   /locus_tag="Nther_R0007"
FT                   /note="tRNA-Ser1"
FT   tRNA            24325..24416
FT                   /locus_tag="Nther_R0007"
FT                   /product="tRNA-Ser"
FT   gene            24426..24521
FT                   /locus_tag="Nther_R0008"
FT                   /note="tRNA-Ser2"
FT   tRNA            24426..24521
FT                   /locus_tag="Nther_R0008"
FT                   /product="tRNA-Ser"
FT   gene            24544..24621
FT                   /locus_tag="Nther_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            24544..24621
FT                   /locus_tag="Nther_R0009"
FT                   /product="tRNA-Arg"
FT   gene            24786..25262
FT                   /locus_tag="Nther_0014"
FT   CDS_pept        24786..25262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0014"
FT                   /product="tRNA-adenosine deaminase"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   sth:STH11 putative Cu-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83613"
FT                   /db_xref="GOA:B2A2Z9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2Z9"
FT                   /protein_id="ACB83613.1"
FT                   /translation="MPSHNNTDKYWMQQAIDQAKLAYNKGEVPIGAVIVKDEQLIATGF
FT                   NKRETSQDATSHAEIIAIQSACNYLGGWRLLDCTLYVTIEPCPMCAGAILQSRITKLVF
FT                   GTEDPKAWGELSISQLLQNPQLNHQVDIVEGICKEESKDIIKQFFHELRKRKKN"
FT   gene            25323..25414
FT                   /locus_tag="Nther_R0010"
FT                   /note="tRNA-Ser3"
FT   tRNA            25323..25414
FT                   /locus_tag="Nther_R0010"
FT                   /product="tRNA-Ser"
FT   gene            25493..25588
FT                   /locus_tag="Nther_R0011"
FT                   /note="tRNA-Ser4"
FT   tRNA            25493..25588
FT                   /locus_tag="Nther_R0011"
FT                   /product="tRNA-Ser"
FT   gene            25756..25858
FT                   /gene="ffs"
FT                   /locus_tag="Nther_R0012"
FT   ncRNA           25756..25858
FT                   /gene="ffs"
FT                   /locus_tag="Nther_R0012"
FT                   /note="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            26074..27843
FT                   /locus_tag="Nther_0015"
FT   CDS_pept        26074..27843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0015"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0034 DNA polymerase III gamma and tau
FT                   subunits; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; DNA
FT                   polymerase III delta; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83614"
FT                   /db_xref="GOA:B2A300"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A300"
FT                   /protein_id="ACB83614.1"
FT                   /translation="MDYQALYRQWRPKYFRDLVGQEHVVTTLKNAISQSRISHAYLFSG
FT                   PRGTGKTSVAKVFAKALNCDHSQDNEPCGQCSRCIEHDRGTFMDILEIDAASNRGIDEI
FT                   REIRDHVAYSPSEGNYKVYIVDEVHMLTTEAFNALLKTLEEPPDYVIFILATTEPHKLP
FT                   MTVLSRCQRFDFYRLSTSKIEKQLQNVIDSKNLSATKESLSIIAKKSDGGMRDALSLLD
FT                   QSLSFLGSGEQLKVDHVLEVTGTVSEDTFYDLLMALKEGDLAQILNIVQQLSDSGKDFG
FT                   QFLNDLIVYLRDLLLFKLKGPSDQLLWGSVDSVKKLHKYFTKDELISMIDFLSEKQQAM
FT                   KWSQNRRLIVEMAFYRIINKYNTSFEAEYKEKETKQKNNEETNDKSLKVQQTTSIESVE
FT                   SENKENAKLQDQSSLPKQTDDQSNKNNDSSKLSREDSDIQQSETKKDKMTEQQEATVQN
FT                   DLNLKIVTEQWDAVLEKLKQRKVTAHALVFEGKPVDVKENTLYLGFKKLHKLHKERVEQ
FT                   KEKGLLEEVLSEFFGDIKVKCIIVEETDLSKQNTKQGNDHKGNSQNEEMDDLTGIAKQK
FT                   FGPDKVEIYNKQI"
FT   gene            27861..28178
FT                   /locus_tag="Nther_0016"
FT   CDS_pept        27861..28178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bld:BLi00029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83615"
FT                   /db_xref="GOA:B2A301"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B2A301"
FT                   /protein_id="ACB83615.1"
FT                   /translation="MGGKMQKMMKQVQKMQSEMQKVQEELKDQTRTGTAGGGAVEATVN
FT                   GHKEVVDISIDPDVIDPEDSEMLEDLIMAAVNDGLKNVDEMVSEEMKKVTGGMDLPPGM
FT                   F"
FT   gene            28179..28778
FT                   /locus_tag="Nther_0017"
FT   CDS_pept        28179..28778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0017"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: bha:BH0036 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83616"
FT                   /db_xref="GOA:B2A302"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A302"
FT                   /protein_id="ACB83616.1"
FT                   /translation="MSNYPKPINRLIEALSYLPGIGPKTAERLAFHIVSMDETKVNHLI
FT                   TALQDSRDKVFECSTCNNLTDKDPCTICQDESRDSNLICVVQDARDVTAIEKVQDFQGK
FT                   YHVLQGVISPMEGIGPDDLNLKALMDRIQGEGITELVVATDPTVEGEATAMYLNKLVKP
FT                   LGVRVTRLAYGLPMGGDLEYADEMTLQQAFEGRKEL"
FT   gene            28964..29284
FT                   /locus_tag="Nther_0018"
FT   CDS_pept        28964..29284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83617"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B2A303"
FT                   /protein_id="ACB83617.1"
FT                   /translation="MSKLNNFVEYKDKLVAYLCYLYHHFDLIESNEDLTWEDQLLNELK
FT                   RTEQEIENAKKYFNSVTDPGLIEHAIYLIKASERKYRYLINQAKKMGVEGKLELKKSNN
FT                   LS"
FT   gene            29339..29620
FT                   /locus_tag="Nther_0019"
FT   CDS_pept        29339..29620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0019"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="TIGRFAM: pro-sigmaK processing inhibitor BofA; KEGG:
FT                   swo:Swol_0034 SigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83618"
FT                   /db_xref="GOA:B2A304"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:B2A304"
FT                   /protein_id="ACB83618.1"
FT                   /translation="MFEGELNFWLSLIFGLLFVYLLARLILQPAKIFFKVFLRIVLGAV
FT                   VLFLVNTAFGIFFDFQIAINVITALTVGFLGLPGMILLVATMLLVGGV"
FT   gene            29826..30482
FT                   /locus_tag="Nther_0020"
FT   CDS_pept        29826..30482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_0042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83619"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A305"
FT                   /protein_id="ACB83619.1"
FT                   /translation="MRYVEAFIGEYASGKSENAINRALDLQKQGREVTLVDLDTVEPFY
FT                   TLRPIKRKLEEQGLSVVAWETHETMGLGEAGSVLKPEMRWVLRRSGDIILDVGYGVHGA
FT                   KIFNLIEGALEDKELKIYVVINTSRPMTSQPERIVSYIESLGKVDGIVHNTHLGAMTDL
FT                   ETIIEGKEKVEEAASKLDLPIIATAIEKSMLSEAKTLDWGHELWPIERYMEESMW"
FT   gene            30553..34080
FT                   /locus_tag="Nther_0021"
FT   CDS_pept        30553..34080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0021"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: amt:Amet_4657 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83620"
FT                   /db_xref="GOA:B2A308"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:B2A308"
FT                   /protein_id="ACB83620.1"
FT                   /translation="MKKIMKTMDGNTAASYVSYALTDVAAIYPITPSSDMAEKVDEWSA
FT                   YGKKNIFDQEVLVTELQSEAGAAGAVHGSLAAGALTTTYTASQGLLLMIPNMYKISGEL
FT                   LPGVFHVSARALSAQALSIFGDHQDVMAARQTGFAFLASGSVQEVMDLGGIAHLASIKS
FT                   RVPFVHFFDGFRTSHEIQKIEALDYQVLKDLVDHQAIKEFRDRALNPENPVLRGSAQNP
FT                   DIYFQARESINPFYNQVPDIVADYMNKISEITGRDYKPFNYYGHPDAERVVIAMGSVTE
FT                   TLEETVDYLNSQGEKVGIIKVRLYRPFSDKYFFEVLPKSVERIAVLDRTKEPGALGEPL
FT                   YEDVKTLFYNSEKSPLIIGGRYGLGSKDTNPSHLKAVFDNLKQDKPKDSFTVGIEDDVS
FT                   NTSLPVKESINTSDEGITRCKFWGFGSDGTVGANKEAIKIIGDKTDMYAQGYFSYDSKK
FT                   SGGVTVSHLRFGKKPIRSTYLIDEADYVACHKETYVDQFDLLEGLKPGGTFLLNCTWSV
FT                   EELESRLPAKMKRYLAENDIDFYIINAVNIADEIGLGGRINMIMQSAFFKLTEVIPYED
FT                   AVKYMKEAIEDAYGKKGEKVVKMNWEAVDRAADALQKVEIPDSWRNAAQKEEVAADKDI
FT                   PEFVKNVAEPMNKHKGDQLPVSTFSGREDGTFPQGTAAYEKRAIAVKVPEWQKDNCIQC
FT                   NQCSLVCPHAAIRPFLLDETELSKAPENFETKKALGKALSGLQYRIQVSPLDCAGCGNC
FT                   EQVCPAKEKALIMKPRPEQTDKESYNWDFAVNQVSIKDNYMSVNNLKGSQFAQPLLEFS
FT                   GACAGCGETPYAKLITQLFGDRMLIANATGCSSIWGGSAPSTPYCKDQNGRGPAWASSL
FT                   FEDNAEFGYGMVLANKKIREKLAILMEEALEQDISSELKEAFKKWLANKDSGAGSKEAR
FT                   DEILPLLEKEDNPVVKEIADRKDYLVKRSQWIFGGDGWAYDIGYGGLDHVLATGEDLNM
FT                   LVFDTEVYSNTGGQSSKATPMAAIAKFAASGKNTKKKDLGLMQAIYGHVYVAQIAMGAN
FT                   MNQALKAINEAEAYPGPSLIIAYSPCINHGIKSGMGAAMEEMKKAVDSGYWNLWRYNPE
FT                   LAEQNENPFILDSKEPTESFKDFLMGEVRYAALANEFPEIAEKLFDQLEQDAKQKRRTY
FT                   ELLSENKLF"
FT   gene            34212..35294
FT                   /locus_tag="Nther_0022"
FT   CDS_pept        34212..35294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0022"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   mta:Moth_0033 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83621"
FT                   /db_xref="GOA:B2A309"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B2A309"
FT                   /protein_id="ACB83621.1"
FT                   /translation="MSDKPITGDQKAFMTGNEVVAWGALAAKADIMYGYPITPQNEIMH
FT                   YWTRLAPQYDKKFLQTEDEISAGFTTVGGVLAGKKGFSATAGPGNTLFQEAISMAEMMR
FT                   VPTVMAITQRGGPSTATVIYSQQEVTMTSYGGNGEGFRIVYSTATHQELFDYTIKSFNA
FT                   AWKYRFPAFVLGDGYQAKMREPLTMYDPEEKGIELIKPEASVGMEGVPGIDREVAHLRN
FT                   TYNTEDELYEVVMDLAKAYEEIAPEVVEYEEYKTDDAEVLLTGHGVVNRACQAAVDILR
FT                   EQGIKAGAFRPITLRPFPEQELRQAVAKPDKLLVIESAHGQFKRQVTDALYGETIEMDT
FT                   LYKPGMGVTAEEIVERVKSY"
FT   gene            35322..36071
FT                   /locus_tag="Nther_0023"
FT   CDS_pept        35322..36071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0023"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: chy:CHY_0044 putative keto/oxoacid
FT                   ferredoxin oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83622"
FT                   /db_xref="GOA:B2A310"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2A310"
FT                   /protein_id="ACB83622.1"
FT                   /translation="MTELQPSMPKSWCKETKPHKFCPGCGHGLVLKALGEVIDELDIQG
FT                   NTVFGCDIGCSLLAWDFFNVDSIQTHHGRTTPVITGIKRVRPEMVGIAYMGDGGGYAIG
FT                   SQHLLNSATRNELVTIILVNNANYGMTGGQMAPTTLPDMKTETSPYGRDVQETGNPTKG
FT                   PEMLSAICQDGAYVARGSISNLRNLKKYIKNALTNQLEGNGFSFVEALASCPTNWRTNA
FT                   TQTWDFVENDMSKYFEVGEFLTPKKEG"
FT   gene            36074..36670
FT                   /locus_tag="Nther_0024"
FT   CDS_pept        36074..36670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0024"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: chy:CHY_0045 putative keto/oxoacid ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83623"
FT                   /db_xref="GOA:B2A311"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B2A311"
FT                   /protein_id="ACB83623.1"
FT                   /translation="MDNTTKIALAGEGGQGVQSVADIFAEAANDTEKQALYIPNFGVEQ
FT                   RGGVSVAYVQIAEEQIGSPKFTKGDIVVALSGRAVDRTEKYVGENTIFVYDSSLIDMPE
FT                   ERENEGSGLGQAKKILGIPANDIAKQEFHPRVFNIMVLGAVIELSKVLPPEAVKNAIEK
FT                   KLQRKFEQNPKLREMNMEAFDRGMELAKESAEEKI"
FT   gene            36688..36948
FT                   /locus_tag="Nther_0025"
FT   CDS_pept        36688..36948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0025"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_0046 putative keto/oxoacid
FT                   ferredoxin oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83624"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A312"
FT                   /protein_id="ACB83624.1"
FT                   /translation="MSAAENYQKLTYEKEGKGKWHLFPGLCKGCGLCMEKCPKNVISWS
FT                   DQLGVYGTPAVEIDAEGCIYCGICEQVCPDVAIKVEKEKKK"
FT   gene            complement(37023..38330)
FT                   /locus_tag="Nther_0026"
FT   CDS_pept        complement(37023..38330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0026"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bca:BCE_A0167 helix-turn-helix/TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83625"
FT                   /db_xref="GOA:B2A313"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2A313"
FT                   /protein_id="ACB83625.1"
FT                   /translation="MGVVGNNIGQKIKRARYEKDMTQEELAGKDFNRSFLSQIEKGLVK
FT                   PSDRVLSIIADRLNLPLSYFYEPEDPDKDDEQAINALNKARNLIQSNKMDEALELITKS
FT                   LKLQDISPKYAGLLMKEQGEIYFQGNNIQKSLSSLKKAKIIFGDHKYHHELCSTLNHIG
FT                   EIYNQSESYKEATQHLQQAINILEDHFVMDNILYLDVYFNLALSYLGEQKYHEAINTLT
FT                   QAIPYSSKTNNFYNFGELHYLLGRCYQKTGKFAKARVAFETAIEQFVMFNKNKYTGKTQ
FT                   LALGELEETEGNLTSAERYYLKALEQFTLLESNDQRERLKLKLLNIYLQLDKKEKIKGL
FT                   APFDLELVDSLSEKIDLSYELSKIHLEKEDFDNCFIVLQFLNDLVDRARRRKIFSDKKL
FT                   LFYYSWMSHLYLNMEYYERGRKCLKQCNSIIKKLGE"
FT   gene            38506..40578
FT                   /locus_tag="Nther_0027"
FT   CDS_pept        38506..40578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0027"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   aoe:Clos_0911 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83626"
FT                   /db_xref="GOA:B2A314"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:B2A314"
FT                   /protein_id="ACB83626.1"
FT                   /translation="MSDDLFALDIGTRSVIGLVCRPDNENKIKVRSFEIREHEMRSMYD
FT                   GQIHDIDSVAQVVQDVKTTLEKKTDNKFGSAAIAAAGRSLETEKYYLETSLNPEQRIDP
FT                   EQVYALELEAVKAAENQLQERMSSRNIHDPNYYCVAHSVINYTLNSHDIINPIGQKGDT
FT                   LGVEIIATFLPQVVVDGLEGVMNQVGLSISNLTLEPIAAISLAIPEKIRMLNLALVDIG
FT                   AGTSDIAITDKGSVVAYQMVPLAGDEITDKLCKELLVEFDTGEKIKFFLSQNKKEKLSY
FT                   YDILGNKQEITKQKLKTIIEPQLERLSKNIGEAILEVNNGAPSAVFCVGGGSELPGLAE
FT                   KLASKLDLPQEKVAVKGYEKWEKVKNLRKGLKGPQGVTPLGIALSSVQNKNFGFIDVTV
FT                   NNELVRLFEHGDIKVANALVSVRFPMKDLIPKPGEGLTVWLNGEKIYYPGQEGKTAQIK
FT                   VNGEPASLETELKTGDEITVEPAQKGPKASVKISQILKQTTNQYFYFNDDQINFPQAIY
FT                   IDKERIDQKKGLDLYINQDCQIETRVINTVDELMKRLEIDNTKYCLYDSQNNRFLDDTE
FT                   NIKPQQEIIVKQKSLNDSKSDEIVESETTKGENKDKGPEQIQINVNGEELQLPEKDSHI
FT                   FMDIFNVVDFKTSMKKGDLVMKINGEPAEFTDVIKNGDELMIYWSEEGPKKLPRI"
FT   gene            complement(40685..42049)
FT                   /locus_tag="Nther_0028"
FT   CDS_pept        complement(40685..42049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0028"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: pth:PTH_2713
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83627"
FT                   /db_xref="GOA:B2A183"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A183"
FT                   /protein_id="ACB83627.1"
FT                   /translation="MFCENVTMTKKVTYQMTQEEIKKLNIINQTIDGYLTIRDAARALN
FT                   LSDRQIKRLKKGVQLEGPSFVIHKSRGKKPDHSVPESTEKHIISLKLEKYPNANFTHFT
FT                   ELLNEREKISISRPVVHRILSKAGISSPKKHKKSKSHHRRKRKDRMGLLVQIDASPYDW
FT                   FDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIF
FT                   RSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLP
FT                   TLFKLHNITTMEKANEFLQKDFLPDFNKRFALKPENELSAFTCLNQDINLDHILCSKFK
FT                   RTVDNSATFSFEGSYYQILDKNSQLVPKSKVTVLSNPKFGVKVKYKDMVFETQIVDKPS
FT                   TTKMTKKVKTTQSPKNRIVPDENHPWRKQSERTNLNYDLTDQELLDTILNTRDRV"
FT   gene            42241..43698
FT                   /locus_tag="Nther_0029"
FT   CDS_pept        42241..43698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0029"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="KEGG: csc:Csac_1713 inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83628"
FT                   /db_xref="GOA:B2A316"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B2A316"
FT                   /protein_id="ACB83628.1"
FT                   /translation="MEYNDKIVNEGLTFDDVLLVPSKSQIIPKDIDIQTRLTNKIRLNI
FT                   PLMSAGMDTVTEARLAVAMAREGGIGIIHKNMSIDKQATEVDRVKRSEHGVITNPFSLS
FT                   QNHKISDAAALMERYRISGVPITESGKLIGIITNRDLRFETDFNRPIKEVMTDSNLITA
FT                   SEGISMSEAQKILQENKVEKLPLTDDEGNLKGLITIKDIEKSIKFPNAAKDETGRLLAG
FT                   AAVGPGKDLDERVAALVEAKVDVIVIDTAHGHSQNVIKAVRYVKETYPDVELVAGNVAT
FT                   TEGTKDLIEAGADAVKVGVGPGSICTTRIVCGVGVPQITAVLDCAKVAKEYGVPIISDG
FT                   GIKYSGDIAKALSVGADVVMIGSLFAGTDESPGEFEIYQGRSYKVYRGMGSETSMKLGS
FT                   KDRYFQEDKRKFVPEGIEGRVPYRGTLQDTVYQLVGGLRSGMGYCGAADIESLQKDSRM
FT                   VRITASGLKESHPHDVQITKEAPNYSL"
FT   gene            43979..45328
FT                   /locus_tag="Nther_0030"
FT   CDS_pept        43979..45328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0030"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   amt:Amet_0315 sodium:neurotransmitter symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83629"
FT                   /db_xref="GOA:B2A317"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B2A317"
FT                   /protein_id="ACB83629.1"
FT                   /translation="MPNEPREQWASRLGFVLAAAGSAVGLGNIWRFPYVVGEHGGAAFL
FT                   FLYLIAIVLIGYPVMITEISMGRSTQKNPVGAFKALAPNTPWWLVGGLGVLTGFVILSF
FT                   YSVIAGWSMSYIFKAIAGFPEGAGANEQLFGQHIAGVAEPLIYHFIFMVITVGVIAAGV
FT                   VKGIQRIVELLMPILVVLLLIVVFRGVTLEGAGEGLAFLFSPDFSAVQPETILSAIGQS
FT                   FFTLSLGMGAIITYGSYLSSKDEVPNSAIQIIGADTGIAILAGLAIFPAMFALGFETTQ
FT                   GPGLVFITLPAVFAEMPMGELFGFLFFLLLSIAALTSAISLLEVVAAYVIDEKNWPRKK
FT                   AAAVVGAIIFVVGIPPALHAGVLSDVTIIGMDMLDFYDFISDSIMLPLGGVLTVIFAGH
FT                   VWGMKNVADEANKGSRGLKIGHWMEPLLKYVIPLGVLIVMIVGIIDTLGG"
FT   gene            45502..46953
FT                   /locus_tag="Nther_0031"
FT   CDS_pept        45502..46953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0031"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   drm:Dred_1815 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83630"
FT                   /db_xref="GOA:B2A318"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B2A318"
FT                   /protein_id="ACB83630.1"
FT                   /translation="MDSLQQAIDEYIKNQYSRYHTPGHIGGEGSPAISLLGEQVFKADL
FT                   TELPGLDDLHAPENVIKNAQSRAAQVFGADFTHFLVNGSSAGIIAMILAMVEPGKKLAV
FT                   PRNAHRSVYHGLILSGAIPEYIPVEVPKESPVAFNISPDELNNTISTNIDSSKTPEAVL
FT                   ITNPSYHGVAIDMNKVALDSNIPLLVDEAHGAHFIFSKDLPPDASEYGGDLWVQSTHKT
FT                   LGSLTQSSMLHGIENLVSREKLAFMLQLVQTTSPSYPLMASLESVIEYADKYHKHWQEF
FT                   ISNRLKYIRNKICEIPGLQLVTPEQITTGFKLDPSKLTIDLRELNISGYKLSDLLRNEF
FT                   GIQVELVDSNSIMLMLTPYHTERELDYLINSLETIVNNKNSYQIVNNTVDKQLVAKTDI
FT                   PYPQVEITPREAVYQEGEYIELSEAIGRVAQEFVIPYPPGIPALVPGEIITGDVYEYLN
FT                   KLTENPEIHIQGFYYSSSSYIKVIR"
FT   gene            46990..48327
FT                   /locus_tag="Nther_0032"
FT   CDS_pept        46990..48327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0032"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: rca:Rcas_3721
FT                   single-stranded nucleic acid binding R3H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83631"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A319"
FT                   /protein_id="ACB83631.1"
FT                   /translation="MEEFNQELKLMLEIFPPHIRENLQKRNDLEDLVEVVLDLGRKPEA
FT                   RYPREFIYLTDDTVTEKDLEFIYNRTGPFGLDNRSGIEKTLHRISAIRNRRDKIVGLTC
FT                   RVGKAVYGTADIIRDIVERGDKTLLLGRPGVGKTTILREAARILADEFRKRVIIVDTSN
FT                   EIAGDGDIPHPAIGHARRMQVKTPDKQHDVMIEAVENHMPEVIIIDEIGTYQEAEAART
FT                   IAERGVQLIATAHGNTLENLILNPTLSELIGGIDTVTLGDEEAKRRNSQKTVLERKAPS
FT                   TFDAVVEIFDRNTLKIHAPLEKVVDYILRGGAPRPEIRLRKNDGQHEIIQNSNITDEWN
FT                   EMDAQTEGNYQNDALQKIYPYAVSKDTLKRLIKELQVPAKLTKHMQEADIMLTVKAQKR
FT                   KGAKKIQKAYQENIPVHVIRKNKEKQVEKVLRHIFKKEVEENDSEM"
FT   gene            48342..48962
FT                   /locus_tag="Nther_0033"
FT   CDS_pept        48342..48962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0033"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: amt:Amet_0082 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83632"
FT                   /db_xref="GOA:B2A320"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B2A320"
FT                   /protein_id="ACB83632.1"
FT                   /translation="MSKRGKFITFEGIDGCGKSTQLKKVTSKLKKLGFNVVSTREPGGT
FT                   SVGDAIREILLAPKHYNMTIETEALLYAASRVQHIEEFIIPNLAEDNIVLCDRFVDSSV
FT                   AYQGIKLSHEEVIRVNQPAYDKVTPDITFLIDITPERAAKRLGIEKDRIENRGVNYQSQ
FT                   VRENYLFLAEEEPDRIVIINGDQSEEKVFEELWNVLEDILIRN"
FT   gene            49007..49342
FT                   /locus_tag="Nther_0034"
FT   CDS_pept        49007..49342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0034"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   bcl:ABC0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83633"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B2A321"
FT                   /protein_id="ACB83633.1"
FT                   /translation="MKMKLIIVILQDKDTPPLLDALNEKEIRVTKLASSGGFLRAGNTT
FT                   LLIGVTQDQVNDVIDLIKNHCSSRQQMVNPVSPVGGTTDTYLPFPVEVTVGGATIFVVD
FT                   VDNFEQV"
FT   gene            49378..49839
FT                   /locus_tag="Nther_0035"
FT   CDS_pept        49378..49839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0035"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   ctc:CTC00667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83634"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:B2A322"
FT                   /protein_id="ACB83634.1"
FT                   /translation="MARISGIGKRGEETNNKKTVTTPGSRKVNQKKQNFQTQFSKAHKQ
FT                   ELNKELDRLVADINEKGQNLANQMTWESFISYRQSIKNFLQVFIGEAYEVTGSRGRNRF
FT                   GSQKLYRHIETIDQKLAELGEKVVKNEGEKMEVIARIDEIRGLLLDLYQ"
FT   gene            complement(49918..50661)
FT                   /locus_tag="Nther_0036"
FT   CDS_pept        complement(49918..50661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0036"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: amt:Amet_4265
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83635"
FT                   /db_xref="GOA:B2A323"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B2A323"
FT                   /protein_id="ACB83635.1"
FT                   /translation="MEALVYSFLAGISTAIGAIIVAFFGQPSQRALSGLLGFAGGIMLA
FT                   ISAFDLMPESLEIGSMSSTIIGFSFGAIMMYALDKFIPHAHMSGGEDIIEENTSPLNNK
FT                   EILRTGYLIFFGIALHNLPEGLAIGAGLESSPELGLYIAIAIGLHNIPEGMATAGPLRA
FT                   GGLRWIKVFLLTLFAGLMTPLGAALGLIIFNISPVLVAGGLAFAAGAMVYIVSDELIPQ
FT                   SHNLHSHIANAGLIIGLLLGFVLTS"
FT   gene            50786..51847
FT                   /locus_tag="Nther_0037"
FT   CDS_pept        50786..51847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0037"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: cpr:CPR_0784
FT                   ISCpe7, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83636"
FT                   /db_xref="GOA:B2A0U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A0U4"
FT                   /protein_id="ACB83636.1"
FT                   /translation="MTKVVCPRCNNNCSDKFYRFGFDNHGHQKYQCQECFSQFAPKTLS
FT                   KGGDKRGPNKPRKYPSCPKCGKATFLHHDYEFYSNLRCWDKSCNHSFYVPKPQSIPEPS
FT                   QLDIDGKVDFSNMRHSLHTVIRALYLYFINGSSTRGVSQFLIDCEGIKVSHVTIADWTK
FT                   KFAPLFLYISRYLKPIDLDSSDEWHVDETVIKIKGKRFYAWTVIDAETRFVLAFHLSPY
FT                   RDSQAAFKVLNYAKKHFGQPHSIVTDRYWAYNAPIKVLFPNSNHIRVESFQDDISNNLI
FT                   ESFFQIFKSWVKQRRGFASFQSANKLIAVFVFAFNFVRTSNVLNQSTPAQVAGINYSNR
FT                   NRTFWLLHSNNAA"
FT   gene            52041..53003
FT                   /locus_tag="Nther_0038"
FT   CDS_pept        52041..53003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0038"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: cth:Cthe_2105 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83637"
FT                   /db_xref="GOA:B2A325"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A325"
FT                   /protein_id="ACB83637.1"
FT                   /translation="METTQETINFQTWSFDKFIGQEKIVKNLLRQLTSGNTGHAYMFVG
FT                   PEGQGKGSLARIFAAGLLCESVDENSGPCGICYSCSKLKKSIHPDLVTIGSESKSIKIE
FT                   EVRKVKQYINYRPTDSKKKIYLIESAENMTREGANSILKMLEEPPEYVVFLLTVNELER
FT                   MLPTVISRCQIHQFLPLTEEQLYKALSNRTHASQEQLELAVSLSGGMIGRGLAILQDES
FT                   YYDMIKKAHSFVEKFEKLTLPELLDWAEKIDSMDNCEEFLELLNIVFKQKLSENQTSDS
FT                   INKLARIMEIILETKGQLLTNVNRLLALEAMMVKIKEVD"
FT   gene            53006..53914
FT                   /locus_tag="Nther_0039"
FT   CDS_pept        53006..53914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0039"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: ctc:CTC00222 tpl
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83638"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B2A326"
FT                   /protein_id="ACB83638.1"
FT                   /translation="MEKYIVVGVRFKKAGKIYYFDPNDIDLEVGNKVIVETARGLEFGQ
FT                   VVTGPKEVTEEDIVAPLKQVLRKATEEDEEKVAEIKQKEDQAFEVCLDKISKHGLEMKL
FT                   VDVEQSFDGSKIIFYFTADGRVDFRELVKDLASVFKTRIELRQIGVRDEAKMLGGIGPC
FT                   GRIMCCASFLGDFEPVSIKMAKEQNLALNPNKISGICGRLMCCLRYESDIYEEAQETFP
FT                   QTGEIVDTGEGKGEVQDFNVIKETVQVKMEDTHIIKEYNLDELTRINGGCGGQHKCHSK
FT                   DHCHNNQLEKDIEDELRKLED"
FT   gene            complement(53936..55492)
FT                   /locus_tag="Nther_0040"
FT   CDS_pept        complement(53936..55492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0040"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: amt:Amet_1618
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83639"
FT                   /db_xref="GOA:B2A327"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2A327"
FT                   /protein_id="ACB83639.1"
FT                   /translation="MPGSSENSRKISLKKLLQNTSPELFTEFADLGTTGTDIEGVTISG
FT                   ITDNSKEVTPGKIFVACQGTKVDAHDYIEEAIANGASTVILERADYIDKVKDSAIPYFK
FT                   VRNGRKTLAKLASTFYDHPSHRLIVTGITGTNGKTTTTTLIDYIINQLGVKSGLIGTVN
FT                   CKINGEEFDSKLTTPPATELYSLIEKMVQKEVKYLTKEVSSHGLKQDRVSAINFDIAGI
FT                   TNISYDHMDFHDSWDDYFKSKTKFFQMLSPDSISVLNADDPNAISMGDKTRSKVITYGI
FT                   SSPGAMITAENVDLKPFETSFTYQIKEELPTVTNKPVRPQSHNLKIRMPGKHNIYNTLL
FT                   AISVCIMAGFDPEQVIKTAEQFPGLFRRLEVIYKNSFTIIDDCAHNPASIRSVFETISQ
FT                   LPFNRLVIVFAIRGSRGDQINLENSQRLVKWVNHLPVRELIITTSKSHAAPTNQVHSSE
FT                   QTAFLSPLKTSGTPFKFIHNLEETIETALNEVKQGDLLMILGPYAINEGQEIVRNYLSN
FT                   S"
FT   gene            55590..56447
FT                   /locus_tag="Nther_0041"
FT   CDS_pept        55590..56447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0041"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tte:TTE0104
FT                   predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83640"
FT                   /db_xref="GOA:B2A328"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2A328"
FT                   /protein_id="ACB83640.1"
FT                   /translation="MGNNTKKGKLFLCPTPIGNLRDITLRVIDCLKEVNLVACEDTRRT
FT                   KKLLNHLEINVEMLSYHKFNQESRGQQIIEKLLQGMDVALVSDAGTPSISDPGKFLVQE
FT                   AIQKEIEVIALPGPSAPITALAGSGLDTDSFMFLGYIPEKGIERKDILAEIIGSAHTVI
FT                   LYENYNRLEKTINDLSKQLGKRQIVIAKELTKVHEQYIRGTAKELLEYLEKNSIKGECT
FT                   VLIQGANHTTELNYLPGEDAKSHLNELIGQGFTKKQAIKLVSQLREIPKREVYQIALEL
FT                   EKEK"
FT   gene            complement(56542..56793)
FT                   /locus_tag="Nther_0042"
FT   CDS_pept        complement(56542..56793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0042"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: cac:CAC0310
FT                   regulators of stationary/sporulation gene expression, AbrB
FT                   B.subtilis ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83641"
FT                   /db_xref="GOA:B2A306"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B2A306"
FT                   /protein_id="ACB83641.1"
FT                   /translation="MKSTGLVRRVDELGRIVIPIELRRNLGIEQKDALEIFIEGEQIIL
FT                   KKYEPACLFCGTADEEEMVRYKSKNICKHCIDQLSNES"
FT   gene            57085..59052
FT                   /locus_tag="Nther_0043"
FT   CDS_pept        57085..59052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0043"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: gtn:GTNG_0030
FT                   methionine-tRNA ligase/methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83642"
FT                   /db_xref="GOA:B2A307"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B2A307"
FT                   /protein_id="ACB83642.1"
FT                   /translation="MARDNTFYITTPIYYPSDKLHIGHSYTTVAADCMARYKKLTGYDV
FT                   MFLTGTDEHGQKIERKAKENGKNPQQFVDEIVASIKELWTLLDIEYDDFIRTTEERHKS
FT                   VVQKIFERFYEQGDIYKDQYEGWYCTPCESFWLERQLDEAKTCPDCAREVEWVKEESYF
FT                   FKMSKYADRLLEHIENNPEFIQPESRKNEMINNFLNPGLEDLCVSRTTFKWGIEVPMDK
FT                   DHVVYVWLDALTNYLSALGYLSEDDTKFQKYWPCDVHLMAKEIVRFHSIYWPIFLMALD
FT                   LPLPKQVFGHGWLLLEEGKMSKSKGNVVDPEVLVNKYGSDAIRYYLLREISFGSDGVFT
FT                   LEALIRRINYDLANDLGNLLNRTVAMIDKYFDGQIPEPVVSEQVDNDLINHAQETVTET
FT                   EKHMEGMDFSEALKALWELIGRTNKYIDETQPWILGKDPNKKDRLATVLYNLSESLRYI
FT                   SVLLSPFMPRTPKQIRSQLGIDNNKEIQTYKSLYEWGQIPSGVRVSKDKPLFPRLEIEE
FT                   ELESFNDNSEEPQKEEKEQDSLKYPELKEQVDIKDFQKLDLRVAEIVNVEPIKGADKLW
FT                   KVNVDLGFENRQVVAGIKESFGAEDLIGKKVILVANLKPAKIKGVKSQGMILAANDEGT
FT                   NQLELPNFISDKITKGSQVR"
FT   gene            59054..59824
FT                   /locus_tag="Nther_0044"
FT   CDS_pept        59054..59824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0044"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: tte:TTE0111 Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83643"
FT                   /db_xref="GOA:B2A3L7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3L7"
FT                   /protein_id="ACB83643.1"
FT                   /translation="MNIIDTHAHLDDKRFSSDLEDVIERAKQKKVSQIINVGINIDSSQ
FT                   KSVEMAKKYPEIYATVGVHPHDAKKVPDNYLDELKKMVTENKDVVVGIGEMGLDYFKNR
FT                   SPQETQKSIFRAQLEFAKELQLPVIIHDRAAHEDALEIVKDFQNDVFGVFHCFAGDEEI
FT                   ASQVMDMGFYISFTGNISFQKADKLRDVVKYAPLSRIMIETDCPYMAPVPFRGKRNEPA
FT                   FTRLVAEEVADIKGESFEDVVTTTTKNAKDLFRI"
FT   gene            59836..60687
FT                   /locus_tag="Nther_0045"
FT   CDS_pept        59836..60687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0045"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; G5 domain protein; KEGG: cha:CHAB381_0301 rare
FT                   lipoprotein A RlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83644"
FT                   /db_xref="GOA:B2A3L8"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3L8"
FT                   /protein_id="ACB83644.1"
FT                   /translation="MKTMRISLLFGLFLLFLQMDSGALVMEQEYQVEVVIDGEKTDELT
FT                   VKGKPEQENLIEKIDLELDDQDEVKLTELKADNSDQDIYWRLEINEWRTETEEQVEILP
FT                   YGEETRENDQLLKGKTRKIQEGQRGSRIKEIRSEYLGDELINEEKNYDVIELPQTEIIE
FT                   KGTYEPPGYSYIEDKEVIEVKGTETGEASWYGARFHGNRTFSGEIYDMYDLTAAHPSLP
FT                   MNSLVHVEFPVTGESVIVRINDRGPHVGGRIIDLSKQAAEKIGLAPHGVGDVKVKVLEN
FT                   DN"
FT   sig_peptide     59836..59919
FT                   /locus_tag="Nther_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.317 at
FT                   residue 28"
FT   gene            60730..61638
FT                   /locus_tag="Nther_0046"
FT   CDS_pept        60730..61638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0046"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   lin:lin0227 dimethyladenosine transferase (16S rRNA
FT                   dimethylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83645"
FT                   /db_xref="GOA:B2A3L9"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A3L9"
FT                   /protein_id="ACB83645.1"
FT                   /translation="MNLFSPKEVSQLLKRYEIHPKKSLGQNFLVDGNIIQKIIAAAELK
FT                   EQDIVLEIGPGLGTLTRDMSFYVNEIFAIELDQRMIDILQETVGSCDNVNIIHNDALKL
FT                   DYQELISDFIEFSPAQLQCKSKQINPKNLKAVSNLPYYIASPLVLKLAKEKVPLSVMVL
FT                   MVQREVADRFTASPGSKNYGAVTVLLDCFYEVEGVFNVPKTVFYPQPRVESQVVKLTKR
FT                   SEAKINDDYQEDFIKFVNQAFNSRRKTLVNNILSIFTGEKSELSQILENNGFSAGIRGE
FT                   QLTVDEFAQIFKIIYNRIKYS"
FT   gene            61686..62162
FT                   /locus_tag="Nther_0047"
FT   CDS_pept        61686..62162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0047"
FT                   /product="protein of unknown function DUF458"
FT                   /note="PFAM: protein of unknown function DUF458; KEGG:
FT                   chy:CHY_2615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83646"
FT                   /db_xref="InterPro:IPR007405"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M0"
FT                   /protein_id="ACB83646.1"
FT                   /translation="MYRSPSRGELNLTEVYWDIVNYILDSSEEKYNLIIGTDSHNLQDQ
FT                   CCFVTAIIVHREGKGARYFFTKKQEDHITSLRHRIFYETSLSVEVAGELFKKLKDSSVK
FT                   DNNLNLEIHLDIGEKGETKELIREVVGMVLGSGFSPKIKPESYGATKVADKYTK"
FT   gene            62269..62535
FT                   /locus_tag="Nther_0048"
FT   CDS_pept        62269..62535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0048"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   tte:TTE2561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83647"
FT                   /db_xref="GOA:B2A3M1"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M1"
FT                   /protein_id="ACB83647.1"
FT                   /translation="MPDYNAIGEIKDSLEQCVGKKIKLKANGGRKKVIEKEGILENTYP
FT                   SLFIIRVDESSFSQRFTFNYADVLTKTVELTLIDDKQWNLAAK"
FT   gene            complement(62544..63005)
FT                   /locus_tag="Nther_0049"
FT   CDS_pept        complement(62544..63005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lin:lin2600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83648"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M2"
FT                   /protein_id="ACB83648.1"
FT                   /translation="MAKKWTNDEIKLLKKLYPRASKTELEQTFNRSMAAITFKANNLNL
FT                   KRQKYWTKKEEDLLKKYYPEISDEELSELLERSVASIRNKASRLNLKKNTNQNPSKPWS
FT                   KMEVEKLKRLYPTTDSRELERIFNRSMNAIRNKAFQLNIKKMPNKKGPK"
FT   gene            63196..64719
FT                   /locus_tag="Nther_0050"
FT   CDS_pept        63196..64719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0050"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: tte:TTE2560
FT                   LysM-repeat proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83649"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M3"
FT                   /protein_id="ACB83649.1"
FT                   /translation="MVKGKEITTNRLYDRMVVNERFVWEDVTVEIQPDSPDRDIIKPNY
FT                   IEVKNITASPMPDKVEIAGELEGEVPYLDDLSPEYLSTSFRKTINLQGVRDYHEIIPLV
FT                   RVDKIYKQVKDSSVIKLKFYLEIFLQIIRPMDIEIVKEMAEDLGEANRERITYLSQVKS
FT                   EQKSFQLKCDHLLSYNPKEIKQIDAGIELSQINQENETLILGGKIIGQSAFIAEETGER
FT                   IKESFTEDFYQEISLPSLKPEMVADVFPRIETIGYSDQKEQKLEINVEISLIISLKNVI
FT                   EKEVISEVVHTDAEVDFETLNFTIPKTKQISEQVEKRVPLEVAENLQENTDGIDAQIVN
FT                   LTKEINKDMITIKGQLELVTTKQVDQKTEDNEMQFDFQKDVRFKGMQREDNVYVHPRIE
FT                   FVILEFNESEHEENNNEVFVQAFINFVIIKIKDYQYQLVTDLEYNQSEEKLKSSNQTTF
FT                   LKVYVVQKNDTIYEIAHRFGLDPEDITKANDIKNPDMVFEGQKLFIPKS"
FT   gene            complement(64751..65023)
FT                   /locus_tag="Nther_0051"
FT   CDS_pept        complement(64751..65023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0051"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   amt:Amet_4793 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83650"
FT                   /db_xref="GOA:B2A3M4"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M4"
FT                   /protein_id="ACB83650.1"
FT                   /translation="MLESFFLTFLLVFLAELGDKTQLATMLLATQKKAPVGVFLGASCA
FT                   LILSSLLGVTLGTVLTKFLPPNILKIGSGVAFVAIGIFLIFGPNN"
FT   gene            65183..66433
FT                   /locus_tag="Nther_0052"
FT   CDS_pept        65183..66433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0052"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: tte:TTE0925 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83651"
FT                   /db_xref="GOA:B2A3M5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M5"
FT                   /protein_id="ACB83651.1"
FT                   /translation="MKSDTSGNKKVIITLIFLLMINTFTVSDVTAKQLYPQEFETPEIE
FT                   AETAVLMEFESGKVLYDQEMHRQMHPASTTKIMTALLLIENASLREQVVVSENAFGTDG
FT                   SSMYLNLDEKITTRDLLYGLMVRSANDAAVAIAEYVAGSVENFADMMNSRAKELGAKNT
FT                   NFKNPHGLTEENHKTTAYDLGVIAREALKNPKFRSVASTRRITLDWPEEEDEDRLLVNR
FT                   NELLADYPGALGVKTGYTRSANQTFVAAAERDGMTLIAVVLSTSRNRLFEDAKELLDFG
FT                   FEAFEQVEIFEQNDVITSTEVENSNQELELIVEESLSLPIPKMATEIEQRVDLEEQLLK
FT                   APIEEGEQVGSLDLLLEEEEIVSVPLYTKEDVEKAPRYGFWILAVMITIPAIFLIYKRY
FT                   YELKSRKKFQEKLKNRY"
FT   sig_peptide     65183..65278
FT                   /locus_tag="Nther_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.773) with cleavage site probability 0.355 at
FT                   residue 32"
FT   gene            66478..67518
FT                   /locus_tag="Nther_0053"
FT   CDS_pept        66478..67518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0053"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase;
FT                   Nicotinate phosphoribosyltransferase-like; KEGG:
FT                   mta:Moth_1836 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83652"
FT                   /db_xref="GOA:B2A3M6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M6"
FT                   /protein_id="ACB83652.1"
FT                   /translation="MDRMDSLHNVEKWDPKTNRRLWSANHEEIIKGGTTDIYFVRTQEI
FT                   LNHMNYGDTEVTVEIFPSRPGIMAGTEEALGLMADAHNLEIWALPEGETFDKKEVIMRI
FT                   KGPYQEIGIYETPLLGILASSAGWAEAARECREIVGEDKQLVCFGARHLHPAVAPVMER
FT                   AALVGGFDGCSCILGAKLKDQKPMGTVPHAVFLIVGDTVRVAEAYHQAMPGEAPRIILV
FT                   DTFKDEAEEALRVARSLDDDLAGVRLDTPSERGGVTPGLVREVRARLNQEGFDHVKILA
FT                   SGGMNPDKISRLIDEGVDAFGVGSYIARSKANDMTMDIKEVNGKPIAKRGRIPGIVNSE
FT                   KLLKMK"
FT   gene            67617..68426
FT                   /locus_tag="Nther_0054"
FT   CDS_pept        67617..68426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0054"
FT                   /product="cyanophycinase"
FT                   /note="TIGRFAM: cyanophycinase; PFAM: peptidase S51
FT                   dipeptidase E; KEGG: aoe:Clos_2107 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83653"
FT                   /db_xref="GOA:B2A3M7"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M7"
FT                   /protein_id="ACB83653.1"
FT                   /translation="MSREHGKLIIIGGNEDKNNDCEILKSFIEMAGKDKAKLAVIPTAT
FT                   KEGQVTGETYQDLFYSLGAESVEILYVNSRRDANKTEVMEKLQNSTGVFFTGGDQLRIT
FT                   SLLGGTRIDWLLHEIYSQGVIISGTSAGAAAITDTMIMEGIDESAPAKNSVALAHGLGF
FT                   LKGAVVDQHFAERGRIGRLLSAVAQNPVVTGMGIDENTAIVVDKDDQIEILGTGTVTII
FT                   DGKEIEETNISQEDDNSPLALTNVTVDILSPGSRFDLKKRNLSLQGG"
FT   gene            68430..71114
FT                   /locus_tag="Nther_0055"
FT   CDS_pept        68430..71114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0055"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp; protein
FT                   of unknown function DUF201; cytoplasmic peptidoglycan
FT                   synthetase domain protein; Mur ligase middle domain
FT                   protein; RimK domain protein ATP-grasp; KEGG: tte:TTE2785
FT                   UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83654"
FT                   /db_xref="GOA:B2A3M8"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M8"
FT                   /protein_id="ACB83654.1"
FT                   /translation="MEIINIKTISGKNIYSHEPVLEAELDLGDFAGVFSNNVSCFNSRL
FT                   HQILPSLQEHVCSRGYPGGFLERLEEGTLFGHIIEHVTLELMNLAGIGTNYGTTKATQE
FT                   DGIYQVIVEQINEEGAKYALEQSVELVKNVINDNPVQVEEIVSEIQEIVNETKIGPSTE
FT                   AILSAAEEQEIPYLKLDEASMYQLGTGKYQKRIQATVTDETSVIGVDIACDKTKTNNSL
FT                   HELGLPVPYGKIASTEEEAVAIVQEIGYPIVIKPRDGNQGKGVTLNINSEQETRSAFKV
FT                   AMSYGDEAIVEQHIEGKHYRLVVVGDQLVAGAERIPAHVVGDGQHTIRELVDIENQNPL
FT                   RGFGHEKPLSKIQLDPVVNMVLARKNMTMNYIPQQDELVYLRESANLSTGGISLDVTDE
FT                   ISDKTIRIAIRVAKIVGLDIAGVDLVAKDIGKPVDEDDNGAIIEVNAAPGIRMHEHPVK
FT                   GHPRRVGKSIVDHLFNKRNDTLQARAPVISVTGTNGKTTTVRAIDHILRSNGKDVGMTS
FT                   SDGTFIKGELIDSGDNTGPNSAKALLKDPTIDSFVFETARGGLVKNGLGYSNAKVAVVT
FT                   NIANDHLGQDGIESIDDLIFVKSLVVEAVEKQGVVVLNASDHYVSDFIRKAKGRIIFYA
FT                   MESDNHYVKSHLAAGGSALYLDQDNIVYATGKFHRKLGEITQLPLTMAGMARHNIENCM
FT                   AGIAAAIGFGIAPSKAFEVLKQFAPSYQDTPGRCNLFRCQGKTVLLDYGHNPEGMNRVL
FT                   AMVEKMPVEKVISVIGVPGDRNDKLIKETGKVVGKYHELIEKVLVKEDSDLRGRKSGET
FT                   ANLLQTTMTEFSEELAVEQNLQEIEAIKTALSEAGENDLVLIFYEQKDSFFNASEELGL
FT                   SPEPLDFNKLASQSNNPVSQKLN"
FT   gene            71216..72142
FT                   /locus_tag="Nther_0056"
FT   CDS_pept        71216..72142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0056"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; KEGG: bce:BC0050
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83655"
FT                   /db_xref="GOA:B2A3M9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3M9"
FT                   /protein_id="ACB83655.1"
FT                   /translation="MSPDILRVESPAKINLYLDILGKRQDGFHEVEMVMQSISLCDRLT
FT                   FIRQSQGNNNNIELLMKSSDCIDQLPVRGDNLIIKAARLLMNDFRLPPIKVILEKNIPT
FT                   EAGLAGGSSNAAATLWAINHMFQLGLTEQELSDIGARLGSDIPFCLFGGTKLAKGRGEI
FT                   LHPLPSLPNCYFVLVKPNFGVSTGKVYQELGFKTDTEYGENHQTKSRVNGIISGLEKGT
FT                   LTGIVENMYNKMEEIVFKWHRDMQIISQQIEQLGALKVLMSGSGSTIFGVFDNYDTAKY
FT                   AKKQLEREFKYVFLSIPRDMGVGKENN"
FT   gene            72142..72927
FT                   /locus_tag="Nther_0057"
FT   CDS_pept        72142..72927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pth:PTH_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83656"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N0"
FT                   /protein_id="ACB83656.1"
FT                   /translation="MVQCVVLAGNSETDRKVADLTSQNINNKALVPINGQPMIQYIISA
FT                   LKKSDLVDDMVIVGPKQELTGRLKGESQNFEIIEKHESGKVLDNLLKGIDFLKPQNNIL
FT                   VVTSDIPLLTPEAIDNFINQCDDKLDLLYPVIPKEANQKEFPQVERTYVNLSNGSFTGG
FT                   NVFYINPAKVRPCYERVDRVIRNRKNPLLMATNFGISFLAQFLMGKLSLKQAEAKISQI
FT                   LQIQAKVIVSHYPELGIDIDKSSDMKLAEKIIDREKVYV"
FT   gene            72951..73793
FT                   /locus_tag="Nther_0058"
FT   CDS_pept        72951..73793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0058"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM:
FT                   phosphoribosyltransferase; KEGG: bsu:BSU00470 purine operon
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83657"
FT                   /db_xref="GOA:B2A3N1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N1"
FT                   /protein_id="ACB83657.1"
FT                   /translation="MKVTRASKISRIFFMTQKLLSNPGKIISLKYFVDNLGAAKSTISE
FT                   DLTEIKQNLHESGEGTLQTVSGKNGGIKFIPLQSQETIQANLDQLEAKLKEAHRILPGG
FT                   YLYMGDIISNPALIKNAAKMFAGYFSPKGPDVVLTVETKGILLAGYTADYLGVPLAIAR
FT                   RNSRVTEGSVLTINYISGSTNMIQTMSLSTRAIEKNSKVLIIDDFMKRGGTLKGLKNLT
FT                   YEFESNVVGLGVLLEQGTQKEKLVSEHLSLGILENINEEQGQVNLTMRRGDFLKNNFY"
FT   gene            73850..74140
FT                   /locus_tag="Nther_0059"
FT   CDS_pept        73850..74140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0059"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: ssp:SSP2258
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83658"
FT                   /db_xref="GOA:B2A3N2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N2"
FT                   /protein_id="ACB83658.1"
FT                   /translation="MLAANKETLEISNIKINLIKDNSKVKALVSLVIEDSLALHGIKVV
FT                   EGNSGLFVAMPSRKTKDNEYKDIVHPITPEFRKNMQETILEVYHEMSAEPV"
FT   gene            74232..75638
FT                   /locus_tag="Nther_0060"
FT   CDS_pept        74232..75638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0060"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase,
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: tte:TTE2572
FT                   N-acetylglucosamine-1-phosphate uridyltransferase (contains
FT                   nucleotidyltransferase and I-patch acetyltransferase
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83659"
FT                   /db_xref="GOA:B2A3N3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N3"
FT                   /protein_id="ACB83659.1"
FT                   /translation="MISLNDANTTAVILAAGKGTRMKSKIPKVLHEVCNKPLLWHILTA
FT                   AQSVTDKQTVVTGYGREKVENFLKEKFDDKNLTTTIQERQMGTGHAVVCAKNQLNSPHT
FT                   MVLLGDTPLITDQELSGLKKYHVDNASAATILTITENDPHGYGRIIRDKDGFVKKIVEE
FT                   ADATPQEKDINEINTGLMIFETEKLLFALDKLDSENNQGEYYLTDVINILYQTGECVLG
FT                   YQIEKTYRALGVNDRAELARAEKIKRQEINNEFMYCGVTIKDPESTYIDPEISIGYDTV
FT                   IYPNTYLTGDTRIGTNCEIGPEVQISDSFIGDGCKVKKSQITDSILEDEVSIGPYAQIR
FT                   PGTTIGSKAKIGNFVEVKNSSIGENTKANHLAYIGDADIGSNVNMGAGSVIVNYDGQIK
FT                   HRTVIEDGAFVGCNSNLVAPVTIKTNAFVAAGSTVTENIPEDSLGIARCRQTNKEDWVT
FT                   KKMGRGYSDG"
FT   gene            75631..76599
FT                   /locus_tag="Nther_0061"
FT   CDS_pept        75631..76599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0061"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: chy:CHY_0193 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83660"
FT                   /db_xref="GOA:B2A3N4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N4"
FT                   /protein_id="ACB83660.1"
FT                   /translation="MANDEKRLNTKNLKIFSGNANLNLSQEITEYLGVDMGKGKATRFS
FT                   DGEIDVVIEESIRGSDVFVVQPICSPANENIMELLIMLDAFKRASAQEINVVIPYYGYA
FT                   RKDRKARARDPITAKLMADLLETAGANRVITMDLHAQQIQGFFNIPLDHLQAGPILADY
FT                   FQEKGLDEPVIVSPDMGGVPRARAMAENLNCPIAIIDKRRPDANVAEIMNVVGDVEGKT
FT                   AIMIDDLIDTAGTMSLAAEALLKHGAKDVYACCTHPVLSGPAVDRLSKSPIKEIVVTNT
FT                   IPLPKEKELDKIKVLSVAPLIGEAILRVHNRMSVSTLFEDD"
FT   gene            76689..77336
FT                   /locus_tag="Nther_0062"
FT   CDS_pept        76689..77336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0062"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   bld:BLi00065 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83661"
FT                   /db_xref="GOA:B2A3N5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A3N5"
FT                   /protein_id="ACB83661.1"
FT                   /translation="MDRKELQVKERTVTRKSEVKKLRTNNEIPAVLYGKNIESKKLSIE
FT                   KRELLDALSTAAGDNVLLDLKLDNGESYPAIFKEIQKDPIKGFFIHIDFHTIDLKETLQ
FT                   VSVPLNIEGEPVGVENGGIPQYQLREIEIECLPTQIPDHIEVDVSNIDLNESINVGDLP
FT                   LPEGSELVTEPEETVMSVVAPETEEEPDTEEDEEGEEDVEEESEEEEEESEE"
FT   gene            77360..77983
FT                   /locus_tag="Nther_0063"
FT   CDS_pept        77360..77983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0063"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: bcl:ABC0081
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83662"
FT                   /db_xref="GOA:B2A3N6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N6"
FT                   /protein_id="ACB83662.1"
FT                   /translation="MRPFKLVLNELGNYGRYYMKLIAGLGNPGKKYQYNKHNIGFMVID
FT                   YFAKQHGLSVTKLKHQSMWDELRLEGEKIVLIKPLTYMNRSGHAIKLWKDYFKIENQDL
FT                   LIIYDDLDLELGDLRMRPKGGTGGHNGLKSIVSTLGGKEFPRIRFGIGRPASQESTSSY
FT                   VLKDFTKKEFETINNKFPDLSKGIELFCKEGINEAMNFVNSLQN"
FT   gene            78114..79670
FT                   /locus_tag="Nther_0064"
FT   CDS_pept        78114..79670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0064"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; AbgT
FT                   putative transporter; short chain fatty acid transporter;
FT                   KEGG: amt:Amet_0146 AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83663"
FT                   /db_xref="GOA:B2A3N7"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N7"
FT                   /protein_id="ACB83663.1"
FT                   /translation="MAGQSETPTPQTPQTPEGSGLFERILNFIERVGNKLPHPIILFFI
FT                   LAGLTIVASWLVSAAGVTVEHPGTGETVEAVNLISRYGFERIVTEAVDNFVGFAPLGVV
FT                   LVAMLGVGVAEKSGLINSVLKSLILGAPMKLLTVAVVLVGILSSVATDAGYVVVVPLGA
FT                   IIFAAKGRHPMVGLAAAFAGVSGGFSANLIITSLDPLLTELTRDAAETWVDSYPMAPSV
FT                   NLWFMMASTIIISAVGAIVTEKIVAPRFGEYTGDYKPELEPLNNQEKSGIKAAVITLII
FT                   LLALLLVMAVPADGLLRDDEGSLTSMQAPLMGGMVPIIMVLFLLPGIAYGYAAKTVKNS
FT                   TDVAKYMSEAMSDMGGYVALAFAAGQFVKYFEWSQIGTILAVAGADFLQAIEFTGIPLL
FT                   IAFVIVAGFINLFVGSASAKWAIMAPVFVPMFMELGYAPELTQMAYRVGDSVTNIITPL
FT                   MPYFAVIIAFAKRFDEKVGIGTLISTMLPYSIVFLITWTIMLILWYALNLPIGPGGQMF
FT                   V"
FT   gene            complement(79807..80352)
FT                   /locus_tag="Nther_0065"
FT   CDS_pept        complement(79807..80352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0065"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   bca:BCE_5451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83664"
FT                   /db_xref="GOA:B2A3N8"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N8"
FT                   /protein_id="ACB83664.1"
FT                   /translation="MIDLWVTTLIALAVASDAFSVSLGIGTKSMTLSRVGKISLLVGFF
FT                   HVAMPLLGLYLGDLLAGYLEELGEILGGGLLIFIGYRMISQYLAEEENEETIDFTKGTG
FT                   LLIFSVSVSIDALTAGFTLGLAGAASLLTALIFGVVALVMTGFGLFLGQQLQSILRGKG
FT                   ELIGGILIIGIGLYFIVF"
FT   sig_peptide     complement(80290..80352)
FT                   /locus_tag="Nther_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.522 at
FT                   residue 21"
FT   gene            80546..80953
FT                   /locus_tag="Nther_0066"
FT   CDS_pept        80546..80953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83665"
FT                   /db_xref="GOA:B2A3N9"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3N9"
FT                   /protein_id="ACB83665.1"
FT                   /translation="MDLLFTIIIALIIIYLYNWGIFLINYRTYNIKALINYLSPIVEEF
FT                   IKTILGFVIANTIIGVHVGIGIAEGLKDLYVDRSWGACMASIIGHSFFGSVTLGIYRLT
FT                   GYLILGIILGAVVHIGWNSLILSINQEKTLK"
FT   gene            81091..84681
FT                   /locus_tag="Nther_0067"
FT   CDS_pept        81091..84681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0067"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bha:BH0069 transcription-repair coupling
FT                   factor (TrcF); TIGRFAM: transcription-repair coupling
FT                   factor; PFAM: helicase domain protein; transcription factor
FT                   CarD; TRCF domain protein; type III restriction protein res
FT                   subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83666"
FT                   /db_xref="GOA:B2A3P0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P0"
FT                   /protein_id="ACB83666.1"
FT                   /translation="MSYLVDIIPYENSLQNIIEDFSPRRKRSTKQMVSGISGSEFPLIL
FT                   AGLFRAYGRPITLITYDNYRAESLYSDLVTLLDKEQVYIYPEHQVYPFELAWQSRDVNN
FT                   ERAQVLQAMLSKKSAVYIFSLKSAKEKLSPAQVVKQTFLNLEVGNEKLSPTMIAEKLTG
FT                   LGYENTSMVEQKGQFSHRGGIIDVFPVASELPVRIEFFDDEIESIRAFDLATQRSLKEY
FT                   NSLVVGPGSQLVIGDNTNLSQALNQLTREFELQKGKLMKDGITDRSEELEERINRDLSS
FT                   LENGISLPHFHRYLSYFYPKNYGTIIDFLPTNSLFWVDEPNRIKESDEFYNNEITELAE
FT                   SLIEEGKILPGESNLFYSIEDVLSGNPFDTIYSANFLRQNPFENVSQATNMSVKSMNQF
FT                   YGQWDFFLKEMKQWMNNNYRIILFSPTPESARTLYENLKKEEIGATIVEKGNTKTENQV
FT                   VIAVGDLKSGFILQESKLAVITYGDLWGHQKKKIRSRKRDKSEDKAVKVSDYRELQVED
FT                   YVVHEKHGIGKYMGIKTLEVGGLYKDYLHIKYAGNDSLYVPTEQIDEIQKYVGKEGKPP
FT                   KLYSLGSSEWQKVKQRVKSSVKELAEDLLKLYAERSSRKGYAFSQDTPWQKEFEDYFPY
FT                   ELTPDQKKAISEIKEDLESEQPMDRLLCGDVGYGKTEVAMRAAFKAVMEGKQVCVLVPT
FT                   TILAQQHFQTFKERFAPYPVDIRVISRFSSQKDEKLVKEEMKEGNAEIIIGTHKLLNKS
FT                   VKFRDLGLLIIDEEQRFGVQHKEKIKMLKKNLDVLTMTATPIPRTLHMSLVGVRDLSVI
FT                   ETPPEGRFPVQTYVMEHSPQLIREAVNREISREGQVYVVHNRVKGINKVAKEVADWVPD
FT                   AKVGVAHGQMPEKQLERVMLDFYEGKYDVLVSTSIVEAGLDIQNVNTIIIYNADRMGLS
FT                   QPYQLRGRVGRSNRMAYAYLTYQKDKVLTQEAEKRLKAIKEFTELGSGFKLALRDLEIR
FT                   GAGNILGPEQHGHIMAVGFDMYTKMLKDAIKEISQESQTQEETTKIQDDKTEVEKPEEV
FT                   KVELNINAYLPTTYISDHEQKITIYKKARSINSYSEANDLETELKDRFGSLPQEVKNLL
FT                   DITRLKVLARETGIISITRQGYWVHLDLDPRQKISGENLIKLTTKFPGKITVSSQTDGL
FT                   TLKVNVKNLKDSGLMDMINKVAESLLELVA"
FT   gene            84784..85338
FT                   /locus_tag="Nther_0068"
FT   CDS_pept        84784..85338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0068"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   stage V sporulation protein T; PFAM: GAF domain protein;
FT                   SpoVT/AbrB domain protein; KEGG: pth:PTH_0119 regulators of
FT                   stationary/sporulation gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83667"
FT                   /db_xref="GOA:B2A3P1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P1"
FT                   /protein_id="ACB83667.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEVI
FT                   LKKYSPIGELGEFAEEYVESIHETTGHIACISDRDMIISVAGTAKKEFLNRPLSPAVDR
FT                   AMEERQSVKIEDSADHPYYQEAEDEQRSRFKSEVIAPIIAQGDAIGAVIIGTKEKDYTM
FT                   TDQELKIAETAAGFLAKQMEQ"
FT   gene            85404..86558
FT                   /locus_tag="Nther_0069"
FT   CDS_pept        85404..86558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0069"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: bcy:Bcer98_0051 MazG family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83668"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P2"
FT                   /protein_id="ACB83668.1"
FT                   /translation="MISQNRICFDILIVTQPVTKHISLEYYRKLMNSNCNILVSNSKSK
FT                   IIEFLQSEQIHYQIIEQDSIDTWGTNGIFYITDNRKDNNISQILSLAKERGVDIDINFL
FT                   GPQEELSLLPLKMVMEKLRGPGGCEFDKKQTHQTLKPYLIEEAYEVIEAIHEQNPDSVC
FT                   EELGDLLLQVIFHAQVAEEQGEFQLDEVLTKLKDKLITRHPHVFGGKYAQTGTDPLSWE
FT                   EIKLEEQQNNRKSPNQNEIDDREGNKHPRESKSVLDKVPQAAPALVKAEKIQKIGKKMG
FT                   FDWENSSGAYEKVNEEFTELQDAYQQENWEKLEEEIGDIIFSLVNLARFFNISTEVSLE
FT                   RTNEKFRRRFRYIEDKVRKQNEKFSNYSLEELDNYWDEAKKRGI"
FT   gene            86675..86953
FT                   /locus_tag="Nther_0070"
FT   CDS_pept        86675..86953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0070"
FT                   /product="nucleoid protein Hbs"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bha:BH3356 non-specific DNA-binding protein II (HB)
FT                   (HU)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83669"
FT                   /db_xref="GOA:B2A3P3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P3"
FT                   /protein_id="ACB83669.1"
FT                   /translation="MNKTELISKVAERSEMTKKDTEKVVNEVFDVISDQLAKEDKVQLI
FT                   GFGTFEVRERAAREGRNPSTGEVIQIEATKVPAFKAGKALKEKVKNG"
FT   gene            87070..88080
FT                   /locus_tag="Nther_0071"
FT   CDS_pept        87070..88080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0071"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: amt:Amet_0168
FT                   SpoIID/LytB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83670"
FT                   /db_xref="GOA:B2A3P4"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P4"
FT                   /protein_id="ACB83670.1"
FT                   /translation="MNISIKALFGMLLLTTALILGGCGPGEEEGPEGAPNGEVEDDEAV
FT                   PDIPEEIRETEGEEPTLQVFLHEEEQVEEMEFEEYLKGVVAGEMEPDWPKDALAAQAIL
FT                   ARTFTLHKISEDGGVPDRDAHASTDIEEFQAYSEEDITEEVEQAVEDTRGEVAVYEDNF
FT                   IRSWFHAFAGPKTATAEEGLGYDEEDPPYIQVVDSPGMDIVPEEEKNWEESFSHDEISS
FT                   AVEAVTGESPESIEQVEIVEEGPSGRAMELDIGGVQVPAPELRLELGSEVMRSTFYDED
FT                   DIEEGEDEVTFSGVGFGHGVGMCQWGAKALVEENNSPEEVVTYFYENVSIVDLWE"
FT   sig_peptide     87070..87138
FT                   /locus_tag="Nther_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.472 at
FT                   residue 23"
FT   gene            88273..88557
FT                   /locus_tag="Nther_0072"
FT   CDS_pept        88273..88557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0072"
FT                   /product="sporulation protein YabP"
FT                   /note="TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein; KEGG: oih:OB0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83671"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P5"
FT                   /protein_id="ACB83671.1"
FT                   /translation="MEERLEETSHKLIITDREYTEITGVLHVDSFDEEEIVLETELGLL
FT                   ALRGEKLDIKELNLDDKLLTVEGVILEAAYSDEASPQDRGKGIFSRIFR"
FT   gene            88571..89077
FT                   /locus_tag="Nther_0073"
FT   CDS_pept        88571..89077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83672"
FT                   /db_xref="GOA:B2A3P6"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P6"
FT                   /protein_id="ACB83672.1"
FT                   /translation="MTDIRGQFVLFLIFVVTGMIMGIVFDFFRVFRSRKKFPKILKHFT
FT                   DLIYWVFVFLLLATVLLVSNWGEVRAYVFVFTGVGIIAYYIWISKSIIEGYVVFFYVSE
FT                   QVIDKFFSALQKTIIIISIPVQFILRACCMILNIIKRAVILITSKIIGLVKVILSRLNI
FT                   FNKKE"
FT   gene            89194..89574
FT                   /locus_tag="Nther_0074"
FT   CDS_pept        89194..89574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0074"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: Septum
FT                   formation initiator; KEGG: gur:Gura_2306 septum formation
FT                   initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83673"
FT                   /db_xref="GOA:B2A3P7"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P7"
FT                   /protein_id="ACB83673.1"
FT                   /translation="MNKITEFPRKSGRQAKKQVNTIKHGAPKRDNNSKSGFKDKMISIL
FT                   LIVAVVYFAFLIIDQGIKYYQLVQQREDLKTEIEQAEQEKKELEEEVEQLRDPQYIEIL
FT                   ARRKFGLIRESDILLEIPLEEE"
FT   gene            89660..90022
FT                   /locus_tag="Nther_0075"
FT   CDS_pept        89660..90022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0075"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   pth:PTH_0189 predicted RNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83674"
FT                   /db_xref="GOA:B2A3P8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P8"
FT                   /protein_id="ACB83674.1"
FT                   /translation="MSLKVGKTVEGVVKGITNFGAFVELPGGETGLVHISEVADTYVKD
FT                   IRKFISEEEHVKVKVLSIDGDKIGLSLKRVRENKEKHVSFEDKMAKFLRESDERQRDLR
FT                   KNTEGKRGSRDTKAFN"
FT   gene            90085..91368
FT                   /locus_tag="Nther_0076"
FT   CDS_pept        90085..91368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0076"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; KEGG: drm:Dred_1139 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83675"
FT                   /db_xref="GOA:B2A3P9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3P9"
FT                   /protein_id="ACB83675.1"
FT                   /translation="MRSVFLRINSLFGGPSLKSQRPYFQKGKYINQIDTNRILDSLFDA
FT                   VLVINHSGVITYINKVVEQVLKIEGETLVGYDYRELLKYSYTYEFENFSIFETALSERK
FT                   AVHDKELHLIDSENNEVIIKGNTYPIYEGENFLGVIGVFRDITREKEYQEQTKRWEEKF
FT                   TQAEKLAIVGEMAAGTAHEIKNPLATIKGFLQLLESNELPESKRKEYLATITDEVNRME
FT                   QLVKEFLHLSKPSNQEEHETNETVSLCKVFQKTLIFFSPQFKNKKVMLNIKCPGHPIYL
FT                   RGKSDKLQQVFINLIKNSLEAMEKIPQDCRKLTIKVDIYKSNNKDDKNEKVILEFIDTG
FT                   PGIPKNIMNKLFSPFATTKVRGTGLGLPVSIQIIQNLGGYLVAENSPLRGACFRIELPL
FT                   YDVDGVNSICRNVYIPYCERVADYDKPD"
FT   gene            91352..92251
FT                   /locus_tag="Nther_0077"
FT   CDS_pept        91352..92251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0077"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: tte:TTE2442
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83676"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q0"
FT                   /protein_id="ACB83676.1"
FT                   /translation="MTNQIKAAIDIGSNSIRLLIARVNKNGLEELYRDVQTTRLGEGIQ
FT                   HYEKLTQRSINDSVHVLKEYYQIIHQYQVNETKIVATSAIREASNNQEFFNEVNRAIAQ
FT                   PINIEVVDGIREAALNYKGATMELTEDAFVFDLGGGSLEIIPQDPNSMASFPIGAVKAT
FT                   ESYCDEEGRIRNHEDLRKAVQKIITTEILSAYQENIQVVGVGGTATYLAKAYKKLPVYK
FT                   KEDIHGTYLSRTDLNNLLKGMEKYDLEQRVDEFFLTPNRADIIIAGGYIINYLLQEIGA
FT                   KGYWASDNDMLMGLILEI"
FT   gene            92326..92402
FT                   /locus_tag="Nther_R0013"
FT                   /note="tRNA-Met1"
FT   tRNA            92326..92402
FT                   /locus_tag="Nther_R0013"
FT                   /product="tRNA-Met"
FT   gene            92567..95068
FT                   /locus_tag="Nther_0078"
FT   CDS_pept        92567..95068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0078"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: amt:Amet_0173 sporulation stage II, protein E;
FT                   TIGRFAM: stage II sporulation protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83677"
FT                   /db_xref="GOA:B2A3Q1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q1"
FT                   /protein_id="ACB83677.1"
FT                   /translation="MAYETEYIKTYERTYKQAYQPLDTSKSATPRTKLLVTFWEKFREL
FT                   FIKLFNGVTSLSTLYLLTGFLLGRAEVRGGLIPLVLAYLLALRLEKASYFSAAFIGSLI
FT                   GIQLTHGIEGTVTVIIPAMIYLLWERRSLGNKPKIGTVIFVASFMVTSWFYGGLPGSFP
FT                   FNLLPLAIEGGLLVIFAVLLMPGLQFIESKRKTDNIEKEEIVSIILLASMAFMGLQGIM
FT                   IGPYSIPRLVSLLAVLIVGYRYGGGQGAAAGAILGTITSFYSLSQISIGALTLSGLLAG
FT                   IFKDFGKLSSTFAFIFSSGLVVFYLGEPFVMLHFLQEILIISVIFLVIPERFFYKITPS
FT                   PISHGSKMVSDRKMDQIINHKFYEFASLFSDMAKVFEPNSNEQDYHDSSEIEDFVQTVV
FT                   NQVCGGCSKVSYCWEKNFFVTYKNFLNVISKVDSGKKLHRDELPEYLQESCIRPSLLLE
FT                   NAGSVFDDYQLEHNKAKSSAAENKKLLSEQMFALSELFNKMAKFKVVDSSNNRELEQEI
FT                   RSAIENKNFVCEEICVTGKVQEDLTIELIINCSGTKQEDIKEISTLVSEVVGEKLSPVT
FT                   WDLYREDSKINNHYFIRLRAEQQLQVITGCIQINKEGEPLSGDTYMSRELSTGEHLLLL
FT                   SDGMGSGSKANEESEATVNLITKLLNYGYDKQMVIRSVNSLLATINRVDSFATVDMALI
FT                   DLYTGIGEFCKAGAVSSFISTAEGVEKVEASSLPAGIIESVEPKKMTYSLKPGDYLYMV
FT                   SDGVFDMGDGEKWFEKAISNLKSKDPQEMAEELLEKVKRRYSYGDFPDDVTILIAKITS
FT                   NSKESELDSQTMGLDIWEKIN"
FT   gene            95138..96667
FT                   /locus_tag="Nther_0079"
FT   CDS_pept        95138..96667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0079"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: aoe:Clos_0431
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83678"
FT                   /db_xref="GOA:B2A3Q2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q2"
FT                   /protein_id="ACB83678.1"
FT                   /translation="MKEKVYQNIFEKGLIKSGDKVLVGVSGGPDSVALLHVLYELRQEL
FT                   QFKLVVSHLNHGFRDKSAEEDADFVKKLAEDLELPIIYDKWQVKDYINYYKLSPQQGAR
FT                   IQRYKFFEQAAKDFGATKLALGHHIDDQVETFFLRLIRGAGTQGLSGMQFIRKLNNDLL
FT                   LIRPLLEVSKSEIKEYLQTNKLKYKIDPTNQETNYLRNKVRHEILPVFQDINPNINERL
FT                   LETMELLKEENDYLNKAANELYQKSQVDTGRSQNNTKPLAYQGQERELLFCLKTLQKSP
FT                   KVLLRRILLTAVYSFISKTDQEDRHLNSENVSKKHIDAVAKMIELGLTGKEITLPGKIY
FT                   TFIDTRMISGQSKQVMVISDQNLTSSYAIQGTKQAELEVPGWTYWPLSNMWLYSYIKDH
FT                   KSEQSSHYHKTINRNSFEATLDYDKIDLPVIIRNRKVGDRFVPLGMNSPKKLKDFFIDE
FT                   KVPRNYRDKIPLLVSGRGEILWVIGYRINEQYKVTKDTRRYFCIEAQLSEY"
FT   gene            96706..97251
FT                   /locus_tag="Nther_0080"
FT   CDS_pept        96706..97251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0080"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: drm:Dred_2376 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83679"
FT                   /db_xref="GOA:B2A3Q3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q3"
FT                   /protein_id="ACB83679.1"
FT                   /translation="MERAYDKDAFKQLISEEEIKDKVKELGEQISQDYQGQEVIAVGVL
FT                   KGSFVFAADLLRQLSIPNEIDFLAVSSYGASTKSSGIIRILKDLDTSIENKHVLIVEDI
FT                   VDTGLTLNYLLETLSTRKPASLKICTLLDKPDRREVDLTPDYIGFQIPDLFVVGYGLDY
FT                   AEYYRDWPAIYVLPEEDE"
FT   gene            97364..99445
FT                   /locus_tag="Nther_0081"
FT   CDS_pept        97364..99445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0081"
FT                   /product="FtsH-2 peptidase. Metallo peptidase. MEROPS
FT                   family M41, membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: drm:Dred_0126 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83680"
FT                   /db_xref="GOA:B2A3Q4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A3Q4"
FT                   /protein_id="ACB83680.1"
FT                   /translation="MNRFTRQAVLYLLILMIVVGIFQQLNQEPEAEEDLFYNEFLNKVE
FT                   AGEVDRVDITERDIEGELTDGTSFVTRDPGDPELIETLKEYEVNIKDHEVPGPPWWASL
FT                   FTYIIPFVLLIAIFFFFMQQSQGGGGRMMNFGKSKAKLHEGDQKSNVKFHDVAGADEEK
FT                   EELVEVVNFLKEPQKFIDLGARIPKGVLLVGPPGTGKTLLGRAVAGEAGVPFFSISGSD
FT                   FVEMFVGVGASRVRDLFENAKKNSPCIVFIDEIDAVGRQRGAGLGGGHDEREQTLNQLL
FT                   VEMDGFDVNEGIIVMAATNRSDILDPALQRPGRFDRQITVNAPDLKGREEILKVHARDK
FT                   PLEDNVDLKVVARRTPGFTGADLENLVNEAAIYAARRNKNRIGMKELEGAIDRVIAGTE
FT                   KKSRVISEFEKKIVAYHEAGHAIVGYLLPHTDPVHKVSIIPRGAAGGFTLMLPEEDRQF
FT                   MTKTELLERVSTLLGGRVAEELKLKEISTGAQNDLERATTIVRQMIMEYGMSENLGPIT
FT                   LGQKQGQVFLGRDIARDKDYSENIAYAIDKEIRNMVDSSYQEARETLEENIDKLEKIAQ
FT                   ALMERETLVAKEIKMLMEGKDLPPIEESEDTETLDFLVDEQQDTKSESDNEQQSQENQA
FT                   DNNQNDSTTEFDDEQQTNDDNRPEDDEDNEEDKNKGNNDFNLKIDYNKEDKDNKDKDK"
FT   sig_peptide     97364..97444
FT                   /locus_tag="Nther_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.620 at
FT                   residue 27"
FT   gene            99610..100155
FT                   /locus_tag="Nther_0082"
FT   CDS_pept        99610..100155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0082"
FT                   /product="membrane protein"
FT                   /note="KEGG: aoe:Clos_0445 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83681"
FT                   /db_xref="GOA:B2A3Q5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q5"
FT                   /protein_id="ACB83681.1"
FT                   /translation="MHSRAIINSSTRKLAVGGLLSAISIVMSFTPLGYVPVPTPAGSVT
FT                   TMHVPVIIAALLEGPYIGTMVGSIFGLTSFIRGANFFVDPVVAIIPRLFIGMGSYFAMR
FT                   LTARLLSDKTKRDFLPYAAGAFTGTVINTAGVLSLATLRGYLPGYAAAGVAVSHGIPEI
FT                   IVAIILTILICRTVRKLY"
FT   sig_peptide     99610..99711
FT                   /locus_tag="Nther_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.647 at
FT                   residue 34"
FT   gene            100248..101918
FT                   /locus_tag="Nther_0083"
FT   CDS_pept        100248..101918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0083"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   aoe:Clos_2127 formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83682"
FT                   /db_xref="GOA:B2A3Q6"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A3Q6"
FT                   /protein_id="ACB83682.1"
FT                   /translation="MKSDIEIARGAPMRPIKDIASEVGIKDEELELYGDYKAKITFDAW
FT                   KRLKDKPDGNLILVTAITPTPAGEGKSTTTVGLGQALKRLGKNTMVALREPSLGPSFGV
FT                   KGGAAGGGYSQVVPMEDINLHFTGDIHAITTAHNLLSAAIDNHIHQGNNLDIDARRINW
FT                   RRVVDLNDRALRNTVVALGGRGNGFPREDGFDITVASEIMAILCLATDIKDLKERLSKI
FT                   IIGYTRDRQPVTVADLKMQGSMAVLLKDAIKPNLVQTYENVPAFVHGGPFANIAHGCNS
FT                   AMATQMGVKMSDYLVTEAGFGADLGAEKFFNIKCRFAGLNPDAAVVVATARALKMHGGV
FT                   EKDNLKEENLEALEKGFENLEKHMENINKFGVPAVVAVNRFPTDTEKELELLINKCQEK
FT                   GYRVALSEVFAKGGEGGEEVAKEVLDIIDSKESNFKYLYDVDKSMEEKIETIAKEIYGA
FT                   SDVEFTPTARRNIKQLAQKGLDQVPVCMAKTQFSFSDDPKLLGRPKDFSITVKRVRISA
FT                   GAGFAVAMTGDIMTMPGLPKQPAAEEIDIDDDGQITGLF"
FT   gene            complement(102079..103482)
FT                   /locus_tag="Nther_0084"
FT   CDS_pept        complement(102079..103482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_2009 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83683"
FT                   /db_xref="GOA:B2A3Q7"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q7"
FT                   /protein_id="ACB83683.1"
FT                   /translation="MIKQLKKLNPLVKILIAMLLLIAIGVLTATIIINSPFYLERPWEP
FT                   LEKGGIYSFQDWEIELDFLDMHFNNGVVVLGYQHDELTGMVIKGDGDYQVNVPSYRIKE
FT                   NNSYHQSGSLEAVYLPITEDTLDKLKGNVIFSPISDHQIDLDYSSYFEAEQKLLAKIET
FT                   FNISRTIHPGETQNMSYLFTEDYDAKYYESKTINLSSCDGKTTQLVADSDRKPYPPENF
FT                   QLFTISYLLISLLLLALLVYIFSVDIDEFYYKHSASQSLTTIFTIIFSGATFFFWRWID
FT                   LEVTLSDFESGLFYLIASAILLMLHLRQGSKLIELGLTTHNLIRSIVISFSFSLLIMGL
FT                   STLMLPSGLSFPDDFELFNMLLIIFFVILFKELVLRSFLLGSLEKILGANLGLFIHILG
FT                   ISVINLILIFITDTHLSFGTQFSTFLDILILPLFTTAFLGYLYQRVRNIFCPVLIQVFV
FT                   ILLSNIIYF"
FT   sig_peptide     complement(103396..103482)
FT                   /locus_tag="Nther_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.501 at
FT                   residue 29"
FT   gene            103637..104608
FT                   /locus_tag="Nther_0085"
FT   CDS_pept        103637..104608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0085"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; Helix-turn-helix type 11 domain
FT                   protein; KEGG: cth:Cthe_2585 biotin--acetyl-CoA-carboxylase
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83684"
FT                   /db_xref="GOA:B2A3Q8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q8"
FT                   /protein_id="ACB83684.1"
FT                   /translation="MSIIKLSETDLSPVKSKILNNLKKQPYVSGEFLSSQLNVSRTAIW
FT                   KNIQGLANLGYQIDPIKGKGYRLVVIPDNLYPWELDFSLKKDYQITYFDNIDSTNNYAR
FT                   SLQPPQVVIAEQQTKGRGRMGRAWFSAPGGIYFSLVITPRCSVDEIPTIPLLISTAITK
FT                   VLKRELGIQAEIKWPNDILVQGQKVTGILVELAGETDAPQKAVIGVGINANQNTNLFPE
FT                   ELKKSVTSLRELNCSPVNRKLMLNSILEEITQLFFELPNCIPKVLNTWKEYSCTLGKKI
FT                   TVKQVSKTITGIAKDIDRSGALIVETPQGEQRILTGDLSINI"
FT   gene            104620..105390
FT                   /locus_tag="Nther_0086"
FT   CDS_pept        104620..105390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0086"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: pth:PTH_0258 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83685"
FT                   /db_xref="GOA:B2A3Q9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3Q9"
FT                   /protein_id="ACB83685.1"
FT                   /translation="MMLLAIDVGNTNIVLGLYKNDELVVHWRINSDREQTEDQYGVLIK
FT                   NLFYHSNLDPGMIDDIMISSVVPPITQTLTRMSKKFMNMEPIIVGPGIKTGMHVKYDNP
FT                   KEVGADRIVNAVAGYTLYGGPLIIVDFGTATTFCAISEKGDYLGGAISPGISISTNALF
FT                   ERAAKLPRVELTKPANLIGKNTVSSMQSGIFYGFIGQVDGIIKKMRQEFNQAPTVVATG
FT                   GMAHLVYPESETINILNSYLTLEGLKIIYERNKN"
FT   gene            105565..105801
FT                   /locus_tag="Nther_0087"
FT   CDS_pept        105565..105801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83686"
FT                   /db_xref="GOA:B2A3R0"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R0"
FT                   /protein_id="ACB83686.1"
FT                   /translation="MSLIGLSLFAATCIGMLTYSLAFTESLISAIFLLLAVIGFYYSIR
FT                   EHAEELMGENTETTQGRGQQMERPNLTEREGAK"
FT   sig_peptide     105565..105633
FT                   /locus_tag="Nther_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.863 at
FT                   residue 23"
FT   gene            105798..106160
FT                   /locus_tag="Nther_0088"
FT   CDS_pept        105798..106160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83687"
FT                   /db_xref="GOA:B2A3R1"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R1"
FT                   /protein_id="ACB83687.1"
FT                   /translation="MKYKDSILTITMAFIAVLITYYINHGLGLGPFIANGTVGIVAALT
FT                   LPKGLAAAAYTASFVGMSADFILPTFSTALISGIIAGIVILATKPIFAGWGGKGGTTAA
FT                   LAVLLTLIVVNYLPIM"
FT   gene            106186..106602
FT                   /locus_tag="Nther_0089"
FT   CDS_pept        106186..106602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83688"
FT                   /db_xref="GOA:B2A3R2"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R2"
FT                   /protein_id="ACB83688.1"
FT                   /translation="MMGLDELSLIILATLGIIVTYYISVHLGKGNVLGSAVVVFMAGLL
FT                   ETVFPGLITTEHAGVLAAASYAGMVSGDKIGSMRQVTALGIICGMMFIATAPAYVGFGG
FT                   RLGTLAALSCGTFFGYRTILERTVWPKFGIRRST"
FT   gene            106768..108393
FT                   /locus_tag="Nther_0090"
FT   CDS_pept        106768..108393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0090"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: drm:Dred_0663 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83689"
FT                   /db_xref="GOA:B2A3R3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R3"
FT                   /protein_id="ACB83689.1"
FT                   /translation="MSFFRYQVQTVDRVGMVLDVLRVVYLKNINITAMEVAPQLIYLKL
FT                   DFAPAMKGALESAVKEIPGVRGIDEISLLPQEEKEQKLRGILDTIGEGIIALDKSGIIT
FT                   MINPSAEKILNLSENIEGRDIRDILSAELPILKTLSAGEDYDNKEIFVTLPGGKSHYLT
FT                   SGRPIKNDDGNTVGAVAAIKDINEVRKLVHRITHPTMLSFDDIIAESSIMNETISFAKK
FT                   IAHGDSTVLLTGESGTGKELFARAIHMESPRKDCPFVPLNCAAIPETLMESELFGYEEG
FT                   AFTGAKKGGKHGLFELANKGTVFLDEIGNLNPQLQVKLLRVLQEREVRRIGGKEEISVD
FT                   IRVITATNHNLEKLVNEGYFREDLYYRLNVIPIKLPPLRNRKEDIIPLANHILGQMRTN
FT                   HGGQYQLSPKSRELLKTYSWPGNVRELENIIERAVNLANDNIIEGEHLFFGQEDGFSNY
FT                   EGEMENWEQNQQYQNGQSEAEISVNYKDKDFSQILQSVEKQILQKVLSEHASARKAAKQ
FT                   LGVSHTTILNKIKKYGLQINQESN"
FT   gene            108439..108831
FT                   /locus_tag="Nther_0091"
FT   CDS_pept        108439..108831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0091"
FT                   /product="DRTGG domain protein"
FT                   /note="PFAM: DRTGG domain protein; KEGG: tte:TTE0885
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83690"
FT                   /db_xref="GOA:B2A3R4"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R4"
FT                   /protein_id="ACB83690.1"
FT                   /translation="MKISQIKKILQADILTGKEENSVEVAFGTDLMSDVLAFFGESDNT
FT                   LLLTGLTNLQVIRTAELLDINAIIFVRGKEPKDELIKEAEECGITLLSTDYTLYEASGL
FT                   LFTHGLRGINTDDNLPESPERGLDHG"
FT   gene            108824..109258
FT                   /locus_tag="Nther_0092"
FT   CDS_pept        108824..109258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0092"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tte:TTE0886 anti-sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83691"
FT                   /db_xref="GOA:B2A3R5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R5"
FT                   /protein_id="ACB83691.1"
FT                   /translation="MDEEQEKFIKSYKLEGQDFQSGGEASAQIKQILKSLGVPSKIIRK
FT                   ATVISYEAEMNVIIHSYSGEIILDVDQYRVVIRTEDTGPGIQDIDKAMEEGYTTVSTEI
FT                   LEMGFGAGMGLPNIKKFSDNLKINSQVGEGTVLEATVYIN"
FT   gene            109303..110685
FT                   /locus_tag="Nther_0093"
FT   CDS_pept        109303..110685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0093"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Fe-S cluster domain protein; KEGG: tte:TTE0887
FT                   ferredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83692"
FT                   /db_xref="GOA:B2A3R6"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R6"
FT                   /protein_id="ACB83692.1"
FT                   /translation="MKPYYHSVRLKEESCIGCVHCLKFCPTQAIRIKGGRAEILKERCI
FT                   DCGGCIQICPNNAKIAESDNISQIDNFQHKVAVVPPSVLVQFPKDVLPKEVFRAFLDLG
FT                   FDKVFSISLGGEWYSYEVNKILNSNFSKKPLISTHCPAIVRLIQVKFPELVGNLVPVDT
FT                   PLDITGDIAREYLKNQLNLDDEDIGIFLISMCSARVTAVKSPEGRPFSSLNGVLSLIDI
FT                   YSQLLKSVKATNSEEEQISNNRKNLDGAIYPPELGIGVGHDVTGCDQTGIESNDCLSIS
FT                   GINNVMDVLEEIELGKISELDYIELHSCYGGCVGGVLNVENPFVSKVRMNKIINEMEKD
FT                   SSYLDGVTQSLPKSFNIRKINIQPRPLEGLSNSISQSVKKLSEIEKLLNCLPQLDCGAC
FT                   GSPSCRSLAEDVVLQRADMKDCVFYLLDNVASLTQEAYTMAKGIPHVLKMRHKGLYNFR
FT                   KD"
FT   gene            110750..111097
FT                   /locus_tag="Nther_0094"
FT   CDS_pept        110750..111097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0094"
FT                   /product="HPr kinase"
FT                   /note="KEGG: amt:Amet_2277 HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83693"
FT                   /db_xref="GOA:B2A3R7"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R7"
FT                   /protein_id="ACB83693.1"
FT                   /translation="MMTLRDLIAELDLEVIVGEDELDKPIEGGYCSDLLSFVMSRSAKN
FT                   YVWITLQSHPNIVAVASLVDLAAVIVTEGVQIEQETLDKAKREKAVILRSQDTSYEIAG
FT                   QLYQLGVKSHV"
FT   gene            111090..111845
FT                   /locus_tag="Nther_0095"
FT   CDS_pept        111090..111845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0095"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: cth:Cthe_0337 PHP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83694"
FT                   /db_xref="GOA:B2A3R8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R8"
FT                   /protein_id="ACB83694.1"
FT                   /translation="MSKGKWFKADLHIHSVLSPCADLDMGPNNIIDICKRENIEIIAIT
FT                   DHNTGRNVPAFQKKAAREGITVIPGMELQTREEVHCLCYFPSYSNLARFESMIAQTFPQ
FT                   IPNKEDIFGTQLVINDREEILAHEERMLLSSSSLGISELMEKVKQYSGLVIPAHVDKPS
FT                   YSLLTNLGPPIGNEGFKALEFFSYSNYIKFTNQFSNLKDYPIIMSSDAHDLQDFQKPEY
FT                   KTYFLLEEPVLSGIQKALESQGFREVILN"
FT   gene            111915..112403
FT                   /locus_tag="Nther_0096"
FT   CDS_pept        111915..112403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0096"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit; KEGG:
FT                   chy:CHY_0731 Fe-hydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83695"
FT                   /db_xref="GOA:B2A3R9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3R9"
FT                   /protein_id="ACB83695.1"
FT                   /translation="MAECKCGSAAKKKEEQQLEEILAQYKNEKGALITALQKVQEFYGY
FT                   LPEEGMQKVAEAFDMPESKVFGVATFYAQFHLQPRGEWVIRVCTGTACHVRGAEKIMNK
FT                   LIEELNIEPGETTEDLKFTLEPVACIGCCGLAPVIMVNDNTHGRLVPDQIPEILDKYK"
FT   gene            112406..112957
FT                   /locus_tag="Nther_0097"
FT   CDS_pept        112406..112957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0097"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: amt:Amet_2279 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83696"
FT                   /db_xref="GOA:B2A3S0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S0"
FT                   /protein_id="ACB83696.1"
FT                   /translation="MKELSLHLLDLIQNAIEASATKIQVDFYLSYQDDVMTLKVIDNGR
FT                   GMDDKFKQQATDPFKTSRKTRKVGLGLSLLQMKAEQCDGDINISSSPWGQGTQVNARFK
FT                   YSHWDRPPLGKLSNTFISILQGNPDLKLYFSYQVENKLFKFSTEEIKEIVHQNAFRDLE
FT                   VLMWVKQYLEENITSLNGGD"
FT   gene            112959..113333
FT                   /locus_tag="Nther_0098"
FT   CDS_pept        112959..113333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0098"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: fno:Fnod_0994 ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83697"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S1"
FT                   /protein_id="ACB83697.1"
FT                   /translation="MSKLKSLEDLKKYREQAKNSTEVRKTNENMVIVGMGTCGIAAGAR
FT                   EVMNALLEELNKRSLKEITVTQTGCIGMCENEVLVDVKKQGEERITYGNVTPEDIPRIV
FT                   NDHLINGKLVQDLVIGKPNQ"
FT   gene            113355..115148
FT                   /locus_tag="Nther_0099"
FT   CDS_pept        113355..115148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0099"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Respiratory-chain NADH dehydrogenase domain 51 kDa
FT                   subunit; KEGG: chy:CHY_0732 Fe-hydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83698"
FT                   /db_xref="GOA:B2A3S2"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S2"
FT                   /protein_id="ACB83698.1"
FT                   /translation="MEVYRSHVLICGGTGCSSSGCQQVQDKFNEELDKHNLSNEVKLII
FT                   TGCHGLCELGPIVIVYPEGTSYFTVSAEDVSEIVEEHLLKGRKVERLMYQDEESAEKIP
FT                   YYNEIGFYKQQERIVLSNCGYINPESIDEYIARGGYQGLARAVTEFDPQGVTEEVINAN
FT                   LRGRGGAGFPAGKKWKFASQEPEPTKYMVCNADEGDPGAFMDRSILEGDPHSVIEGMAI
FT                   ASYAIGAEVGYVYIRAEYPLAVRRLKEAIQQAEELGLLGENILGSGFNFKLKVKEGAGA
FT                   FVCGESTALTRSIEGRRGMPRPTPPRSTEKGLWGKPTVLNNVETLACVSFILSKGAEEF
FT                   TKFGTEQSPGTKVFALTGKVNNTGLVEVPMGISIRDIVFDIGGGIQHGNKIKAVQIGGP
FT                   SGGCLPEDKLDLSVDFDTLDDAGAMMGSGGLVVMDEETCVVDVSKFFLKFTQAESCGKC
FT                   TPCREGTKRMLEILERITKGQGEPKDIDLLKELGEMIINTSLCGLGKSAPNPVLSTLRY
FT                   FEDEYREHIEKGRCPAGICADLVKYKIIADNCIGCTACVKVCPVDAISGEKKQAHEIDP
FT                   DKCIGCGECYEKCKFEAITLG"
FT   gene            115206..117887
FT                   /locus_tag="Nther_0100"
FT   CDS_pept        115206..117887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:116262..116264,aa:Sec)
FT                   /locus_tag="Nther_0100"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: chy:CHY_0733 NAD-dependent formate
FT                   dehydrogenase, alpha subunit, selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83699"
FT                   /db_xref="GOA:B2A3S3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S3"
FT                   /protein_id="ACB83699.1"
FT                   /translation="MSLVTVTIDGQSIQVPKTSTVLDACEKLGKEIPTLCHQKDLTTVG
FT                   ACRLCVVEVEGAGNFPTACTLPVKDGMVINTNTDEVRHARKMVLELLWANHPNDCLTCE
FT                   SNGNCKFQDYCYEYGVTESRFRGEVIEHEIDETSRFVERDLDKCILCGKCIRVCHEIQG
FT                   SEAIDFMDRGFETKVATFYDKGLSDSPCVDCGNCINVCPVGALIPKPLKGKGRDYDFEK
FT                   VKTTCPYCGVGCTFNLNVKDGEVVGVSPDEEAEVNDGYLCVKGRFGTGFIHNDDRLTQP
FT                   LVRKNGELVETDWEEALNTVAENFKKLKEKHGGDAFGFLASAKCTNEDNYLFQKFARAV
FT                   VGTNNIDHCARLUHAPTVAGLATQFGSGAMTNSIGEIEDTSTIFAIGTNTTEAHPIIAQ
FT                   KVFKAQNKGAKLIVADPRKIEIAEKADIWLRPLPGTNVALLNGIMKVILEKDLVDKEFI
FT                   RNNTEGFEEVKKQLEQVSLDEIEQITQVPKDKIEQAAIMYGESDKASTLYTMGITQHTT
FT                   GTDAVSSIANLALMTGNVGRESTGVNPLRGQNNVQGACDLGGLPNVLTGYQKVADPETV
FT                   SKFSQEWGQELNDQPGMAVTEMLKATGEDLKAMYIMGENPMVTDANLGHVEEALDSLDF
FT                   LVVQDIFLTETAEKADVVLPASSFAEKDGTFTNTERRVQRVRKAIESVGDSKPDWQIIA
FT                   DLSQQMGYEMNYSNPQEIMDEIRKLTPSYSGISYDRIEDQGIQWPCPSEDHPGTKYLHK
FT                   EGNFAIGKGQFKAVDYREPAETADDEYPFVLTTGRMLYHYHATMTRKVRELNEEVPEGD
FT                   IEINTQDAEKLGIENGDQVKVSSRRGEVVTVAEVTDRVAPGVVYMDFHYKEAAANRLTN
FT                   DALDPAAKTPELKVSAVKVEKS"
FT   gene            118006..118164
FT                   /locus_tag="Nther_0101"
FT   CDS_pept        118006..118164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0101"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   bvu:BVU_1429 putative rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83700"
FT                   /db_xref="GOA:B2A3S4"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S4"
FT                   /protein_id="ACB83700.1"
FT                   /translation="MKKYVCTVCGWVYDPEQGDPDNGVKPGTAFEDIPEDWVCPECGVD
FT                   KSMFEEQ"
FT   gene            118252..119451
FT                   /locus_tag="Nther_0102"
FT   CDS_pept        118252..119451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0102"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bha:BH0613 assimilatory nitrite
FT                   reductase (subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83701"
FT                   /db_xref="GOA:B2A3S5"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S5"
FT                   /protein_id="ACB83701.1"
FT                   /translation="MHYVIVGSGVSGITAAKNLRNLKPEAKITILGDEPHYCYNRPRLI
FT                   ELLGKEVDIENIFFYPPDWYCQQGIDIYLNVTVKEIHSKKQLVITDCGQEISYDKLLLA
FT                   NGSTPNLPPVPGAENRGVFTIRTIDEVRQIQRRALTSSQSIVIGGGLLGLETAFSLTKL
FT                   KQEVTVIDRNSWLLKRQIDQKGSELLQEILKSYGISVVLEGNTESIEPPKNSVGDSKDL
FT                   NVNLKDGRKIPGQIVIFSAGVRPNISLAEKAGISVNKGIVVDEHLKTSDPNIYASGDVA
FT                   EFQDKSYGIIPAALEQGKLAAVNMASEEGQNYEGTIPSTSLKIAGIDLISLGEIYPQED
FT                   DQVVTKIDSSNKIFKKAIFRENCLKGAILLGDKTELPLIHKNLRAQQPFRDPELIFENY
FT                   "
FT   gene            119649..120980
FT                   /locus_tag="Nther_0103"
FT   CDS_pept        119649..120980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0103"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: chy:CHY_1575 potassium uptake protein KtrB;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83702"
FT                   /db_xref="GOA:B2A3S6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S6"
FT                   /protein_id="ACB83702.1"
FT                   /translation="MVRATRFNPARTLVLGFLSLIIIGAVLLSLPIATIEAGRLPLLDA
FT                   LFTATSAVCVTGLVVVDTGTTFTVFGQTVIMLLIQAGGLGFMTSATLIFLALGRKITLR
FT                   ERIVIQESLNQFDLQGVVRLVRSILILAFSIQGIATMILGIRFSQELGWAKGFFFGLFH
FT                   SISAFCNAGFDLIGDFRSLMPYVNDPLISLLLPLLFIIGGLGFTVLVDLYFTRYITRLG
FT                   FHTKVALIITGSFLLIGFLTVTLLEWNNPKTLGSVTGGAKIWSAFFTAATPRTAGFNVL
FT                   PTDELNQATTLFIMVLMFIGASPASTGGGIKTTTFGTLLLAVISVVKGKNQVSFLRKRI
FT                   PYNLISKALAIIFISLGIVVLVAMVLLVTEDANFEEALFEAISAFGTVGLSKGITPDLS
FT                   AVGRIVVIVTMFVGRVGPLTLAFALAKESDDTGIKYPEERLLIG"
FT   sig_peptide     119649..119735
FT                   /locus_tag="Nther_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.269 at
FT                   residue 29"
FT   gene            120998..121660
FT                   /locus_tag="Nther_0104"
FT   CDS_pept        120998..121660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0104"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: amt:Amet_1637 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83703"
FT                   /db_xref="GOA:B2A3S7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S7"
FT                   /protein_id="ACB83703.1"
FT                   /translation="MAKKKQFAILGLGRFGSSVAYTLTNMGYDVLAVDSNEERVEEVSK
FT                   EVTHAVQANVTSEKNLQALGIRNFDVVIVAIGEDIQASIMATILVKDMGVEHVVVKSQD
FT                   KMHGEVLKRIGADRVIFPEWDMGCRVAHNLATTNILDYIELSPEYSLAEVSVPTKMVGK
FT                   TPQELDLRAKYGVTVLAIKRGNDINISPKANAQFHKSDVLIVVGKQGDINRLEELNS"
FT   sig_peptide     120998..121060
FT                   /locus_tag="Nther_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.698 at
FT                   residue 21"
FT   gene            121775..122275
FT                   /locus_tag="Nther_0105"
FT   CDS_pept        121775..122275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0105"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   mta:Moth_2001 protein of unknown function DUF64"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83704"
FT                   /db_xref="GOA:B2A3S8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S8"
FT                   /protein_id="ACB83704.1"
FT                   /translation="MEYNELYQATLAMLKERGVDLDEIAELVLDLQKPYLPKLTLEDAR
FT                   DSVDAVLEKREVQNAILTGIYLDIASEKGDVDEPLQSLLLTDDPLYGVDEILALSIVNI
FT                   YGSIGLTNFGYLDKEKPGVIDKINKEKGGKVNTFLDDLICAIAASSASRIAHRARDGEF
FT                   DRD"
FT   gene            122363..123745
FT                   /locus_tag="Nther_0106"
FT   CDS_pept        122363..123745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0106"
FT                   /product="aminotransferase"
FT                   /note="PFAM: aminotransferase class-III; KEGG: tte:TTE2339
FT                   PLP-dependent aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83705"
FT                   /db_xref="GOA:B2A3S9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3S9"
FT                   /protein_id="ACB83705.1"
FT                   /translation="MELINIDETLEMTRQELRTKHNNYLNPGFMKMLSLLGFDKKFVRA
FT                   EGTKVWDDNGIEYLDFLGGYGSLNLGHNPEEVFNALDKIKGSPNILQAAPGTFNAALAE
FT                   NLAAITPGNLQHSFFCNSGAEAVEGAVKLARRATGKSKVISAKGSFHGKTMGSLSVSGR
FT                   DKFKAGYFPLVPECTQIPYGDDEALREEIDENTAAVILEPVMGEGGVIVPPEGYLSTVS
FT                   EICSQNNIVFILDEIQTGLGRTGKMLACEWEQITPDIICFAKSLGGGVFPIGAFITTPE
FT                   LWNKAYGRMEEALMHTSTFGGNALATGASIATINSILDNNLPERANEHGEYFINSLKQL
FT                   DDKHDMIKEVRGQGLLIGIEFNSPEKSVLNKLSKGMLEKVSQEYTGAFVAEKLQNEYQV
FT                   LTAFTLNNPNVIRLEPPLIVDKEQIDYVVDSLDKLLDHHGDFFKLAFSSGKKAVSSFFK
FT                   RD"
FT   gene            123981..125483
FT                   /locus_tag="Nther_0107"
FT   CDS_pept        123981..125483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0107"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: ctc:CTC01338 sodium/proton antiporter ShaA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83706"
FT                   /db_xref="GOA:B2A3T0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T0"
FT                   /protein_id="ACB83706.1"
FT                   /translation="MSFTDLVYSLPMLIVLFPLIMTGVIFLVEQKSIFGRNLLSVVTSA
FT                   ITFLMVAAMYPVVIKGEVIYYQLANLIPPFGISFMVDTLGFGLSLLASFIWMLVTIYSL
FT                   EYMKKENYTGRYYPALSLTLSGSMGLFLAGDLFTMFIFFEIMSLVSYLLIIHNETKEAL
FT                   RAGYKYLIVTIIGGLFLFFGIIITFELSQTITLSEMGIISTPTSLAFAGFLSFVIGFGM
FT                   KAGMVPLHIWLPEAHPVAPSPASALLSGIMIKTGAYGLIRIMFHVFDYQMILEANWHLI
FT                   LAVVAVITIFLGSAVAITQEDLKRRLAYSSIGQMGYILLGLAILTETAMTGDIFHIFSH
FT                   AFMKSTLFLAAGAMIMKTGKKKIADLKGVGRAMPLTMLSFTIAALAMIGIPPLNGFISK
FT                   WSLSLGALEAGQPYYVVILLISSLMNSVYYLPIINTAYFGKSEETDDDVESKGVISEAP
FT                   MKMVMPVAILGFSCLILSLFPTNIPYELAQLAAKALINGNPF"
FT   gene            125682..126188
FT                   /locus_tag="Nther_0108"
FT   CDS_pept        125682..126188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0108"
FT                   /product="ferripyochelin binding protein (fbp)"
FT                   /note="KEGG: pmo:Pmob_0648 ferripyochelin binding protein
FT                   (fbp)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83707"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T1"
FT                   /protein_id="ACB83707.1"
FT                   /translation="MLHEFKGKYPDISEDVFVADGTQIIGDVTIAEGASVWFNSVIRAD
FT                   LDIVEIGRKTNIQDGSICHVDTNEPLKVGDYVTVGHGAILHGCTIANNTLIGMGATVLN
FT                   GATVGENCIIGAGTLIPEGKEIPPNSLVVGVPGKVVRELSQEEANNLKNHAEEYHKKAM
FT                   KYLEQ"
FT   gene            126358..127341
FT                   /locus_tag="Nther_0109"
FT   CDS_pept        126358..127341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83708"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T2"
FT                   /protein_id="ACB83708.1"
FT                   /translation="MTTKIGIPRALAYFTFFPLWITFFEQLNMDVMVSSESNKQVLDQG
FT                   VKETVNDACIPIKIYHGHVKDLTGKVDYLFVPRLVSLDGEETVCPKFLGLPDMVRYSIE
FT                   GLPPLIDERLDLRKGRFELWKFFYRIGRTFNKGFLEIFKAYQVACREYQKYRNLLTQGF
FT                   TPQNAWEALRGEKNLDSNNNKTQSEDISIALLGYPYTIYDSYISVGLFERLKNMGVNVL
FT                   TKDNVPPQELLKQRKNFSKEMFWYYSNQVARAALYYLDKPRVNGVIHVTAFGCGPDAMV
FT                   DKLVELECKQNGVPFLTLSLDEHTGEAGVGTRVEAFVDMLKRKRGL"
FT   gene            127341..128420
FT                   /locus_tag="Nther_0110"
FT   CDS_pept        127341..128420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83709"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T3"
FT                   /protein_id="ACB83709.1"
FT                   /translation="MRKVTFPRMGTSYIAFKMLVEDLGHEAVTPPPPTKQTLTYGTKYS
FT                   PEFACIPFKVLMGTYIEAIEQGADTIVSSGGVGPCRAGYYGEMHHRILKDAGYDTDMII
FT                   FEPPLKSLGDFLKKVKIIKGKSSWLTLIDAVRRAWHKLIALDDLEIMVSKTRPYEINKG
FT                   DTTRRFQESFEMLNEAWTLKEIKEARQEALNNIKKVETVPRPSNPIKVGMIGEIYVVLE
FT                   PFINADVEKILGELGVEVYRSIYLTNWTRDNTVIDGEKDVKKLARPYLDQLIGGHGQSS
FT                   IGDTIKYAKEGYHGVVHLAPFTCIPEIVAKSILPTVSHDYQIPVITLFLDEQTGKAGIK
FT                   TRLEAFVDLIKKKQLNEVS"
FT   gene            128423..129397
FT                   /locus_tag="Nther_0111"
FT   CDS_pept        128423..129397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0111"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG: tte:TTE1991
FT                   activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class
FT                   ATPase domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83710"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T4"
FT                   /protein_id="ACB83710.1"
FT                   /translation="MKAIYLGVDVGSVSTNFVALDENYQVLASQYLRTKGEPIKAIQTG
FT                   LRNIGEELGNDVEVKGVGSTGSARTLAGVILGADTVKNEITAHAVAASQQVPEVKTVLE
FT                   IGGQDSKIIILREGVVVDFAMNTVCAAGTGSFLDHQSERLGVPIEEFGEKALMSDSPVR
FT                   IAGRCSVFAESDMIHKQQMGHETIDIIRGLSEALVRNYLNNVGKGKEILSPIVFQGGVA
FT                   ANRGIKAAFEQELESEVVVPNFFNVMGAIGAAILAKDASKDKGETSFRGFQASDLRYQA
FT                   SSFECSSCPNMCEIVNIKSEEQLLARWGGRCEKWEVLETNVNT"
FT   gene            129394..130377
FT                   /locus_tag="Nther_0112"
FT   CDS_pept        129394..130377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0112"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: cno:NT01CX_1044 nifR3
FT                   family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83711"
FT                   /db_xref="GOA:B2A3T5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T5"
FT                   /protein_id="ACB83711.1"
FT                   /translation="MNKMKLGKLTLDNCIIVAPMAGVTDYPYRRILAKFSPGLICGEMV
FT                   SAKGMVYGNKKTEEMVIHHNQGVHYSQQIFGSDPKVMADAAVKLENLGVDSIDVNMGCP
FT                   APKIVKNGEGSALLKKPHLAQEIVREIVNSVNLPVTVKIRKGFDRKSSDPLELALRLQE
FT                   VGIKALAVHGRTCEQQYSGKADWEVVAKLKNYLDIPVIGNGDIFSSEDAVSALEMTACD
FT                   GIMLGRGLMGNPWLIEQTKGMLIKDEKIESPEIHEIKNEMKSHFENAIKYYGESKGIAE
FT                   MRKHISWYLKSLPGSTSIKDEVMRLTDVNQIWFSLNEYFQALEKKS"
FT   gene            130548..131075
FT                   /locus_tag="Nther_0113"
FT   CDS_pept        130548..131075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chy:CHY_2368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83712"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T6"
FT                   /protein_id="ACB83712.1"
FT                   /translation="MDIEYIRVGEKLININKIEDKVRKLLNLRAQGYSQKEVSNKLEID
FT                   RTFVSRVESMGEVRKGGGIAVIGFPIKNKDELLKICDNYGVEYCFLMTDQERWTWLKNK
FT                   SGEMLINRIMELVYEVRVYDIVVVLGSNYRINLIKALLNKEVIGLKIGESPIEKDVYVS
FT                   SEKFAKVLDDLV"
FT   gene            131090..131998
FT                   /locus_tag="Nther_0114"
FT   CDS_pept        131090..131998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83713"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T7"
FT                   /protein_id="ACB83713.1"
FT                   /translation="MKRVVSVSLGSSKRNHKVEEEFLGEKVSIERIGTDGDLDKMKQII
FT                   SELDGEVDAFGLGGMDLYLAVGKYRYMLKDAQKVAQCCKNTPIVDGSGLKNSLERNALQ
FT                   QLNEHHNLFNSHDRVLLVSALDRFGMAEKLSQLHSEVIYGDLIFSLGIPISIRSLHNLE
FT                   KIARCALPVVRWLPFKLLYPSGSKKNRTNGSQNKYEKYYDWADIICGDFHYINKYLPDN
FT                   LEEKVIVTNTVTQEDEENLKNCGLKQLITTTPSLKGRSFGTNVMEALLIALKGGKQELK
FT                   PREYETLLEELNFIPSIKDLN"
FT   gene            132033..133127
FT                   /locus_tag="Nther_0115"
FT   CDS_pept        132033..133127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0115"
FT                   /product="Shikimate/quinate 5-dehydrogenase"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   chy:CHY_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83714"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T8"
FT                   /protein_id="ACB83714.1"
FT                   /translation="MDKFAFIIHPIYHSDIIKKFPFLKALPENILEKTFGRLPPFKVSN
FT                   IEGVESPHNQIEGCFVACPLSSNQILNLPQDYVIKKIIKAGKKAEELGAQVVGLGALTS
FT                   VVGDAGVTVAKNLNIPVTTGNSYTVATAIEGVKSACQMMDFDHSEAHVAVLGASGSIGK
FT                   VIAKKFARESRWLTLLGRDKDKLETVSKEIYNESGMAAKVTNQIKKNISEADIVFAVTG
FT                   AADAVISGEELKPGAIVCDVARPRDVSWRVAQSRDDVLVIEGGIVEIPGDVEFNFNFGF
FT                   PPKTAYACMAETMILALEKKYESFSLGRDLSLDKVEQISRLAEKHNFRLAGFRSFEKAV
FT                   SKETVDQIKQNAMRKRIKFSTSKV"
FT   gene            133411..133905
FT                   /locus_tag="Nther_0116"
FT   CDS_pept        133411..133905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0116"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: drm:Dred_0174 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83715"
FT                   /db_xref="GOA:B2A3T9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3T9"
FT                   /protein_id="ACB83715.1"
FT                   /translation="MASREVSNNGKEVVLTRGGYEELEEELEHLKTVRRKEVAERIKTA
FT                   ISFGDISENSEYDDAKNEQAFIEGRIITLEKMLRNAKIVDKDETDNKVVSIGNTVVLKD
FT                   LEYDEEVEYTIVGSAESNPTDQKISNESPVGEAIIGKKVGEVVEVKVPAGVIEYEIVDI
FT                   N"
FT   gene            134047..135516
FT                   /locus_tag="Nther_0117"
FT   CDS_pept        134047..135516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0117"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: drm:Dred_0175 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83716"
FT                   /db_xref="GOA:B2A3U0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U0"
FT                   /protein_id="ACB83716.1"
FT                   /translation="MEKDHELINVRYEKARDMENRNIQPFGDKYSATYYAQEVKDNYEQ
FT                   LLETKEEVSLSGRIMAKRGHGKAGFAHIQDSSGQVQIYTRVDNVGEEDYELYKELDIGD
FT                   IIALKGPVFMTRKGEITVEVKEFHLQSKSLRPLPEKWHGLKDVDLRYRKRYLDLIMNQD
FT                   VKDTFVIRSKIIREMRRYLDDRGFFEMETPTLHTIPGGANARPFKTYHNALEMKLYMRI
FT                   ATELHLKRLIVGGFDKVYELGRIFRNEGISTKHNPEFTSIELYQSNSDYHDMMELTENM
FT                   IYEIANKIFGTPVVEYQGTNIDFTPPWPRKTMIDAVKEATGIDFSELNHEKAREKAEQA
FT                   GIEVEKDATWGEALNEIFEEKVEDSLVQPTFILDYPVEVSPLAKRHEEDSRLTYRFEGF
FT                   LWGSEIANAFTELNDPRDQRERFESQVEKRDAGDEEAHMMDEDFVEALEYGMPPTGGLG
FT                   IGIDRLVMFMTNSTSIRDVILFPTMRPKQDE"
FT   gene            136033..137463
FT                   /locus_tag="Nther_R0014"
FT   rRNA            136033..137463
FT                   /locus_tag="Nther_R0014"
FT                   /product="16S ribosomal RNA"
FT   gene            137695..137772
FT                   /locus_tag="Nther_R0015"
FT                   /note="tRNA-Ile2"
FT   tRNA            137695..137772
FT                   /locus_tag="Nther_R0015"
FT                   /product="tRNA-Ile"
FT   gene            137782..137857
FT                   /locus_tag="Nther_R0016"
FT                   /note="tRNA-Ala2"
FT   tRNA            137782..137857
FT                   /locus_tag="Nther_R0016"
FT                   /product="tRNA-Ala"
FT   gene            137898..141026
FT                   /locus_tag="Nther_R0017"
FT   rRNA            137898..141026
FT                   /locus_tag="Nther_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            141152..141268
FT                   /locus_tag="Nther_R0018"
FT   rRNA            141152..141268
FT                   /locus_tag="Nther_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            141500..142150
FT                   /locus_tag="Nther_0118"
FT   CDS_pept        141500..142150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB1691 choline ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83717"
FT                   /db_xref="GOA:B2A3U1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U1"
FT                   /protein_id="ACB83717.1"
FT                   /translation="MGISTSILEFWQYLVDRQDMFLNLFYEHTRLILITAIISIIIGVI
FT                   LGLVSTYYKSLANIILTVTQILMTIPSLAMIAIIFPLFGIGPTTGIVALVLYSLLPIVR
FT                   NTYTGINELDANVLEAAKGMGMSERKILLKIKIPLALPVIIAGIRTAVVMVVGIGAIAS
FT                   LIGAGGLGDFIFRGISRDFPFMILAGAIGVSILAIALDLLLSWLEQKVIARQS"
FT   gene            142232..143341
FT                   /locus_tag="Nther_0119"
FT   CDS_pept        142232..143341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0119"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: pmo:Pmob_1126 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   CBS domain containing protein; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83718"
FT                   /db_xref="GOA:B2A3U2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U2"
FT                   /protein_id="ACB83718.1"
FT                   /translation="MIKFEDVSKTFPNADNPAVKNLNMEVSEGEITVLVGPSGCGKTTT
FT                   MKMVNRIYEITKGNIYVDNQDIYDLDPIELRLNIGYVIQEIGLFPHMTIADNIATVLYE
FT                   KKWPKEEIDKRVNELMVLMGLDPDIYKQRRPSKLSGGQRQRVGVARAMAANPPIMLMDE
FT                   PFAAVDPITRARLQNEFLELQEKMKKTIIFVTHDINEAIKMGDKIAVMREGQIVQYDSP
FT                   KKILQNPRDEFVEKLVGSNRAVKSLSLVKINDAIINQVVSLEENSDIEEIKQHLDSNIN
FT                   IALLKDYNGHVTGYVTDLDLRGVNSGKIKDFKKPYEQVLNKNDDLSKALSVMLNQSVYH
FT                   VPVMDGQNECLGVITVDDVFKAVSSNDSQ"
FT   gene            143328..144173
FT                   /locus_tag="Nther_0120"
FT   CDS_pept        143328..144173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0120"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_1634
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83719"
FT                   /db_xref="GOA:B2A3U3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U3"
FT                   /protein_id="ACB83719.1"
FT                   /translation="MTVNKNTKSELNHRQVEIQDKGESRTRSRQIKVILTKYSHILIPI
FT                   LYITLGTVYTVINVQNPVDSLAEGWLSYERIGGLLYEHIILVGLATLGAILTSVPLGIL
FT                   ITRPTFRWLTPFVDNPVNVGQTVPSIAILGLAYYFMGTGLLTALFALWLYSLLPILRNT
FT                   SIGIKSVDPEILEAARGMGMTPYRIFIKIEFPLALPVIMAGIRTSVVICTGAATLATFI
FT                   GAGALGEIINAGLSMRRIQLVYQGAVLAALFALLLDNLIGTLERYLTQEAYDEDEVDEN
FT                   "
FT   gene            144228..145169
FT                   /locus_tag="Nther_0121"
FT   CDS_pept        144228..145169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0121"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: pde:Pden_4888
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83720"
FT                   /db_xref="GOA:B2A3U4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U4"
FT                   /protein_id="ACB83720.1"
FT                   /translation="MKMKNLAITLVILSMMLVGVGCGQDGEVQQDGDAVIAVGSKEFTE
FT                   QLILGQLTIQLLEEEGYDVIDNTGLSGTAILRDAFLDGEVDVKWEYTGTALISHLGHDE
FT                   AITDSEECYEAVKEEDLEENGVVWLDYAGLDNTYTLIMREDYAEEAGIQSMSDLAEAVN
FT                   EGETPPTGGEWVLASNEEYATRDDGMEGVEETYGFEFEDVDIMEPGIIYGVVRDGEAPV
FT                   GMGFMTDGRIDGYDLITLEDDKGFHPAYNAAPNVREEVLDEHPELEDILAKLTERLDNE
FT                   TMQQLNAKVDIDGYQPEEAAEEYLVEEGLISE"
FT   sig_peptide     144228..144299
FT                   /locus_tag="Nther_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.688 at
FT                   residue 24"
FT   misc_binding    145343..145467
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 112.05"
FT   gene            145566..146708
FT                   /locus_tag="Nther_0122"
FT   CDS_pept        145566..146708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0122"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="KEGG: amt:Amet_1018 riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83721"
FT                   /db_xref="GOA:B2A3U5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U5"
FT                   /protein_id="ACB83721.1"
FT                   /translation="MDNWIKKDRQYMDRALDLAWKGWGKTNPNPLVGAVLVKNDDIVAQ
FT                   GYHGRLGGPHAEAVALEKAGREASGTTMYVTLEPCCHYGKTPPCTDKIIEAGVKRVVIA
FT                   SLDPHEKMAGKGVKKLRQAGIKVEVGLKKAEAEKQNEIFRKYIVTGLPYMIGKWGMSLD
FT                   GKIATHTGDSRWITSEKARFDTHRLRARVAAIMVGIGTVKADDPLLTCRHPNYPGQHPV
FT                   RIVVDSHLRLSLQSKVLEKISETPTIIATSEEIKHKSKEMEIAKQIENLGGEVLYLPQT
FT                   STGKVDIFELVKLLGQRGLDSVLVEGGETLHGSLIEANYYDKYIVYLGNLVIGGTNSPT
FT                   PVGGKGFQALKDSVMLNNMEYEYFGDSIRIEAYPFLENQR"
FT   gene            146705..147424
FT                   /locus_tag="Nther_0123"
FT   CDS_pept        146705..147424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0123"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: llm:llmg_1531 RibB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83722"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U6"
FT                   /protein_id="ACB83722.1"
FT                   /translation="MKVGGNLFTGIVEEVGKVLSVNQGPNSISLNIQAEKIMDDIKLGD
FT                   SISTNGVCLTVSKVGTNNFVADVMPETLRRSNLRYLTTNSWVNLERALRLSDRLGGHFV
FT                   SGHVDGVAKVISRKHEGNAEIFNFQVVEENERNIQKYLVEKGSIAVDGISLTIVACEGD
FT                   GFSVSIVPHSKENTILETRQVGNYVNIEVDIIGKYVEKLLFQEKQDNGSASTTGTSDKK
FT                   AKIDSKIDINRLRELGY"
FT   gene            147503..148741
FT                   /locus_tag="Nther_0124"
FT   CDS_pept        147503..148741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0124"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase,
FT                   GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="KEGG: chy:CHY_1473 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase/GTP cyclohydrolase II; TIGRFAM:
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase; PFAM:
FT                   34-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83723"
FT                   /db_xref="GOA:B2A3U7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U7"
FT                   /protein_id="ACB83723.1"
FT                   /translation="MTLSTIKEALEDLKNGKMVIVVDDEDRENEGDLVIPAEKATPQAV
FT                   NFMAKYGRGLICMPMKEERLQELDIPLMVNDNTDEMGTAFTVSVDYKDCHTGISAYERA
FT                   MTVTKLIKEDSKPEDFNRPGHIFPLAARQGGVLKRAGHTEAAIDLAYLAGCYPAGVICE
FT                   IMSDDGTMARLPELEQFAREHDLKIISIADLISYRRNSEQLIEAVADINLPTKYGEFQG
FT                   KLYQDTISGEHHLAIIKGEPDKEKEPVLVRVHSECLTGDVLGSMRCDCGDQLASAMQKI
FT                   EEEGVGVVLYMRQEGRGIGLANKLKAYELQDQGKDTVEANELLGFPADLRDYGIGAQIL
FT                   KDLGLTKILLMTNNPKKIIGLKGYGLEVEQRLALEAEVTPHNKCYLQTKQDKLGHILNV
FT                   QQQNDNKEENYYE"
FT   gene            148734..149201
FT                   /locus_tag="Nther_0125"
FT   CDS_pept        148734..149201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0125"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: cbf:CLI_2919 6,7-dimethyl-8-ribityllumazine
FT                   synthase; TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83724"
FT                   /db_xref="GOA:B2A3U8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U8"
FT                   /protein_id="ACB83724.1"
FT                   /translation="MSKIYEGQLKAEGLKIGIVVSRFNELITNKLLGGAMDSIKRHGGD
FT                   EDNVGVIWVPGCFEIPGATKMVVNSGKYDAVISLGAVIRGDTPHFDYVASEVSKGVAKI
FT                   SLDSNVPVIFGVLTTDTVDQAIERAGTKAGNKGYDAACSAIEMANLYKQLY"
FT   gene            149392..149931
FT                   /locus_tag="Nther_0126"
FT   CDS_pept        149392..149931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0126"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: ckl:CKL_3756 NrdG"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83725"
FT                   /db_xref="GOA:B2A3U9"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3U9"
FT                   /protein_id="ACB83725.1"
FT                   /translation="MDENIDQENHNIIKIAGIIPECVVNAPGGISYVIFAQGCAHKCPG
FT                   CHNPETHDFNAGEEWRIDEILTDLKNYPLSGIVTFTGGDPFFQAKSFHKLAVKLKELNY
FT                   TIVAYSGFYFEELKNDMDKKNLLSHVDILIDGPYLEEQKQRDLNFRGSLNQRILDVKNS
FT                   IIENNPVILNKYYEKS"
FT   gene            150060..152270
FT                   /locus_tag="Nther_0127"
FT   CDS_pept        150060..152270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0127"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: pth:PTH_1842 oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: ATP-cone
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83726"
FT                   /db_xref="GOA:B2A3V1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3V1"
FT                   /protein_id="ACB83726.1"
FT                   /translation="MEHKDVALVTEVSKMPTKVVKRDGREQPFDPSKITNAIKKALKAI
FT                   DKEDHSLALSLTYQVINKLTKHGVDKPTVPQIQEMVENSLMDTGHYEVARAYVIYRNDR
FT                   DRIREADTKLMKELLKVLETRDQENANVNGDAPMGKMLKGGSEAMKEVYLNHFAKNEHS
FT                   QAHRNGYIHIHDADFAAIGTTTCLQIPLDRLLAEGFNTGHGWITTPKSIESAASLSCIV
FT                   FQSNQNDQHGGQSFATFDSSLAPYVKITFDKIKNELSQLGISENIDDKAWEQVKKRTYQ
FT                   AMQIFVFNLNTMHSRAGAQVPFTSVNFGLDTSPWGRLISEMLLKVYKKGLGRGETPIFP
FT                   NLIFSLATGVNKEPGDPNYDLRRLAHEVSCERLFPNYSNQDASYNAPFYYREEDPQVVA
FT                   YMGCRTRVISNRRGPEVTEGRGNLSFTSINLPRIALETSCPSDFYQRLEDTIWLVADQL
FT                   YDRFKIQKNKKAKEFPFLMGQGLYMDSEDFESEETLEEALKHGTLSIGFIGLAEALKAM
FT                   IGEHHGESEEAFKKGLQIVEFMDNICKKASEQYNLNFSLLATPAEGLSGRFTELDRETF
FT                   GEIEGVTDKEWYTNSFHIPVEYSISAYEKIRKESAFNKYTPAGHINYVELDAAPKGNID
FT                   AFEQLVNAAMDNDCGYFSVNFPVDQCLNCANNGVIDSETCPVCGSRRIQRVRRVTGYLG
FT                   VLEEIPDEEGEGKTSGFNDGKYHECLNRVSHLQGFQTKDDQN"
FT   gene            complement(152400..152693)
FT                   /locus_tag="Nther_0128"
FT   CDS_pept        complement(152400..152693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0128"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_2475 iron-sulfur cluster-binding
FT                   protein FixX"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83727"
FT                   /db_xref="GOA:B2A3V2"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3V2"
FT                   /protein_id="ACB83727.1"
FT                   /translation="MDSRNLNLRDMVQFVTIVPDSQTHIYLKEPNLCADKCDLKPCTYI
FT                   CPSHVYYFDDDNQQTLIDYKRCIECGACIYACPLENIDWHFPRPGYGIFYKY"
FT   gene            complement(152709..154019)
FT                   /locus_tag="Nther_0129"
FT   CDS_pept        complement(152709..154019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0129"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; HI0933 family
FT                   protein; FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   mta:Moth_0060 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83728"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3V3"
FT                   /protein_id="ACB83728.1"
FT                   /translation="MKEYYDAIVVGAGPGGSSAAYHMAQQGLNVALFEKGNKPGDKNVY
FT                   GGTIYRRSTQEAFPGFWEEAPLERTVITDEVWFLEHDSAVKMGFTGLEFKKPPYNKFTA
FT                   LRSKFDNWLAEQAKDVGAELYTNTLVTDLLYQKGFLASGKRIKGVKLYDGTQIKAGVVI
FT                   LAEGVNAPLAHQAGLRKKLPTNAFTLYTCETLALSPKTIEERFELESGEGATIGFAGFP
FT                   TSGSSGKGGLWTNHDNLSIIVGGRLNEMVSKQLNPHHMLERFKSHPLIKRLLHGADSLE
FT                   YKAYMIPKGGYSLMPKLFSDGVLIVGDAAIMISGRRGTDLAMISGKKAAETVVQAKARE
FT                   DFSKKSLANYSHKLNQQFFMKDIKSKTKEKDYYLKHPDADYLVNSLMNEIAYEFFTEDL
FT                   KEQNEKQKLLFSKVYQKQLPIKSFVDLIQGINHWRFG"
FT   gene            154201..155982
FT                   /locus_tag="Nther_0130"
FT   CDS_pept        154201..155982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0130"
FT                   /product="Oligopeptidase F"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: oih:OB1370 oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83729"
FT                   /db_xref="GOA:B2A3V0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B2A3V0"
FT                   /protein_id="ACB83729.1"
FT                   /translation="MNRLDDHDKLSLTWDLNKIFSGGSDSYQLKEMMSELEQELKDLAN
FT                   KSSELIVDTKSVSNLVQSCQDTRDKLREVGAFIRCLVSQDQTDKEAQRLEAYLGQLEAK
FT                   LEAVMIDLESIVQEFWEEDWQKLINSQEINPIKFFMEELRAKGKNKMAPDKEKLAADLA
FT                   VDGYHGWGQLYHTIIGDIEIQYQDQIISVGQAHNLLSDPNQNVRFEIGQKIEEAFQNKE
FT                   HLIANTLNHLAGYRLNLYKHRHWDDFLYEAMTINRVSQKTIETMWDTISKYKETFTDYY
FT                   ENKKQFLNLEKFGWFDRNAPLSSDDSQIEFGEGAQFIIDQFEKVSQEMADFAEMALINR
FT                   WVEAENRANKRPGGFCATFPMSGESRIFMTYSGTSRNVATLAHELGHAYHQWTLKELPS
FT                   FSAKYPMTLAETASTFAEQVVSDAAIEASQSKEEMITLLDDKISRSCAFFMDLHSRFLF
FT                   ETSFYREREAGPVDVDRLNQLMVEAQRKAYLNSLDHWHPRFWATKLHFYLTKVPFYNFP
FT                   YTFGYLFSMGIYALYKNSPEDFPEIYKKLLKDTGSMTVEELAWKHMGTDLTKPDFWEEA
FT                   VANCIADVDKLNSILKD"
FT   gene            complement(156064..157413)
FT                   /locus_tag="Nther_0131"
FT   CDS_pept        complement(156064..157413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:729395 hypothetical protein LOC729395"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83730"
FT                   /db_xref="GOA:B2A476"
FT                   /db_xref="UniProtKB/TrEMBL:B2A476"
FT                   /protein_id="ACB83730.1"
FT                   /translation="MSTDGKNNNKKQDLNTQNNCDIITNEIKEEIKDLNEQELELVKNL
FT                   SQITPSQSSPDSDFQEQLKQQLLEEHRALNKHRSSTNFFSSILHFHKYKFIGATAAAFL
FT                   AFIIGFGLFAQDNYNDFYFTAQEEEKESMELTKKDDEETEVKEEADDEGKSQLEFDKDD
FT                   EKTDINIARDTKDLPETKKTEQETEQSTVEPKEKDKEKNIAEIEKSEQDEAEQEFHITK
FT                   EGDNKEKEKSEEQETELFTAKTDDQLTQELESILEEMPESFPIYETDKQSIEIKDLKDN
FT                   FSYIVAKEDFPLTRKAVENSVENLVQDYQESDNLQMHVSVEKVDIEKTDDKEKNSLKNE
FT                   SELKIFNLAIEHKTKDNFSIILDRDNYLVVTSDGDITDGYLTQLADLNKVSRESTKELK
FT                   QLKEKITDKGFAVGQIKTGYQLKDGHKLVPILYEEANGRPREDKIIALVP"
FT   gene            complement(157410..157973)
FT                   /locus_tag="Nther_0132"
FT   CDS_pept        complement(157410..157973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0132"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   csc:Csac_0456 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83731"
FT                   /db_xref="GOA:B2A477"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2A477"
FT                   /protein_id="ACB83731.1"
FT                   /translation="MKELSKQQLAELISKASHNEQAFEQLYNYFFPKIYQYIYYRVNNK
FT                   EVTEDLVSDIFLKVLRNLKSLKKPEDFQSWIYSIARNALIDYYRKKGRKKEEASEAISD
FT                   DETVLIDTPEDHVLLEEHSKEIFKLLEILSIEQQEVIQLRFVDELKIKEIAKVLDKSEG
FT                   AIKGLLYRGLNKLSRHLDSKEVQS"
FT   gene            complement(158023..158598)
FT                   /locus_tag="Nther_0133"
FT   CDS_pept        complement(158023..158598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0133"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dps:DP0917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83732"
FT                   /db_xref="GOA:B2A478"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2A478"
FT                   /protein_id="ACB83732.1"
FT                   /translation="MQISIFSGSPRKTGNSSIIASKLEQEFTNLNNKVTCDIIKVSDLN
FT                   IYPCTGCESCSNTSRCVIQDDMLEIYKKVQLSDVIVFVSPIYFGSITGQLKILIDRFQP
FT                   FFAAKYLRKQPIIPSSNNKIASLIAVSGMDKQRFYENAQEIIKVFCINSNIKLGPGLYL
FT                   GGVDYAGEINDKPLLKNKVSELAQLLID"
FT   gene            158784..159407
FT                   /locus_tag="Nther_0134"
FT   CDS_pept        158784..159407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0134"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: tte:TTE1130 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83733"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B2A479"
FT                   /protein_id="ACB83733.1"
FT                   /translation="MVTSYNTVKSNSEVELYIKKSRFISYVAPVDSEEKAQEFVNTIKE
FT                   QHSDATHNVYAYRVGLKSDIKRQSDDGEPSGTAGKPVLDVIENQNLKNLAIVVTRYFGG
FT                   IKLGAGGLVRAYSNSAKEGVEQAGIVTRSLHSELKIEVDYSQLGKIQNEIGERTNWLLR
FT                   NTEFMEKVSLMVAVPENQVQEFTNFVENMTAGQGRIWETKQLYL"
FT   gene            159519..160448
FT                   /locus_tag="Nther_0135"
FT   CDS_pept        159519..160448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0135"
FT                   /product="thioredoxin reductase (NADPH)"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; HI0933 family
FT                   protein; KEGG: mta:Moth_2420 thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83734"
FT                   /db_xref="GOA:B2A480"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2A480"
FT                   /protein_id="ACB83734.1"
FT                   /translation="MTDQFDRENIYDVAIIGSGPGGLTAAIYATRAGLKVLMIERMAPG
FT                   GQLLNTEEVDNFPGFPDGTTGVELAQKLEKQARRFGTELKMGEVIETNLSGSEKMIKTR
FT                   DEVYKAKSVIIATGESPTELSAPGEQNLKGRGVSYCAICDGAFFKNKNVAVVGGGDSAV
FT                   ESALYLSRLASQVTLIHRRDQLRAVEYLKKRAIDCENLEIKYNTVVKEIQGEQKVESLL
FT                   VEDVNTQARETLNCQGIFVYVGAHPNTDFLSNQLDLEDGYLVTSETMETNLKGVFAVGD
FT                   VRKKELRQIVTAVSDGAIAAFHAEKLLS"
FT   gene            160475..160798
FT                   /locus_tag="Nther_0136"
FT   CDS_pept        160475..160798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0136"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mta:Moth_0927 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83735"
FT                   /db_xref="GOA:B2A481"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2A481"
FT                   /protein_id="ACB83735.1"
FT                   /translation="MSKILEVNDTNFKEQVLEADKPVLVEFWAPWCGPCKMVAPVLEEL
FT                   AEEMDGKIKICKVNVDENTDTASDYGVMSIPTMVLIKDGEVQEQVVGYLPREELQNKIE
FT                   ENI"
FT   gene            160902..161681
FT                   /locus_tag="Nther_0137"
FT   CDS_pept        160902..161681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0137"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   drm:Dred_2003 Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83736"
FT                   /db_xref="GOA:B2A482"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B2A482"
FT                   /protein_id="ACB83736.1"
FT                   /translation="MRPLWKGAISFGLVNVPVKMYAATEKKNVKFRYLHRDCNAPVEYK
FT                   RVCSNCKKEVPYEEIVKGYEYEPGKFVVLEDEDFEALPQEEARSINIVEFVNLSEIDPV
FT                   YYDKTYYLTPQETGEKPYQLLKQVLKEKGKVAVCKVVIRSKSNLSCIRIYDEVLTLETM
FT                   YFPDEVRNPKEELEIEEQPEVMSRELEMAGQLVDSLEGEFQPENYQDEYREHLMDLIKA
FT                   KIHDEDVTIPERPKDERVVNLMEALEKSVDLVKEKSG"
FT   gene            complement(161685..162668)
FT                   /locus_tag="Nther_0138"
FT   CDS_pept        complement(161685..162668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0138"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: swo:Swol_1123
FT                   DNA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83737"
FT                   /db_xref="GOA:B2A483"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2A483"
FT                   /protein_id="ACB83737.1"
FT                   /translation="MEFFQIQAMEPIPRQSVPTGDDWFYQIKWDGIRILTFFDGNSIKL
FT                   RTKKGFKRTTEYPELNELTKEFGNTTWLLDGEIIVANQTDKSDHPKFITTNESCEEVGA
FT                   NFFHVLKRDRTKNPTQKLLKTFPVRYKVFDLLMIDNQWLVNEPFIKRRELLNKHFNNNK
FT                   FLQIIRSYSDGLSLFNITSQQNHEGIVAKKSNSIYHPGKKHSEWFKIKHLKYLQAYLGG
FT                   VIVKENQIKSLLLGQKSDLADYKLNYIGRASTGLTQKELNMLKDFAFKNRVSNSPFGNL
FT                   SKVDLELADSKESVVFLSPQLKLQVKYTNWTPGGNLRHPVINGFII"
FT   gene            162817..163737
FT                   /locus_tag="Nther_0139"
FT   CDS_pept        162817..163737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0139"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit; KEGG:
FT                   swo:Swol_1124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83738"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:B2A484"
FT                   /protein_id="ACB83738.1"
FT                   /translation="MRYMVNSQTLDVHGREVVLTNLLKPIWPEKDITKYDLIKYFLDMS
FT                   PYILPHLKNRPLVITRFPEGVHKEGFYQKDIKKAGNSPSWLKTITIPTKNKERERQVID
FT                   YLVVDHPATLVWLGNLAAVELHPWLSSVESLDYPDFGVFDLDPMPQADFYQVKTLAFSI
FT                   KKILNQLEITGYPKLTGSSGLQIFVPFYPKYTYQEIREFIHKVCLQVLDHHADIATIER
FT                   KVNQRPSHKVYLDYLQNAKGKTISAIYGPRANKGAHVSVPVNWEELANIETSRQYDVLS
FT                   VGARMKNTGDVFKTILENKQKLNFC"
FT   gene            complement(163778..163981)
FT                   /locus_tag="Nther_0140"
FT   CDS_pept        complement(163778..163981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83739"
FT                   /db_xref="UniProtKB/TrEMBL:B2A485"
FT                   /protein_id="ACB83739.1"
FT                   /translation="MYKNMLHKHPPFKNMKPPYKHEVDSFFLDRVDEIELAYHPFDLPM
FT                   KGWWSNKWSPEEGSNISQDNSR"
FT   gene            164021..164728
FT                   /locus_tag="Nther_0141"
FT   CDS_pept        164021..164728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0141"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   MgtC/SapB transporter; KEGG: amt:Amet_3081 MgtC/SapB
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83740"
FT                   /db_xref="GOA:B2A486"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B2A486"
FT                   /protein_id="ACB83740.1"
FT                   /translation="MISPFEIVLRLVLGGILGGVVGFEREQHNRPAGFRTHILVCVGAT
FT                   LIMLVSIYTFTGPEGEISRGADTARIAAQVVSGVGFLGAGTILRQGSTIRGLTTAASLW
FT                   VVAGIGLAVGGGFYLGAFTATAVVMVSLYILGNVERFLAQKRRLKELWVRVIDRPGQLA
FT                   KISSLIAERNVNIHKVEMTEPEYMEGYQVKAIDITLLLKVPTRLDDNEFLSAIMEMEGV
FT                   LELSWEGKNVNEG"
FT   gene            165179..166606
FT                   /locus_tag="Nther_0142"
FT   CDS_pept        165179..166606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0142"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: swo:Swol_1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83741"
FT                   /db_xref="GOA:B2A0J9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B2A0J9"
FT                   /protein_id="ACB83741.1"
FT                   /translation="MTVTNKGMKCRQLLTGESCKEGSPQKNSAEHEGYAGVHSSLRITE
FT                   NNISNANLSKGNLLEEILDRDNMNKAFKKIKSNKGSHGIDGMGVDELLQYLKENGDHLR
FT                   QRVLDGKYRPNPVRRVEIPKEDGKKRKLGIPTVVDRVIQQAIAQVLSPIYEEQFSDNSY
FT                   GFRPGRSTHDAIKKSQQNINEGYKYVVDMDLEKYFDTVNQSKLIEVLSKTIKDGRVISL
FT                   INKYLRAGVMIKHTYKDTEVGVPQGGPLSPILSNIMLHELDKELEKRGHEFVRYADDLL
FT                   IFCKSRRSAGRTLKNILPFIENKLFLKVNKDKTVVAYVGKVRFLGFGFYRHKGKARLRV
FT                   HLKSVTKMRTRIKELTSRSYGISNEARAKKLSRYIMGWVNYFKPADMKNLLINTDSWMR
FT                   RRIRMIYWKQWKKVRTKFKMLKFFGANKYKAWEYANTRKGYWRISNSPVLSKSLGNDVI
FT                   KGFGFLFFSEYYRQVKA"
FT   gene            166978..167442
FT                   /locus_tag="Nther_0143"
FT   CDS_pept        166978..167442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0143"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: bha:BH0100 transcriptional
FT                   repressor of class III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83742"
FT                   /db_xref="GOA:B2A488"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B2A488"
FT                   /protein_id="ACB83742.1"
FT                   /translation="MGSLSDNIEKYLKNLIEESPNKAIVVKRCDLAYKFNCVPSQINYV
FT                   LSTRFTEDKGYLVSSRRGGGGYIEIRRLRLAGETPLYKLTDLIGNSISEQEANGLITRL
FT                   ADEGIIKEREEGLLKSCVKRESIPVPLPWRDEIRAALFKNVLLEILKFKE"
FT   gene            167477..168004
FT                   /locus_tag="Nther_0144"
FT   CDS_pept        167477..168004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0144"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: gka:GK0076
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83743"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B2A489"
FT                   /protein_id="ACB83743.1"
FT                   /translation="MMCQNCNKRPATVHWTKIINNKKTEVHLCEKCAKESEQIEFDFEN
FT                   SFPLQNFLSGLMGFDKTAGEGSAQSFHVSADQQGQCETCGLTYQQFGKMGRFGCSNCYE
FT                   KFGERLKPMLKRIHGSTGHHGKVPKRAGGTLRLKKRISELKEELQRSIHREEFERAAEI
FT                   RDEIKKLEKELE"
FT   gene            168016..169086
FT                   /locus_tag="Nther_0145"
FT   CDS_pept        168016..169086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0145"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   bha:BH0102 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83744"
FT                   /db_xref="GOA:B2A490"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:B2A490"
FT                   /protein_id="ACB83744.1"
FT                   /translation="MLDKYIRETGAKWMEGEGPHHNIVLSSRIRLARNFREVPFPSLAG
FT                   DEETEQVINSVQESLKRGESGLGRPKTIKMKDLSSIDKQVMVEKHLISPLLAKEDRNSA
FT                   VILSQDEDISIMLNEEDHIRIQCLFPGLQLEKAFEMADHIDDLIEESVDYAFDEELGFM
FT                   TACPTNVGTGMRASVMLHLPALAITGQINRILSAVGQVGLAVRGLYGEGSEVVGNIFQI
FT                   SNQITLGQSEQDMIENLLGVTKQIVEQEEQARKKLEEDSELKVADKAGRSFGQLSYARI
FT                   VTTKEALDLLSQVRLGVDMGLLKEVDATILDDLMVLIRPANLQKIAGKELESGERDTKR
FT                   AEIIQKRINMNTDKQE"
FT   gene            169117..171561
FT                   /locus_tag="Nther_0146"
FT   CDS_pept        169117..171561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0146"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0103 class III stress
FT                   response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83745"
FT                   /db_xref="GOA:B2A491"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2A491"
FT                   /protein_id="ACB83745.1"
FT                   /translation="MFARFTQRAQKVMALSQDEAKRLNHNYIGTEHLLLGLIREGEGIA
FT                   AQTFKNLGVDLEEVREAVENLVQPGEEQVSGNVGYTPRVKTVIELSMEEARRMGHNYIG
FT                   TEHLLLGLVKEGEGIAAKVLQELGVDLDKAREEVLKIIGGSQQPKGQANFGQAQNPKMA
FT                   NRDKTPTLDNFGRDLTKLAEEGKLDPVIGRKKEIERVIQVLSRRTKNNPCLIGEPGVGK
FT                   TAIAEGLAQKIIEGEVPKILENKRVVTLELSAVVAGTKYRGEFEERLRKLIDELTDSGE
FT                   VIIFIDEIHTMIGAGAAEGAIDASNILKPALAKGELQCIGATTLDEYRKYIEKDSALER
FT                   RFQPVTVDEPSKEATVEILKGLRDRYEAHHRVQITDDAIEASVKMSDRYITDRYLPDKA
FT                   IDLIDEAASNVKLKTNTAPPDMRKLEEDLEEIEKEKEAAVKSQDFEQAAKLRDKEQEIK
FT                   KELEDMEKSWEKKQLSDEAQVTEEDIARIVSDWTGIPVKRLAQEETERLLNMEDALHQR
FT                   VVGQEEAVQSVSNAIRRARSGLKDPKRPIGSFIFLGPTGVGKTELARALADVLFGDEDA
FT                   MIRLDMSEYMEKHTVSRLLGSPPGYVGHEESGQLTEKVRRRPYSVILLDEIEKAHPEVF
FT                   NTLLQVLEDGRLTDAKGRTVDFRNTVIIMTSNVGANLIRNESKVGFKPQTSEDSYKEMK
FT                   DNVMSELKNSFRPEFLNRVDEVIVFHALEKEHLSDIVELMLEELKERMAEFNMNLEFTE
FT                   ESKKHLAEQGYDPTYGARPLRRVIQKQVEDVLSEKMLSGEFAHGETVVIDAEDNELSFK
FT                   KK"
FT   gene            171689..172723
FT                   /locus_tag="Nther_0147"
FT   CDS_pept        171689..172723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0147"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   nucleic acid binding OB-fold tRNA/helicase-type;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   gur:Gura_2929 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83746"
FT                   /db_xref="GOA:B2A492"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2A492"
FT                   /protein_id="ACB83746.1"
FT                   /translation="MKKEQFVKDINVGDKIDAPFVVVEKKMMDFNTQKKTGEKFMLLRL
FT                   RDNTGTIKAVLWERAEQTANYVHEDTIVWVKGKTQEYKGVQIIIDEIEAIAEDIDLTPF
FT                   VPSSSIGSEELKKELRKTIKNINNKYLTELLNTIFEDQKLLSLYLKAPAGKKVHHNYLG
FT                   GLAEHSLEVIKIVSSMYQLYQDRINWDLLVTGSLLHDIGKIYEYDLNSPSFQMTDRGKL
FT                   LGHIALGEELIRSKIDRLSYFPESLAVEIRHMILSHHGEKEWGSPEVPKTFNALCLFYG
FT                   DLISSRLNQVDKLFFEAETGEQEENFNWTNFDPLMGRAFYLPQEETSEQIEGSQLSLDN
FT                   LTES"
FT   gene            complement(172818..173141)
FT                   /locus_tag="Nther_0148"
FT   CDS_pept        complement(172818..173141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0148"
FT                   /product="protein of unknown function DUF964"
FT                   /note="PFAM: protein of unknown function DUF964; KEGG:
FT                   bpu:BPUM_0928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83747"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:B2A493"
FT                   /protein_id="ACB83747.1"
FT                   /translation="MSVEQKAKELAEAIKETEEFETLKSAENKLNLDVTAQELLQKFQD
FT                   KQQNLQQSQQQGQEVSQEEIQTLQSLQQEMQNNETIKTLMDAQQQFDNLLQEVNQTVLT
FT                   SLK"
FT   gene            173364..175622
FT                   /locus_tag="Nther_0149"
FT   CDS_pept        173364..175622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0149"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; KEGG: sfu:Sfum_0259
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83748"
FT                   /db_xref="GOA:B2A494"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:B2A494"
FT                   /protein_id="ACB83748.1"
FT                   /translation="MELTKNAKMVLEKRYLKTNEKGETENPEDMLKRVADNIAQVEKDV
FT                   YQKDKQEVSKVSQNFFDLMDNQYFMPNSPTLMNAGRELQQLAACFVLPIEDSMESIFEA
FT                   IKNAALIHKSGGGTGFSFSNLRPKNDIVLSTGGVASGPVSFMKVFNSATEAVKQGGTRR
FT                   GANMGILRVDHPDIQEFITCKRDSDEINNFNISVGITEEFMEAVKQDGEYSLKNPKNGQ
FT                   AVKTLRAREVFDKIVEMAWGNGEPGIVFIDKMNENNPTPHIGEIESTNPCGEQPLLPFE
FT                   SCNLGSVNLSKMVNNGAVDYQLLKETVHTAVHFLDNVIDANRYPLPEIEKTSKENRKIG
FT                   LGVMGFGDMLFKLRIPYNSQEALDLAEKVMGYIDQESKAKSQELAKERGAFPNFKGSIY
FT                   DQKGEEPIRNATTTTIAPTGTISILCGTSSGIEPLFALAFTRNVLDNDKLVEVNPVFKE
FT                   ATEEAGCYSSELMEKVADKGSIQDIDEIPDSIKKVFVTSHDISPEWHLKMQAAFQKATD
FT                   NAVSKTVNLPNEADLKDVYEIYNLAHELNCKGVTVYRDGSRDTQVLQTSKAKSKQEEQK
FT                   QQKPQKSEPKEGRAGEIVPRKRPDATIGRTERIKTGCGNLYVTINEDEEGLCEVFASMG
FT                   KSGGCAASQSEATARLVSMALRSGLKGESIVKELRGIRCPSPAWNKGGGMVLSCPDAIG
FT                   IVLDRYLIRKEQGEEPVQSNNGIDKLDMLMGACPDCGSPVSHESGCITCYYCGYSKCS"
FT   gene            complement(175696..176457)
FT                   /locus_tag="Nther_0150"
FT   CDS_pept        complement(175696..176457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0150"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gur:Gura_0553 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83749"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2A495"
FT                   /protein_id="ACB83749.1"
FT                   /translation="MKVTFLGTGPSHGVPVIGCSCSVCSSKDSKNTRYRSSVIIKYENN
FT                   HLLIDTPPEFRLQMINNNIHRIDGVLFTHPHADHVHGFDDLRRFNEIQRESIPCFASSE
FT                   TVKNLKNMYSYVFRGGDPYTSSPKVTLHSISSSFELNGLTINPIPIYHGKSLILGYRIG
FT                   RFAYLTDCSQIPPDSYKFLQGLHTLVIGALRYRSHPNHLSVDEAVETVNKINPEVAYFT
FT                   HMTHDLDYYQLNEQLPVNIKPAFDNLTIQVE"
FT   gene            176512..177270
FT                   /locus_tag="Nther_0151"
FT   CDS_pept        176512..177270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0151"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: tte:TTE1740 NAD-dependent protein deacetylase, Sir2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83750"
FT                   /db_xref="GOA:B2A496"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B2A496"
FT                   /protein_id="ACB83750.1"
FT                   /translation="MADNKKFQDLKEKLLSSEEPYVLTGAGISTESGIPDFRGKDGLWT
FT                   KIDPMQYSTREVLMSVPEKFYEYGFERFKQLANKEPNQGHKILADLEKHGVISGIVTQN
FT                   IDGLHQKAGSKQVFEVHGNTRKCYCLGCNQEYPFQELSDQLEKEQKDVPKCKECGGMLR
FT                   PDIILFGDQMPDLFFKVTTVLKQRCDFLLVIGTSLQVYPVAALAELGIPMGIINLEETP
FT                   FDRQAEVVIQGKCGETLSQLWDHMKDELSQ"
FT   gene            complement(177303..177614)
FT                   /locus_tag="Nther_0152"
FT   CDS_pept        complement(177303..177614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0152"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   bce:BC5008 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83751"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B2A497"
FT                   /protein_id="ACB83751.1"
FT                   /translation="MAIVEVSVAPLGTGSPSISPYVADCHQILESQSKVNYKLTPMGTI
FT                   LEGDLNDCLDIVKQMHQVPFDSEAQRVVTNIKIDDRRDKTASMNQKVSSVTSKMSQTE"
FT   gene            177755..178327
FT                   /locus_tag="Nther_0153"
FT   CDS_pept        177755..178327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0153"
FT                   /product="putative rRNA methylase"
FT                   /note="PFAM: putative rRNA methylase; KEGG: cdf:CD2049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83752"
FT                   /db_xref="GOA:B2A498"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2A498"
FT                   /protein_id="ACB83752.1"
FT                   /translation="MQINPFNKPTEIDKQLLDGVISQGDRVVDATCGNGHDTEYLANRV
FT                   GDQGLVYAFDIQKQALETTWKRLQQEGLHERVRLLNKGHEKLIEDVEGPVSCVMFNLGY
FT                   LPGSDKKVVTEPQNTIRAIEGALSLLKAGGLLTIVLYPGHETGMIESQVVQDYLMRLDQ
FT                   TKFHTKKIISLNFKNNPPYLMAVLKNK"
FT   gene            178376..179230
FT                   /locus_tag="Nther_0154"
FT   CDS_pept        178376..179230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0154"
FT                   /product="apurinic endonuclease Apn1"
FT                   /note="KEGG: nph:NP5118A endonuclease IV; TIGRFAM: apurinic
FT                   endonuclease Apn1; PFAM: Xylose isomerase domain protein
FT                   TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83753"
FT                   /db_xref="GOA:B2A499"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A499"
FT                   /protein_id="ACB83753.1"
FT                   /translation="MRLGFHMPLSGGVGKQLNRASELGMECIQIFSGNPTSWKPGKITP
FT                   KSRDLFIKKQEELQIKPLVFHTPYLINLASPKNDIREKSIYLLNAALEKAKAYDAPYVV
FT                   THIGSHVGEGVEKGIDLVSYSLEKIMEDWPEGVELLLENTSGAGSTLGGSLTELKKIID
FT                   KFSGTQVLGCCFDTAHAWGAGYDISNVKEVETTLELVNEQLGLDLIKVCHANDTNVPLG
FT                   STKDRHQHIGEGNITDEGFGALLTHDSFTPKAVIMETPKNGTDCDQINLQRLKKVVGRH
FT                   EEE"
FT   gene            179217..180605
FT                   /locus_tag="Nther_0155"
FT   CDS_pept        179217..180605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0155"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tte:TTE0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83754"
FT                   /db_xref="GOA:B2A4A0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A0"
FT                   /protein_id="ACB83754.1"
FT                   /translation="MKKNDFKMTEQNIYSYMSPDNIKVEVFLSPLLFEYLEESSLKQLL
FT                   DASELPGVIPPVIGMPDIHEGFGLPIGGVLATDGNDGIISAGAVGMDINCGVRLINTDI
FT                   DYGDIKDELPKLLEKITSSVSPGVGGKTKYLKAKSLDIQNVLEQGVPYLIRQGFGNMED
FT                   LDHIEDGGVISEGDSSVLSHEAVKRAKEQLATLGSGNHFIEICLLETDFNQKEANDLGI
FT                   NYGKVCFLIHTGSRGIGHQVCTEYMDRMKKALKKDRQPLPTKGLAYAEIKSPLGREYFS
FT                   AMAAASNFAFANRQLLTTAIEEAIGCKTNLIYDVPHNIAKFETIDNQKLLVHRKGATRA
FT                   FPAGHSALAKKFKNTGQPVIIPGTMGTGSYIMLGTENLRRTFYSVNHGAGRQLSRKQAK
FT                   KSITKKQFKQMMNGIEMSIPGVKNVIDEAPQAYKDVDEVVNTLCDIGLTKKIARLRPIG
FT                   VIKG"
FT   gene            complement(180674..181609)
FT                   /locus_tag="Nther_0156"
FT   CDS_pept        complement(180674..181609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0156"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: bha:BH2643 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83755"
FT                   /db_xref="GOA:B2A4A1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A1"
FT                   /protein_id="ACB83755.1"
FT                   /translation="MKPKFVKNTRGSSQKQFRHLFIPILLVGIILTAGWIYLDIDDIQG
FT                   TNPVAGDNGEKVKDEENKDSEETKDVVSEGDEEEVVNGQKDKEKQETENGKEETDQEDA
FT                   DQSAEIPPSEEWDRDLIVSKLDHFISPIEDAVITYADSHLPGADRAYRNGVHEGIDYFN
FT                   EYVGVPIEIDTPVKSVAEGEVIRADHDFKELEKSYRDELLEETAELGKTPEDTLDKLRG
FT                   KQVWVEHEHNIVVRYAHLNSIEAHIEEGYQIEQGEVLGGVGNTGTGAAAEGRDDGPHLH
FT                   MEIWLGEDQRFLGEEKSIDETREILVEIFE"
FT   gene            181788..181979
FT                   /locus_tag="Nther_0157"
FT   CDS_pept        181788..181979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0157"
FT                   /product="small, acid-soluble spore protein"
FT                   /note="KEGG: tte:TTE2548 small, acid-soluble spore
FT                   proteins, alpha/be"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83756"
FT                   /db_xref="GOA:B2A4A2"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A2"
FT                   /protein_id="ACB83756.1"
FT                   /translation="MARRRNRGVMSEELKYELAKELGVFDTVAREGWGSVPSRDCGNLT
FT                   KLAIEKAEQMMRDQNQGF"
FT   gene            182158..183528
FT                   /locus_tag="Nther_0158"
FT   CDS_pept        182158..183528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0158"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: bcl:ABC0122 DNA repair protein RadA; TIGRFAM:
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83757"
FT                   /db_xref="GOA:B2A4A3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A3"
FT                   /protein_id="ACB83757.1"
FT                   /translation="MKKSTIYYMCLDCGHTELKWLGKCPACSNWNTFQKKYQQPSDNKH
FT                   KSNIGSSESEQSSQVITLSEIDLEKEPRMSTSIDELDRVLGGGIVPGSVVLFGGDPGIG
FT                   KSTLMLQASHNLDTLNFSTLYVSGEESLSQLKLRCERLGLNSESLLFASITDLRELENR
FT                   LNEQKPQILIIDSIQSLYTPEIEAPPGSLSQVKHCAAVLHSVAKENEIACLIVGHVTKA
FT                   GQIAGPKVLEHIVDTVLYFEGDHHQDYRILRSIKNRFGPIEIGVFEMRQTGLQEITNPS
FT                   KLFLRKRPDYTVGSAILPSLEGTRAFLVEIQALVSTSQLGTPRRVVTGIDSNRAALITA
FT                   VLEKKSGLHLVGDDIFINVVGGAKVAEPAADLAVALSLISSFKEQGFPGDLVVMGEIGL
FT                   TGEIRSCNQPEKRLLEAERMGFKKAILPEACRLNHHQGNIEIYPVSYLKDVLEILSG"
FT   gene            183533..184624
FT                   /locus_tag="Nther_0159"
FT   CDS_pept        183533..184624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0159"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: pth:PTH_0286 predicted nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83758"
FT                   /db_xref="GOA:B2A4A4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A4"
FT                   /protein_id="ACB83758.1"
FT                   /translation="MRLTYLSKLHDNKEFLDTLAMLAPGTGLRAGLENVLRAKTGGLIV
FT                   LGDNEEVRELITGGFKIDATFSPSNMYELAKMDGALVLSSDARKIVYANVHLNPDSNIS
FT                   SSETGIRHRTAERVAKQTQKTVVAISQRRNIITIYHNNWKYAMSDIGVILTKANQAVQT
FT                   LDKYRSVLDQDLTNLSALEFEESVTLADVVKVIQRSEMVMRIVKEIEKYITELGTEGRL
FT                   VKMQLDELIVNVEDDSYLLIKDYYNSEGHYSPAEISNKISEIESDELLEPEKILEALGY
FT                   PKKASYLDQKVMSRGFRILNKIPRLPINIVENVVERFGDLRGILNASIEELDDVEGIGE
FT                   IRARVIKDGLRRIREQALIDRYV"
FT   gene            184646..185302
FT                   /locus_tag="Nther_0160"
FT   CDS_pept        184646..185302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0160"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: swo:Swol_1031 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83759"
FT                   /db_xref="GOA:B2A4A5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A5"
FT                   /protein_id="ACB83759.1"
FT                   /translation="MDIKKILPNILTIANLTVGFAAILLISGEYYSTAVSFVIIAMVLD
FT                   GLDGKVARKFQVSGDFGTELDSLCDVVSFGVVPGYFMWANNSETSPLITTLFTITALLF
FT                   LICGAYRLARFNVETTSGEDFTGIPITIAGGILVLGSFYIAPFSAILVIMLAVILSLLM
FT                   ISEVPYPSFKGVTLPNEYWWYLIFLGIIILFILFPLLFLFLLSIYFISGFVKLII"
FT   gene            complement(185468..185866)
FT                   /locus_tag="Nther_0161"
FT   CDS_pept        complement(185468..185866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83760"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A6"
FT                   /protein_id="ACB83760.1"
FT                   /translation="MGTQNNCQDLQKQVSQLLLRHKSILDNITKFQESNARVNRAVIKS
FT                   VTNCGCLQVDADKQVIPESATIEDFHKHLSTHLKGDLCDNCHEVLTNEIGNHLFYMAAL
FT                   ANTLNINLNDVIDNESDKISTLGFFNLT"
FT   gene            complement(186090..186944)
FT                   /locus_tag="Nther_0162"
FT   CDS_pept        complement(186090..186944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0162"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   tte:TTE0646 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83761"
FT                   /db_xref="GOA:B2A4A7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A7"
FT                   /protein_id="ACB83761.1"
FT                   /translation="MNVGIVGGGNGGESLLKLFRDLDDVNIFWVCDINTEAPAIVLAKD
FT                   MGIRTISDFNDYINTDLDVVIDVTGVAKVNEQLKELVPHGVSIMDPSAANLLIYTVEDR
FT                   EQMNENLKAQADQLTDVANTLSSNIQQIKSSMEEITTGAENLANLGQDLSKRAKDAESD
FT                   ANSINEVLEFIQKIANQTRIIGLNAAIEAARVGEKGKGFGVVATEVKKLADDSSNSIQE
FT                   VEETITRVVNHIKEMNSEIQTSSDVAESQAASTQEILASVQEMTEISENLISTAQNLSE
FT                   SNT"
FT   gene            187416..187955
FT                   /locus_tag="Nther_0163"
FT   CDS_pept        187416..187955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83762"
FT                   /db_xref="GOA:B2A4A8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A8"
FT                   /protein_id="ACB83762.1"
FT                   /translation="MFKKKFTTRDLVFMALLIALNVILTRYGSLRINFGGVEAVRIGIG
FT                   ALPVILTGVFFGPIAGGIVGGIGDVVGFMMFPMGAYMPHFTLSAFLTGFIPGLLLYQCE
FT                   KDNLTFPKLILAIGVGQVVTSLLLTPYFQNTLFGIPFAVTIPARLISQAINIPLYSLLI
FT                   KMIALKWNTIFAHNHS"
FT   gene            188118..188603
FT                   /locus_tag="Nther_0164"
FT   CDS_pept        188118..188603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0164"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: drm:Dred_0185
FT                   transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83763"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4A9"
FT                   /protein_id="ACB83763.1"
FT                   /translation="MFKKGDKVVYPMHGAGVIEGVEEREVLGKKHMYYIMKIPVGDMKV
FT                   MIPKERVDAIGLREIVDKNSVKKVLAILKAEETNVNHNWNQRYRANLEKIRSGDIYQVA
FT                   EVIRNLVFLDDEKGLSTGEKKMLENAKQILVSELVLAKDIEEEQAHEIINDTLLTTS"
FT   gene            188768..189868
FT                   /locus_tag="Nther_0165"
FT   CDS_pept        188768..189868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0165"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: tte:TTE2323 ATPase of the PilT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83764"
FT                   /db_xref="GOA:B2A4B0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B0"
FT                   /protein_id="ACB83764.1"
FT                   /translation="MIRRTVRILMTIIGFVAGYQLSYGLTTLDAVSGMDLGESTVLGIT
FT                   LLGGAVLGLIFYFIAPMMMERVIQLTKWIERKMRPIPTRDILLGSFGLLLGLLLGYLIS
FT                   IPIYRIPWVGIYLALAVNLFMGYLGIILTFNRKEELLTLMTFLKSGKNEYFAKEDQKNK
FT                   STIKVLDTSVIIDGRIYDVCKTGFLEGTMMIPEFVLEELRHIADSSDLLKRNRGRRGLD
FT                   ILNKMQKEDSIDVEIYEGDVDESEVDSKLVKLAKVMSGKVITNDYNLNKVSELQGVPVL
FT                   NINELANAVKPVVLPGEEMAVKVIKDGKEAGQGVAYLDDGTMIVVDGGKRHIGEKLEVM
FT                   VTSVLQTAAGRMIFAKPKYQLDKSHA"
FT   gene            189880..190638
FT                   /locus_tag="Nther_0166"
FT   CDS_pept        189880..190638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0166"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   aoe:Clos_0463 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83765"
FT                   /db_xref="GOA:B2A4B1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B1"
FT                   /protein_id="ACB83765.1"
FT                   /translation="MCNSNLNVSVILPAGGQGSRMGQSINKQYLNLRGQPILARTWRVF
FT                   TRLPCVKEIFLVVASGEERFCWENVVYPYKDLENTVNIQVLSGGKERQDSVYEGLKRVS
FT                   EESDYTIIHDGARPLITQQNIENSLIQAKESGASIVAVPVKNTIKSLQYPLKVKSLSNG
FT                   DEVPKVKETLPRNTLIEVQTPQTFKSTLIKDAYQWALRQNITATDDSSLVEKMGHQVSV
FT                   VQGSFENIKVTTPEDLFMAEEILKKREEQI"
FT   gene            190635..191111
FT                   /locus_tag="Nther_0167"
FT   CDS_pept        190635..191111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0167"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: gsu:GSU3367 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83766"
FT                   /db_xref="GOA:B2A4B2"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4B2"
FT                   /protein_id="ACB83766.1"
FT                   /translation="MRIGHGVDVHKLVKGEDLVLGGVQIPSDLGLKGHSDADVLIHAIM
FT                   DAMLGSLALGDIGKHFPDDDPRYHQIDSKVLLKKTYQLITSYGYQLINLDSTIMAEKPK
FT                   LAPYIDEMRITISDVLDLYPSQIGIKATTFEKLGFVGSGQGIMAQAVVLMERLY"
FT   gene            191302..192768
FT                   /locus_tag="Nther_0168"
FT   CDS_pept        191302..192768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0168"
FT                   /product="glutamate--tRNA(Gln) ligase, glutamyl-tRNA
FT                   synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: drm:Dred_0191
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83767"
FT                   /db_xref="GOA:B2A4B3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4B3"
FT                   /protein_id="ACB83767.1"
FT                   /translation="MTNKARLRFAPSPTGQIHIGNIRTALFNWLYSRHIDGEFILRVED
FT                   TDMNRSVEEYEQIIFRALSWLGLDWDEGPQKGGDFGPYRQSERKDIYHKYANKLLEAGK
FT                   AYYCYCTEEELEEMREAQRARGEMPRYSGKCADLSSEERAELENEGRKSVIRFKVPENQ
FT                   TIRVNDLVKGEVDFESDGIGDFILIKSDDMASYNFACVVDDYLMNITHVLRGEDHLSNT
FT                   PKQVMIYEALGFETPEFGHLSLILGPDKAKLSKRHGDTFIGEYREKGYLPEAMVNFLAL
FT                   LGWSPPGEDELFTQDELIRLFDIGRVSKSAAVFDVDKLNWMNSHYIKEADTERLLNLSK
FT                   EYLINSDLVSQEQLEHDWEWFVSAVDLVKEKIDMLSELPPQLKIFYGDDVDLKGEEVEF
FT                   LEKDHVPELLSEVINQFNDLDSFEDPKAIKKAVNKAGKQVGVKGKQLFMPVRIAVSGQM
FT                   HGPELDQLISLLGRERAINRVNSTLSQIQS"
FT   misc_feature    192847..193056
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   67.20; T-box leader sequence"
FT   gene            complement(193231..194430)
FT                   /locus_tag="Nther_0169"
FT   CDS_pept        complement(193231..194430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0169"
FT                   /product="transposase IS111A/IS1328/IS1533"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: pth:PTH_2396
FT                   transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83768"
FT                   /db_xref="GOA:B2A2R9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2R9"
FT                   /protein_id="ACB83768.1"
FT                   /translation="MYFVGIDWADTKHDILVMSGDGRELDNFTIQHSKDGFETLKNKLL
FT                   KHDDDPENFYCLIETKHGLLTQYLLENNFTVYSVNPKLVDARRKASGAKTDFIDAKILA
FT                   NMGRSELHDLHKLEPDSEHIQELKVLTRDQEALIQESARLTNRLISTLKEYYPVALELF
FT                   SKITLPVSLAFLRKYPTPKQARKASRDEIFKFLKKQKHPNPTSKANEIFTKLQKPNLEG
FT                   NRAICSAKSKFLFTILDQLEPLLEHIDEYDKEIEKLFKSHSDSKIFDSIPGAGKRIAPR
FT                   LLAEWGDDRSRYADASVVQALAGTSPVLHQSGKMRIVKRRHSCIKPFRNALHQFALQTT
FT                   RWIPWAKDYYYKKRKEGKQHHEAVRTLANIWVRILFAMWVNKEPYNESKFIKAREKHAA
FT                   "
FT   gene            194688..195356
FT                   /locus_tag="Nther_0170"
FT   CDS_pept        194688..195356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0170"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: chy:CHY_2339 serine acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83769"
FT                   /db_xref="GOA:B2A4B5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B5"
FT                   /protein_id="ACB83769.1"
FT                   /translation="MIQTIKSDIRAVFERDPAVKSLLEILLCYPGIHAILLHRMAHFLY
FT                   NKRGYLIARFISQINRLLTGIEIHPGAKIGKSFFIDHGMGIVIGETAEIGDNVTLYQGV
FT                   TLGGTGKEKGKRHPTLKDNVVIGAGAKVLGPITIEDNVKIGAGSVVLDHVPNDSTVVGV
FT                   PGRIVVRKGKRLNNVDLNHHELPDPVARQIEYLERKIEKLRFEIEDIKRGDHENEHKAL
FT                   "
FT   gene            195331..196740
FT                   /locus_tag="Nther_0171"
FT   CDS_pept        195331..196740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0171"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: tte:TTE2315 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83770"
FT                   /db_xref="GOA:B2A4B6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B6"
FT                   /protein_id="ACB83770.1"
FT                   /translation="MKMSIKLFNTMKKKKEEFVPKQEGKVDMYVCGPTVYDYFHVGNAR
FT                   AFLIFDVVRRYLDYKGYQVTYVQNITDIEDKMINRANEDGITVAELAEKYTSEYFDDAR
FT                   AIGIKDADHHPKATEHIAEIIEIIQDLLDKGYAYRQGGDVYFDTAAFDDYGKLCRQDPE
FT                   ELVSGARVAVDDRKKNPADFVLWKSKKEGEPAWDSPFGQGRPGWHIECSAMSMKYLDTP
FT                   LDIHAGGSDLVFPHHENEVAQSEAATGQDFCKYWMHVGYLEIDNRKMSKSMGNFLTVRD
FT                   FRQKYDPRVLRLFLMSAHYRSPLNFTDELIEQAKSSLDRLDNFYNNLKFYLEKSREQEL
FT                   TDKEQDIMEYLKQARTEFEAAMDDDFNTASALAVIFSLAKEINSYIGNGGENALVFKNT
FT                   YDLLLEFDQVMGLLPETDEILPEEIEQKIQEREQARKQKDFQRADAIRDELRDRGIILE
FT                   DTPEGVRWKRT"
FT   gene            196737..197162
FT                   /locus_tag="Nther_0172"
FT   CDS_pept        196737..197162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0172"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III; KEGG: tte:TTE2314
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83771"
FT                   /db_xref="GOA:B2A4B7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B7"
FT                   /protein_id="ACB83771.1"
FT                   /translation="MKAFEKTIEQKTKTGQFSPQSLAYLGDAVYELYVRLQSTATPYNS
FT                   VSNLHENTVRLVSAPTQAVLLDKIYPKLTKEEQAIVRRGKNAKVHQPPKGVRYYEYRLA
FT                   TGFEALVGYLYLKEREDRIEELLINEVNRELSNEECK"
FT   gene            197201..197893
FT                   /locus_tag="Nther_0173"
FT   CDS_pept        197201..197893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0173"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /note="TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX;
FT                   KEGG: swo:Swol_2353 thymidylate synthase complementing
FT                   protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83772"
FT                   /db_xref="GOA:B2A4B8"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B8"
FT                   /protein_id="ACB83772.1"
FT                   /translation="MKVIDPQVLIPEKEMDEAKLKKIERYARVCYKSEDKMKGNYNQSL
FT                   LEFLVEQGHESVIEHEKVTVMMIIDRGLSHEIVRHRLASYSQESTRYCNYQKDKFGNEI
FT                   TLIRPYFYSHRDKEYQLWESSCQEIEQKYFELLETGSTPQEARSILPNSLKTEIVVTFN
FT                   MREWRHFFKLRCDKAAHPQARQIAIPVLKEFKNKFPVLFQDIDYDKSFDQEHYASVIYT
FT                   DEMFQPLK"
FT   gene            198084..198827
FT                   /locus_tag="Nther_0174"
FT   CDS_pept        198084..198827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0174"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: amt:Amet_4497
FT                   RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83773"
FT                   /db_xref="GOA:B2A4B9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4B9"
FT                   /protein_id="ACB83773.1"
FT                   /translation="MRTDSLVPGKNPVVEAIRGNRKVFRIYISKDSNKNFQDEMLKLAQ
FT                   QHNINLDKVPLDRLDKMVPTTEHQGIVAETEPFKYSQLDTVLKGFDYNNQKPLTLLILD
FT                   HLTDPQNFGAIIRTADAVGVDGVIIPKRRSVDVNPTVMKASSGAAEHVPIIKVSNLRQT
FT                   ISKLKEQWIWILGTDIDGDRGIFEENYNIPLALVVGNEASGMSPLVKKECDFIANIPMI
FT                   GRVNSLNASVATAVVLYEIYRQKTN"
FT   gene            198860..199372
FT                   /locus_tag="Nther_0175"
FT   CDS_pept        198860..199372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0175"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   cdf:CD0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83774"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C0"
FT                   /protein_id="ACB83774.1"
FT                   /translation="MTDYLIVDGYNIINAWDHLKKSAEENLEISRIELIDELSEYKGIL
FT                   WGKIVVVFDAHSAKQKNRHTEQINGILVIYTKEGETADSLIEALVYDLVDKGNVDVATS
FT                   DWQEQRVIMGKGAVRLSARDLKKLIRETKEKIRKNFIEKEEGKRNTLDNLLDQQVKEKL
FT                   NILRHKK"
FT   gene            199476..200117
FT                   /locus_tag="Nther_0176"
FT   CDS_pept        199476..200117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0176"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   mta:Moth_2479 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83775"
FT                   /db_xref="GOA:B2A4C1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C1"
FT                   /protein_id="ACB83775.1"
FT                   /translation="MSQSAQDIFEKYDLNSDEEVAKRAREGCHEALEFLIGKYKNFVRA
FT                   KARSYFLIGADREDIIQEGMIGLYKAIRDFRGDKLSSFKAFAELCITRQIITAIKTATR
FT                   QKHIPLNSYVSLDKPIYDEDSDRTLLDVISGVRITDPEYLMVNREEYNDIELKMTEILS
FT                   SLEWKVLMLYLEGKSYQEIAQELDRHVKSIDNALQRVKRKLERYLNIRSE"
FT   gene            200288..200375
FT                   /locus_tag="Nther_R0020"
FT                   /note="tRNA-Tyr1"
FT   tRNA            200288..200375
FT                   /locus_tag="Nther_R0020"
FT                   /product="tRNA-Tyr"
FT   gene            200395..200468
FT                   /locus_tag="Nther_R0021"
FT                   /note="tRNA-Gly1"
FT   tRNA            200395..200468
FT                   /locus_tag="Nther_R0021"
FT                   /product="tRNA-Gly"
FT   gene            200486..200562
FT                   /locus_tag="Nther_R0022"
FT                   /note="tRNA-Met2"
FT   tRNA            200486..200562
FT                   /locus_tag="Nther_R0022"
FT                   /product="tRNA-Met"
FT   gene            200581..200658
FT                   /locus_tag="Nther_R0023"
FT                   /note="tRNA-Thr1"
FT   tRNA            200581..200658
FT                   /locus_tag="Nther_R0023"
FT                   /product="tRNA-Thr"
FT   gene            200663..200739
FT                   /locus_tag="Nther_R0024"
FT                   /note="tRNA-Met3"
FT   tRNA            200663..200739
FT                   /locus_tag="Nther_R0024"
FT                   /product="tRNA-Met"
FT   gene            200993..202195
FT                   /locus_tag="Nther_0177"
FT   CDS_pept        200993..202195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0177"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: drm:Dred_0213
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83776"
FT                   /db_xref="GOA:B2A4C2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C2"
FT                   /protein_id="ACB83776.1"
FT                   /translation="MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAMTTCLSTAGGAEKM
FT                   EYDSIDRAPEEKERGITISTAHVEYESDNRHYAHVDCPGHADYVKNMITGAAQMDGSIM
FT                   VVSAADGPMPQTREHILLSRQVGVPHIVVFLNKADMVDDEELLELVEMEVRDLLNEYDF
FT                   PGDDTPVVTGSALKAIECGCGDRECENCGPIWELVDAIDDYIPTPDRDVDKPFLMPVED
FT                   VFSITGRGTVATGRVERGNINVQDEVEIVGMADRPKKTVVTGVEMFRKSMDYGEAGDNI
FT                   GALLRGVDREEIERGQVLAKPGSINPHTKFKAEVYVLKKEEGGRHTPFFQGYRPQFYFR
FT                   TTDVTGVIELPEGVEMVMPGDNVQMEINLITPIAIEEGLRFAIREGGKTVGAGVVTGII
FT                   E"
FT   gene            202343..202492
FT                   /locus_tag="Nther_0178"
FT   CDS_pept        202343..202492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0178"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: cbe:Cbei_0137
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83777"
FT                   /db_xref="GOA:B2A4C3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4C3"
FT                   /protein_id="ACB83777.1"
FT                   /translation="MREKITLECTECKQRNYKSFKNKQNDRDRIELKKYCKFCNRHTLH
FT                   KESK"
FT   gene            202598..202789
FT                   /locus_tag="Nther_0179"
FT   CDS_pept        202598..202789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0179"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: tme:Tmel_0640
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83778"
FT                   /db_xref="GOA:B2A4C4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C4"
FT                   /protein_id="ACB83778.1"
FT                   /translation="MGLIRKALKFLRETKIELKKVNWPNRQQLITYTGVVLMTVAIVGV
FT                   YFWILDTAFIGIIQLMIQ"
FT   gene            202834..203358
FT                   /locus_tag="Nther_0180"
FT   CDS_pept        202834..203358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0180"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: drm:Dred_0202 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83779"
FT                   /db_xref="GOA:B2A4C5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C5"
FT                   /protein_id="ACB83779.1"
FT                   /translation="MEKQWFVVHTYSGYENKVKTNLEKRVASMGMDDKIFRIVVPTETQ
FT                   INIKDGRRQEKEKKVFPGYVIVEMVMDEDSWYVVRNTPGVTGFVGSGAKPVPLNEDEVA
FT                   SIMKQMGYEEPKKEVDLEAGQEVKILEGPFENFSGQIEEVYPDKEKVKVTVSMFGRETP
FT                   VELDFEQVEKV"
FT   gene            203434..203859
FT                   /locus_tag="Nther_0181"
FT   CDS_pept        203434..203859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0181"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: bay:RBAM_001270
FT                   RplK"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83780"
FT                   /db_xref="GOA:B2A4C6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4C6"
FT                   /protein_id="ACB83780.1"
FT                   /translation="MAKKVAQVIKLQIPAGKATPAPPVGPALGQHGVNIMSFCKEFNEQ
FT                   TANQEGMLIPVEITVYEDRSFTFITKTPPAAVLLKKAAGIDKASGEPNKNKVATVGKDK
FT                   VKEIAELKMQDMNASDLDAAMKMVEGTARSMGIIVEG"
FT   gene            203988..204689
FT                   /locus_tag="Nther_0182"
FT   CDS_pept        203988..204689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0182"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: mta:Moth_2471 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83781"
FT                   /db_xref="GOA:B2A4C7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C7"
FT                   /protein_id="ACB83781.1"
FT                   /translation="MAKAKSKKYLEALEKIDREKLYDPEEALELVKETGVANFDETVEV
FT                   ACRLGVNPKYNDQQVRGALVLPNGTGKTAKVVVFAKGDKAKEAEDAGADIVGAEELVNK
FT                   IEGGFLDFDVAIATPDMMSMVGKLGRVLGPKGLMPNPKAGTVTNDISKAVEEAKAGKVE
FT                   FRVDRSGNVHVPIGKESFEADKLKENFDALMDAILKARPAAAKGQYLRGVAVSTTMGPG
FT                   IKINNQKVTQK"
FT   misc_feature    204739..204915
FT                   /note="Ribosomal protein L10 leader as predicted by Rfam
FT                   (RF00557), score 66.44; ribosomal protein L10 leader"
FT   gene            204937..205467
FT                   /locus_tag="Nther_0183"
FT   CDS_pept        204937..205467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0183"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: pth:PTH_0308
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83782"
FT                   /db_xref="GOA:B2A4C8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4C8"
FT                   /protein_id="ACB83782.1"
FT                   /translation="MKKTRQEKERMVEELTEKLSQAESAVLVDYRGLDVAQMNELRRQL
FT                   GDSNVDFKVVKNTLTSIAAENAGIDEINQYLEGPVGIAFGYDDPVVPAKILNDFSKENE
FT                   ELEFKAAILGESVVGEEKVKNLAKLPSREELLGKVAGTFQAPIAGFAGACQGIIRKFVY
FT                   AVDAVRQEKEDAS"
FT   gene            205515..205895
FT                   /locus_tag="Nther_0184"
FT   CDS_pept        205515..205895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0184"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: swo:Swol_2343 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83783"
FT                   /db_xref="GOA:B2A4C9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4C9"
FT                   /protein_id="ACB83783.1"
FT                   /translation="MSKVQEVLDIVKEMSVLELSELVEAMEEEFGVSAAAPAPAAAPAA
FT                   GGDQGGAEAAEQTEFDVVLNDAGQKKIQVIKAVKEATGMGLKEAKALADELPKAVKEKV
FT                   SKEEAEELKEKIEEAGGDVEIK"
FT   gene            complement(206078..207442)
FT                   /locus_tag="Nther_0185"
FT   CDS_pept        complement(206078..207442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0185"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: pth:PTH_2713
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83784"
FT                   /db_xref="GOA:B2A183"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A183"
FT                   /protein_id="ACB83784.1"
FT                   /translation="MFCENVTMTKKVTYQMTQEEIKKLNIINQTIDGYLTIRDAARALN
FT                   LSDRQIKRLKKGVQLEGPSFVIHKSRGKKPDHSVPESTEKHIISLKLEKYPNANFTHFT
FT                   ELLNEREKISISRPVVHRILSKAGISSPKKHKKSKSHHRRKRKDRMGLLVQIDASPYDW
FT                   FDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIF
FT                   RSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLP
FT                   TLFKLHNITTMEKANEFLQKDFLPDFNKRFALKPENELSAFTCLNQDINLDHILCSKFK
FT                   RTVDNSATFSFEGSYYQILDKNSQLVPKSKVTVLSNPKFGVKVKYKDMVFETQIVDKPS
FT                   TTKMTKKVKTTQSPKNRIVPDENHPWRKQSERTNLNYDLTDQELLDTILNTRDRV"
FT   gene            207673..211197
FT                   /locus_tag="Nther_0186"
FT   CDS_pept        207673..211197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0186"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: bha:BH0126
FT                   DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83785"
FT                   /db_xref="GOA:B2A4D1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4D1"
FT                   /protein_id="ACB83785.1"
FT                   /translation="MAKPASENLRRSYSKLDEVFELPDLIEIQKSSYQWFLDEGLKEMF
FT                   DDISPIEDFTGGLVLEFVDYSLGEPKYSVEDCKERDVTYSVPLKVKVRLVNQETGEVKE
FT                   QEVFMGDFPLMTENGTFIINGAERVIVSQLVRSPGVYFSSEIDSNGNTLYSGTIIPNRG
FT                   AWLEFEMNAQNVISVRVDRTRKLPVTVLIRALGYGTDDDIFHLFGEDPRIKATLEKDHT
FT                   DSYEAGILEIYKRLRPGEPLNVENAKSLFESLFFDPKRYDLAKVGRHKINQKLELGDRL
FT                   LGKTARETITDDETGEVIIEEGTVIDTQDLEKLEQSGITSIRIGKDDQEDRDCVVLTNG
FT                   DVDKNVKNLTRNDIVASIGYMLNLLDGLGFVDDIDHLGNRRLRCVGELLQNQFRIGLSR
FT                   MERVVRERMTIQDVDSITPSALINIRPVIASIKEFFGSSQLSQFMDQTNPLAELTHKRR
FT                   LSALGPGGLSRERAGFEVRDVHHSHYGRMCPIETPEGPNIGLISSLSSYGKVNEFGFIE
FT                   TPYRKVDKENGLVTEKIEYLSAHEEDKYVIAQANTPLDSDGYFSSDRITARYRHETLIT
FT                   TPDKIDYMDVSPRQLVSVATAQIPFLENDDANRALMGSNMQRQAVPLLQTESPLVGTGM
FT                   EYRTAYDSGAVVKSRADGTVDKVQSNEIWVRRNDNAKGRVVNGRTGEVFEGETGEVRAG
FT                   YDIYKLQKFQRSNQGTCMNQVPIVEEGQQITENQILADGPSTDNGEIALGQNVLVGFMP
FT                   WEGYNYEDAILISEKLVKDDTFTSIHIEEYEAEARDAKLGPEEITRDIPNVGEDALKNL
FT                   DERGIVRIGAEVKSGDILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGE
FT                   HGIVVDVKVFNRDDGDELPPGVNQLVRVYIAQKRKISEGDKMAGRHGNKGVIAKILPEE
FT                   DMPFLPDGTPLEIILSPLGVPSRMNLGQVLETHLGWAAKALGLKMASPVFDGADEDEIL
FT                   ETLKEAGLPENGKTQLVDGRTGEPFDNEVTVGYIYMLKLAHLVDDKIHARSTGPYSLVT
FT                   QQPLGGKAQFGGQRFGEMEVWALEAYGAAYSLQELLTVKSDDVVGRVKTYESIVKGDNV
FT                   PEPGIPESFKVLIKELQSLGMDVKVLNEEQGLVSIKDGEGNEEVVSVEDLNLDLKDADQ
FT                   DSSSQRDE"
FT   gene            211298..214954
FT                   /locus_tag="Nther_0187"
FT   CDS_pept        211298..214954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0187"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: mta:Moth_2467 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83786"
FT                   /db_xref="GOA:B2A4D2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D2"
FT                   /protein_id="ACB83786.1"
FT                   /translation="MIDVNSFNALKIGLASPEQIRSWSKGEVKKPETINYRTLKPEKEG
FT                   LFCEKIFGPQKDWECHCGKYKRVRYKGIVCDRCGVEVTQSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRLGLLLNMSPRALEKVLYFASYVVIDPGETSLAKKQLLTETEYREYYDKFE
FT                   SQFKKGKGFKAMMGAEAIKELLKELDLEALTKELRNDLKTAKGQKKVRTVRRLEVAESF
FT                   RKSGNKPEWMILDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLNLG
FT                   APDIIVRNEKRMLQEAVDALIDNGRRGRAVTGPGNRPLKSLSDMLKGKQGRFRQNLLGK
FT                   RVDYSGRSVIVVGPELKIYQCGLPKEMALELFKPFVMKRLVEKELSHNIKSAKRMVEKV
FT                   RPEVWDVLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIEGRAIQIHPLVCPAYNADFDG
FT                   DQMAVHLPLSAEAQAEARILMLASQNILNPKDGSPVATPTQDMVLGSYYLTLENTSDFK
FT                   NDAYFSSPAEAVMAFRQKDIDMQEPIAVDVRNYEKKDFSLPENNKPSDSNLLITTVGKI
FT                   IFNEIFPEDFPYVNGEKPGLNEYDWLKSGERIEDKLKQREPREAIQKGSLGDLVGHCYR
FT                   KYGSTKTASILDKMKEVGYSYATKAGVTIGITDVAVPEKKHEIISDAEGKVDEVEKQHH
FT                   RGLITPQERYTRVIDIWNNAKDSVTGAVMDNLDIFNPIYMMATSGARGNISQITQLAGM
FT                   RGLMADPTGRIIDLPIKTNFREGLTVLEYFNSTHGARKGLADTALKTADSGYLTRRLVD
FT                   VSQDVIVREEDCGETDGVEVGAITNGNEIIEGIGDRVVGRFAAADIRDRQGNMIVNRNE
FT                   LITEDAAEQIQEAKLDQVPIRSVLTCKTKNGVCVKCYGRDLATGAVANVGEAVGIIAAQ
FT                   SIGEPGTQLTMRTFHTGGVAGDDITQGLPRIEELFEARKPKGLAVISEIDGRITVKTEH
FT                   NKRKVIVTPEKGEQKSYNIPYGARLKVKDGDEINAGDEITEGSINPHDLLKIKGVRGVQ
FT                   LYILQEVQKVYRMQGVDISDKHIEIIIRQMLKKVRIEEAGDTELLPGSYVDFFDFEKVN
FT                   ERIKEEGGEPAKAKSLLLGITKASLATDSFLSAASFQETTRVLTEAAIKGKVDPLIGLK
FT                   ENVIIGKLVPAGTGMPHYRNIDLAYNDEENEAQSDKSQDEQEIGEITVDMGE"
FT   gene            215009..215257
FT                   /locus_tag="Nther_0188"
FT   CDS_pept        215009..215257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0188"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   mta:Moth_2466 ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83787"
FT                   /db_xref="GOA:B2A4D3"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4D3"
FT                   /protein_id="ACB83787.1"
FT                   /translation="MSLSKLKKASQTAIGVNESLKAVEEGAAKMVFIAQDADDHIVEPL
FT                   KQKCNELQLDIKYVTTMKELGQAAGIEVNATSACIID"
FT   gene            215330..215698
FT                   /locus_tag="Nther_0189"
FT   CDS_pept        215330..215698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0189"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: dvl:Dvul_1770 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83788"
FT                   /db_xref="GOA:B2A4D4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D4"
FT                   /protein_id="ACB83788.1"
FT                   /translation="MPTINQLIRKKRKSTGKKRTAPALEKCPQRRGVCTRVSTTTPKKP
FT                   NSALRKIARVRLTNGMEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYQVVRGALDT
FT                   AGVEDRAQGRSKYGTKKG"
FT   gene            215779..216249
FT                   /locus_tag="Nther_0190"
FT   CDS_pept        215779..216249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0190"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: bcy:Bcer98_0100
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83789"
FT                   /db_xref="GOA:B2A4D5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D5"
FT                   /protein_id="ACB83789.1"
FT                   /translation="MSRKGPAPKRDVNPDPIYNSKMVTKFINKLMLDGKKGLSQRIFYK
FT                   ALELVGERTNEEPLEVFETAVKNVMPVLEVKARRVGGATYQVPVEVEPNRKQVLAIRWI
FT                   VNYARERGERAMSERLAGELIDAYNNTGGAIKKKEDTHKMAEANKAFAHYRW"
FT   gene            216317..218392
FT                   /locus_tag="Nther_0191"
FT   CDS_pept        216317..218392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0191"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: cth:Cthe_2729 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83790"
FT                   /db_xref="GOA:B2A4D6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D6"
FT                   /protein_id="ACB83790.1"
FT                   /translation="MTRKFPLEQTRNIGIMAHIDAGKTTTTERILFYTGRVHKLGETHD
FT                   GASTMDFMDQEQERGITITSAATTCQWRDTRVNIIDTPGHVDFTVEVERSLRVLDGAIG
FT                   VFCAKGGVEPQSETVWHQADRYHVPRIAYINKMDIMGADFYNVVDMMNERLQANPVPIQ
FT                   LPIGKEDDFQGIVDLIKNTAVIYKDDLGTEWEEVEIPEDMQELAEEYRDKMLEMAAEYD
FT                   EELMMKYLEGEEITSEEIRLALREGCLKTELTPVLCGSSYKNKGVQMLLNAVIDYLPAP
FT                   TDVPPIEGVVPGKEDEEEKEQRVSSDDEPFSALAFKIVTDPYVGKLCFFRVYSGKIEAG
FT                   SYVYNPVKGKKERVGRILQMHANHREERNVVYTGDIAAAVGLKNTSTGETLCSPEKPIV
FT                   LESMQFPEPVISVAIEPKTRADQEKMATSLQKLSEEDPTFQTHTDDETGQTIIKGMGEL
FT                   HLEVIVDRLLREFKVEANVGKPQVAYKETIKAPTKSEGKFIRQSGGRGQYGHVLIEMEP
FT                   LERGAGYEFEDKIVGGVIPKEYIPAVDNGIQEAMQNGVLAGYPMVDVKITLYDGSYHEV
FT                   DSNESAFKIAGSMAFKDGSKKASPVILEPIMKVEIVVPEEYMGDVMGDVNSRRGRIEGM
FT                   EERSGSRLIRSYVPLAEMFGYATQLRSTTQGRGTYTMEFSHYDEVPDSIAKELMDV"
FT   gene            218420..219622
FT                   /locus_tag="Nther_0192"
FT   CDS_pept        218420..219622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0192"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: drm:Dred_0213
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83791"
FT                   /db_xref="GOA:B2A4C2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4C2"
FT                   /protein_id="ACB83791.1"
FT                   /translation="MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAMTTCLSTAGGAEKM
FT                   EYDSIDRAPEEKERGITISTAHVEYESDNRHYAHVDCPGHADYVKNMITGAAQMDGSIM
FT                   VVSAADGPMPQTREHILLSRQVGVPHIVVFLNKADMVDDEELLELVEMEVRDLLNEYDF
FT                   PGDDTPVVTGSALKAIECGCGDRECENCGPIWELVDAIDDYIPTPDRDVDKPFLMPVED
FT                   VFSITGRGTVATGRVERGNINVQDEVEIVGMADRPKKTVVTGVEMFRKSMDYGEAGDNI
FT                   GALLRGVDREEIERGQVLAKPGSINPHTKFKAEVYVLKKEEGGRHTPFFQGYRPQFYFR
FT                   TTDVTGVIELPEGVEMVMPGDNVQMEINLITPIAIEEGLRFAIREGGKTVGAGVVTGII
FT                   E"
FT   gene            219714..220025
FT                   /locus_tag="Nther_0193"
FT   CDS_pept        219714..220025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0193"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: cth:Cthe_2902
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83792"
FT                   /db_xref="GOA:B2A4D8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D8"
FT                   /protein_id="ACB83792.1"
FT                   /translation="MANKQKIRIRLKAFDHMILDQSAEKIVETAKRTGANVSGPVPLPT
FT                   DKNVYTVIRAPHKFKDSREQFEMRTHKRLIDILDPTSKTVDSLMRLDLPSGVDIEIKL"
FT   gene            220065..220697
FT                   /locus_tag="Nther_0194"
FT   CDS_pept        220065..220697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0194"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: sha:SH0802 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83793"
FT                   /db_xref="GOA:B2A4D9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4D9"
FT                   /protein_id="ACB83793.1"
FT                   /translation="MKKAILGKKVGMTQIFSEEGEVMPVTVVKAGPCSVVQKKVEDTDG
FT                   YNAVQIGFEDKKENKTKKPEKGHFEKAGVNPKKHLTEFELESMENLEVGQELTVEQFEV
FT                   GDQIDVTGTSKSKGFQGTIKRFKHSTGPKTHGSRFYRAPGSLGSMDISRVFKGQTLPGR
FT                   MGGNTVTVQRLEVVDVDKENNLLLVKGAVPGPKKGLLKIVDSVKAKS"
FT   gene            220746..221369
FT                   /locus_tag="Nther_0195"
FT   CDS_pept        220746..221369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0195"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: aoe:Clos_0493
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83794"
FT                   /db_xref="GOA:B2A4E0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E0"
FT                   /protein_id="ACB83794.1"
FT                   /translation="MPKVALYNNEGSQVGEITLDDSIFATDINETLMHEAVNMHLASKR
FT                   RGTASAKTRSEVRGGGRKPWRQKGTGRARHGSIRSPIWVGGGISFAPKPRDYSYKMPKK
FT                   AKRKAIKSALTTKLNNGEIVILEELTMEAPKTKKIIEMLENLSINHKAMIVTGASDLNV
FT                   YRSTRNIPGVSSALANNLNVYDVLNHDYLVLTKDAVSVIEEVFC"
FT   gene            221369..221650
FT                   /locus_tag="Nther_0196"
FT   CDS_pept        221369..221650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0196"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: amt:Amet_4476
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83795"
FT                   /db_xref="GOA:B2A4E1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E1"
FT                   /protein_id="ACB83795.1"
FT                   /translation="MDPRDVIIKPWITEQSTDQMEENKYTFVVAKDANKTQIKDAVQKL
FT                   FGVKVKQVNTMNMKGKPKRLGIYQGKTPSWKKAIITLTDDSKAIDLFE"
FT   gene            221684..222535
FT                   /locus_tag="Nther_0197"
FT   CDS_pept        221684..222535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0197"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: cth:Cthe_2906 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83796"
FT                   /db_xref="GOA:B2A4E2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E2"
FT                   /protein_id="ACB83796.1"
FT                   /translation="MKKEGNKVSIKKFKPTSPGKRYMTVASKEEITREEPEKSLLAPLK
FT                   NKSGRNNQGRISTRRQGGRHKRKYRIIDWKRDKDGVPAKVASIEYDPNRTAYIALLNYV
FT                   DGEKRYILAPLGIKPGDKIESGSKAEIRPGNALPIRNIPVGTIVHNVELKPEKGGQLAR
FT                   SAGTYCQIVAKEGKYAHVKLPSEEVRMIHLDCRATVGQVGNVEHENIDLGKAGRARWQG
FT                   KRPSVRGVAMNAVDHPHGGGEGKAFVGRKTQYTPWGQKSAGYKTRRKAKKSDKYIVKKR
FT                   NQ"
FT   gene            222575..222859
FT                   /locus_tag="Nther_0198"
FT   CDS_pept        222575..222859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0198"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: drm:Dred_0219 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83797"
FT                   /db_xref="GOA:B2A4E3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E3"
FT                   /protein_id="ACB83797.1"
FT                   /translation="MPRSIKKGPFVDDHLLKKVKEMNKSNKKQVIKTWSRRSTILPDMI
FT                   GHTIAVHDGRKHVPVFITEDMVGHKLGEFAPTRTFRGHGDHTERSTSLK"
FT   gene            222889..223230
FT                   /locus_tag="Nther_0199"
FT   CDS_pept        222889..223230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0199"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: dsy:DSY0476 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83798"
FT                   /db_xref="GOA:B2A4E4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E4"
FT                   /protein_id="ACB83798.1"
FT                   /translation="MEAKATARYVRISPRKAREVIDMIRGKNIEEALGILQLTPKGATK
FT                   PIEKVVKSAQANAENNFEMNPDSLYISECYVDEGPTLKRFRPRAMGRATPINKKTSHLT
FT                   VVVKEQKEG"
FT   gene            223235..223924
FT                   /locus_tag="Nther_0200"
FT   CDS_pept        223235..223924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0200"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: pth:PTH_0326 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83799"
FT                   /db_xref="GOA:B2A4E5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E5"
FT                   /protein_id="ACB83799.1"
FT                   /translation="MGQKINPIGLRIGVIKDWQSNWYADKNYTELVHEDIKIREYIENK
FT                   LFNADVSAIQIDRAANRIKVTLHTAKPGMVIGKGGSGVEKLRSDIENLTGKKVHINVME
FT                   VKTPELDAHLAAKSIAIALERRVAFRRAMKQAVGRAMRQGAKGIKVMCSGRLGGAEMSR
FT                   TEWYTEGNVPLQTLRADIDYGMVEANTAYGQIGVKCWINKGEVLPEVDENEETKEENKE
FT                   KSEEKSE"
FT   gene            223942..224376
FT                   /locus_tag="Nther_0201"
FT   CDS_pept        223942..224376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0201"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: tte:TTE2285 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83800"
FT                   /db_xref="GOA:B2A4E6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E6"
FT                   /protein_id="ACB83800.1"
FT                   /translation="MLMPKRTKFRRQMRGRMKGKAKGGKEIAFGEFGLQALEPAWINSR
FT                   QIEAARIALTRYIKRGGKVWVKIFPDKPVTQKPAETRMGGGKGSPEFWAAVVKPGRILF
FT                   EVAGVPKETAREAMRLASHKLPIKTKFVEREEMGGDANES"
FT   gene            224366..224563
FT                   /locus_tag="Nther_0202"
FT   CDS_pept        224366..224563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0202"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: tte:TTE2284 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83801"
FT                   /db_xref="GOA:B2A4E7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E7"
FT                   /protein_id="ACB83801.1"
FT                   /translation="MKAKEIREMTNRELEAKLDELKEELFNLRFQVATGQIENPMRLKQ
FT                   VRKDIARVKTILRERELNIS"
FT   gene            224593..224850
FT                   /locus_tag="Nther_0203"
FT   CDS_pept        224593..224850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0203"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: cno:NT01CX_1124
FT                   30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83802"
FT                   /db_xref="GOA:B2A4E8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E8"
FT                   /protein_id="ACB83802.1"
FT                   /translation="MERSNRKVRTGRVVSDKMDKTRVVLVEGRTKHPLYEKTVKQAKKF
FT                   KAHDEANETREGDVVKIMETRPTSKDKRWRIVDIIERTKL"
FT   gene            224886..225254
FT                   /locus_tag="Nther_0204"
FT   CDS_pept        224886..225254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0204"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: gka:GK0116 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83803"
FT                   /db_xref="GOA:B2A4E9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4E9"
FT                   /protein_id="ACB83803.1"
FT                   /translation="MIQTESTLRVADNTGAREIQCIKVIGAGQKQYANVGDVIVGTIKE
FT                   ATPGGVVKRGQVVRAVIVRTKRGIKRPDGSYIRFDENACVIIDENKDPRGTRIFGPVTR
FT                   ELREKKYMKIISLAPEVL"
FT   gene            225276..225599
FT                   /locus_tag="Nther_0205"
FT   CDS_pept        225276..225599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0205"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: tte:TTE2281 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83804"
FT                   /db_xref="GOA:B2A4F0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F0"
FT                   /protein_id="ACB83804.1"
FT                   /translation="MPQQKLHVKSGDTVVVISGKDKGKRGKVLRTFPSEQKVLVEGVNM
FT                   INKHTRATQENPQGGIVEQEGPVYADKVMVYCSKCQKPVRTGAKIDDKGNKSRICKKCG
FT                   VEL"
FT   gene            225628..226167
FT                   /locus_tag="Nther_0206"
FT   CDS_pept        225628..226167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0206"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: cno:NT01CX_1127
FT                   50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83805"
FT                   /db_xref="GOA:B2A4F1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F1"
FT                   /protein_id="ACB83805.1"
FT                   /translation="MARLLEHYRGEVKPKLKDEMGYKNIMEVPKLEKVVVNMGIGDAKD
FT                   NPKILDNAVENLEQVTGQKPVVTKAKRSIANFKVRQGMPVGCKVTLRGERMYHFLDKLI
FT                   NVALPRVRDFKGVSPKAFDGRGNYSLGLKEQMVFPELEYDDIERVQGMDIIIATTAETD
FT                   EEAKKLLERLGMPFSG"
FT   gene            226195..226380
FT                   /locus_tag="Nther_0207"
FT   CDS_pept        226195..226380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0207"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cth:Cthe_2916
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83806"
FT                   /db_xref="GOA:B2A4F2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F2"
FT                   /protein_id="ACB83806.1"
FT                   /translation="MARKSLIAKAKKRPKFKTRAYNRCKICGRSHAYLRKFGMCRICFR
FT                   ELAHEGKLPGVRKASW"
FT   gene            226407..226805
FT                   /locus_tag="Nther_0208"
FT   CDS_pept        226407..226805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0208"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: chy:CHY_2295 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83807"
FT                   /db_xref="GOA:B2A4F3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F3"
FT                   /protein_id="ACB83807.1"
FT                   /translation="MTMTDPIADMLTRIRNAQSVYHKQVEIPASKLKRELVDILKREGY
FT                   INDFEYIDDNKQGILRIELKYSDNDEQVISGLKRISKPGLRVYAKKDEIPRVLGGLGIA
FT                   VVSTSSGLLTDREARDQGIGGEILCYIW"
FT   gene            226834..227370
FT                   /locus_tag="Nther_0209"
FT   CDS_pept        226834..227370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0209"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: drm:Dred_0230
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83808"
FT                   /db_xref="GOA:B2A4F4"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F4"
FT                   /protein_id="ACB83808.1"
FT                   /translation="MSRIGKKPIEIPDSVDISINNNEVTVKGPKGELSQVVDQSIILEE
FT                   EEGQLLVKRPTDSNHHKSLHGLSRSLIANMVEGVTNGFERHLEIVGVGYRAQMQGKNLV
FT                   LNVGYSHPVTIEPPEGVEIEVPKNNQIIVKGTDKEVVGQVAARIRAVRKPEPYKGKGIK
FT                   YAEEQIIRKVGKTGK"
FT   gene            227399..227764
FT                   /locus_tag="Nther_0210"
FT   CDS_pept        227399..227764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0210"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: tte:TTE2275 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83809"
FT                   /db_xref="GOA:B2A4F5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4F5"
FT                   /protein_id="ACB83809.1"
FT                   /translation="MPRFDRKQARKKRHRRVRKKIYGTSERPRLNVYRSAKNIHAQVID
FT                   DNRGHTLVHASTLDPEIKDDYQGKNNQEASAAVGRLIAKRSKDKGIEDVIFDRGGYLYH
FT                   GRVKALAEAAREEGLNF"
FT   gene            227794..228300
FT                   /locus_tag="Nther_0211"
FT   CDS_pept        227794..228300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0211"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   drm:Dred_0232 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83810"
FT                   /db_xref="GOA:B2A4F6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F6"
FT                   /protein_id="ACB83810.1"
FT                   /translation="MRRKDFDPNKLDLSEKVVEINRVTKVVKGGRRFSFSALVVVGDEN
FT                   GYVGAGNGKAVEVPEAIRKGIEDAKKNLIKVPMVGTTIPHEIVGRDGGGQVLLKPAYEG
FT                   TGVIAGGPVRAVLEQAGIRDILTKSLGSNNAKSMVNATIAGLNQLKTAEQVARLRGISV
FT                   KDLQG"
FT   gene            228313..228504
FT                   /locus_tag="Nther_0212"
FT   CDS_pept        228313..228504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0212"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: chy:CHY_2291
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83811"
FT                   /db_xref="GOA:B2A4F7"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F7"
FT                   /protein_id="ACB83811.1"
FT                   /translation="MADKKLKVTLKRGLIGVSDGKIRTIKALGLKKRSHSVIKNDTPEI
FT                   RGMIDKVSNLVEVEELEA"
FT   gene            228525..228965
FT                   /locus_tag="Nther_0213"
FT   CDS_pept        228525..228965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0213"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: tte:TTE2273
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83812"
FT                   /db_xref="GOA:B2A4F8"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4F8"
FT                   /protein_id="ACB83812.1"
FT                   /translation="MRLHELRPKTNYKKSRKRKGRGMSSGLGKTAGRGHKGQNARTGGG
FT                   VRPGFEGGQMPLQERLPKRGFTNAFKKEYAIVNVETLNDFEEGTEITPEVLLESKVIKG
FT                   VKDGIKVLGKGEIDKKITVKAHKFSKQAKEKIEEAGGKVEVI"
FT   gene            228967..230226
FT                   /locus_tag="Nther_0214"
FT   CDS_pept        228967..230226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0214"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: mta:Moth_2440 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83813"
FT                   /db_xref="GOA:B2A4F9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4F9"
FT                   /protein_id="ACB83813.1"
FT                   /translation="MLGTLVNAWRIKDLRQKLIFTLAMLFVFRLGAHVPVPGIDATQIQ
FT                   QLFEGQDLFGFLNVIAGGALSQLSIFAMSITPYINASIIMQLLTVVVPKFEQWSKEGQE
FT                   GKKKLAQYTRYGTVIIAFLQAIGMTLGLLRPAVVDPSFTSYMVIILSLTAGTAFLMWLG
FT                   EQINDRGIGNGISIIIFAGIVSRIPQVITTMYEMVRVGEINILLVLVLLAILLSVIVGV
FT                   VALQEGRRQIPVQYAKRVVGRKMYGGQSTHIPLKVNQAGVIPVIFASSILMFPETIAQF
FT                   IQHPIAVSIANAIGFGTPLNTVLYVVLIVFFTYFYTAIQFNPQDMADNMKKYGGFIPGI
FT                   RPGKPTAKYLSKIMDRITLAGAFALAGIVILPILLDGVVEMNIMFGGTALIIMVGVALE
FT                   TMKQIESQMLMRHYQGFMKK"
FT   gene            230246..230890
FT                   /locus_tag="Nther_0215"
FT   CDS_pept        230246..230890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0215"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein; KEGG: chy:CHY_1340 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83814"
FT                   /db_xref="GOA:B2A4G2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4G2"
FT                   /protein_id="ACB83814.1"
FT                   /translation="MRIILMGPPGAGKGTQAEKLSKELDVPHIATGDIFRKAVSEGTEL
FT                   GKEAKSYMDAGQLVPDDVVIGIVEERLKKPDCHEGFILDGFPRTVTQAEALDKVLSDNP
FT                   LTAAVYIDVSKDELIDRLSGRRICRKCGKSYHIKFNPPQVRGVCDEDEGELYQRDDDNE
FT                   ETAKERLEVYLENTQPLVEYYQDRGILKKIDGTKSPEEVFRDILKAVQAKQ"
FT   gene            230887..231636
FT                   /locus_tag="Nther_0216"
FT   CDS_pept        230887..231636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0216"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: aoe:Clos_0514 methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83815"
FT                   /db_xref="GOA:B2A4G3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4G3"
FT                   /protein_id="ACB83815.1"
FT                   /translation="MIIKKSNQELELMRVAGRIVAETHQKVAEAITPGITTVELDKIAE
FT                   DYIKRQNAHPSFKGYHGFPASICASINHEVVHGIPAIKKLQEGDIISIDIGANYKGYHG
FT                   DAAKTYKVGAVDGQLEELIDVTEQSLFKGIEQAVPGNRLSDISHAVEKHVNNHNFYVVK
FT                   KYVGHGIGSAMHEAPEIPNFGPPGKGPRLKAGMVFAIEPMVNIGTSEVKTLDDHWTVIT
FT                   ADESASAHFEHTVAITDSEPEILTKLT"
FT   gene            231713..231994
FT                   /locus_tag="Nther_0217"
FT   CDS_pept        231713..231994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83816"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4G4"
FT                   /protein_id="ACB83816.1"
FT                   /translation="MQKLQVGQLVCSNQGRDAGRLYIVVEILDEEFVRVSDGQKKPLSR
FT                   SKKKNIKHLQKYNKFISKDLIAKLTNKKASDRELRFEVEDFKSQIEAE"
FT   gene            231991..232248
FT                   /locus_tag="Nther_0218"
FT   CDS_pept        231991..232248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0218"
FT                   /product="translation initiation factor 1 (bIF-1)"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bcl:ABC0173 translation initiation factor IF-I"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83817"
FT                   /db_xref="GOA:B2A4G0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4G0"
FT                   /protein_id="ACB83817.1"
FT                   /translation="MISLTKRREELSYMSKKEAIEVEGTVVEPLPNAMFRVELENGHKI
FT                   LAHVSGKIRMNYIRILPGDKVKVELSPYDLSRGRITYRYK"
FT   gene            232284..232400
FT                   /locus_tag="Nther_0219"
FT   CDS_pept        232284..232400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0219"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: ssp:SSP0686 50S
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83818"
FT                   /db_xref="GOA:B2A4G1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4G1"
FT                   /protein_id="ACB83818.1"
FT                   /translation="MMKTRPSVKPICERCKVIKRRGKVMVICSNPKHKQKQG"
FT   gene            232499..232864
FT                   /locus_tag="Nther_0220"
FT   CDS_pept        232499..232864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0220"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: mta:Moth_2434 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83819"
FT                   /db_xref="GOA:B2A4P7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4P7"
FT                   /protein_id="ACB83819.1"
FT                   /translation="MARIAGVDLPRNKRVAIGLTYIYGIGHSKAEEIVEQTGVSTDTRV
FT                   KDLTEDEVNRLRSTIDNDYTVEGDLRREISMNIKRLMEIGCYRGLRHRRGLPVRGQSTK
FT                   NNARTRKGPKRTVGAKR"
FT   gene            232942..233337
FT                   /locus_tag="Nther_0221"
FT   CDS_pept        232942..233337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0221"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bsu:BSU01420 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83820"
FT                   /db_xref="GOA:B2A4P8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4P8"
FT                   /protein_id="ACB83820.1"
FT                   /translation="MARRKRAAARKKKVKKNIESGIATINSTFNNTLVNITDSDGNTMA
FT                   WSSSGACGFKGSRKGTPYAAQIAAETAAKTAMEDGLKGVEVRVKGPGSGREAAIRSLQA
FT                   AGLEINAIKDITPIPHNGCRPPKRRRV"
FT   gene            233365..233994
FT                   /locus_tag="Nther_0222"
FT   CDS_pept        233365..233994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0222"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: pth:PTH_0347 ribosomal protein S4 and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83821"
FT                   /db_xref="GOA:B2A4P9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4P9"
FT                   /protein_id="ACB83821.1"
FT                   /translation="MARYQGPVCRLCRREGTKLFLKGERCYTDKCAIDKKAYAPGQHGP
FT                   TRRSKQSEYGMQLREKQKARRIYGVLENQFRRYFREADRKKGITGQTLLRLLETRLDNV
FT                   VYRMGFAASRAEARQFVNHGHIMVNGKRVNVASYEVKPGDEVVVREKSRDIPRVQELKE
FT                   LAEGYRVPEWLEADHENFTGRVVRYPEREEIDVPVEEHLIVELYSR"
FT   gene            234043..234990
FT                   /locus_tag="Nther_0223"
FT   CDS_pept        234043..234990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0223"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: gka:GK0133 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase alpha subunit domain protein; RNA
FT                   polymerase dimerisation; RNA polymerase insert; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83822"
FT                   /db_xref="GOA:B2A4Q0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4Q0"
FT                   /protein_id="ACB83822.1"
FT                   /translation="MIEIEKPQIECHEMNEESTYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSVKIDGVLHEFSSIPGVVEDTTEIVLNLKRLALKIHSDENQVLTLEKEGK
FT                   GPVTAGDIQAGSDVDVINPELHIATLSEDTRLYMEITAKNGRGYVRAERNKEPEQPIGL
FT                   IPVDSVFTPVTKANFYVDDTRVGQVTDYDRLTLEVWTDGSLKPDEAVSMSAKIMQEHLD
FT                   LFINLTEKATDMEVMVEKEEDNKEKIMELSIDELDLSVRSYNCLKRAGINTIGELTQKT
FT                   PEDMMKVRNLGKKSLEEVKNKLTELGLSLKDSKE"
FT   gene            235004..235345
FT                   /locus_tag="Nther_0224"
FT   CDS_pept        235004..235345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0224"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: tte:TTE2262
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83823"
FT                   /db_xref="GOA:B2A4Q1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4Q1"
FT                   /protein_id="ACB83823.1"
FT                   /translation="MSYKKLKRNKDQRKALLKNLTTAFLRDEKIETTEAKAKEVSRLAE
FT                   KMITLAKKNTLASRRQALSYLTDEDVVTKLFENIGPKFQERQGGYTRVLKKGPRQGDGA
FT                   PMAILELVE"
FT   gene            235445..236293
FT                   /locus_tag="Nther_0225"
FT   CDS_pept        235445..236293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0225"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tte:TTE2261 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83824"
FT                   /db_xref="GOA:B2A4Q2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Q2"
FT                   /protein_id="ACB83824.1"
FT                   /translation="MEKKEKAKQLIELQNVKFSYSQDDDPGQEALKDISLGISRGEFLA
FT                   VIGKNGSGKSTLAKLLNGLLLPSQGRVLVDNLDTSISDQIWHIRQKAGMVFQNPDNQIV
FT                   ATTVEEDVAFGLENLGVSPDLMKARIAEALKIVGMEQYRDYPPHLLSGGQKQRVAISGI
FT                   IAMRPEVLILDEPTAMLDPRGRNEVVKTVLKLNQEEKITVVYVTHFMEEVVKADRVIIM
FT                   DEGQIKYTGTPEEIFSLVDELKETGLEAPQIVELCHELRKEGVEIPNNVLTVESLVRML
FT                   C"
FT   gene            236287..237159
FT                   /locus_tag="Nther_0226"
FT   CDS_pept        236287..237159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0226"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ctc:CTC02575 cobalt transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83825"
FT                   /db_xref="GOA:B2A4Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Q3"
FT                   /protein_id="ACB83825.1"
FT                   /translation="MLIKTDNLSYVYSPGTPMEQKALHDINLTIEKGEFTGIIGHTGSG
FT                   KSTLIQHFNALLYPTAGRVLIDGIDTAQNKNKLKDIRQKVGLVFQYPEHQLFEETVAED
FT                   IAFGPKNLNLSEQEVEERIKSAMETVALPYEEFKDRSPFELSGGQMRRVAIAGVLAMRP
FT                   EVLIMDEPTAGLDPQGRRAILDQIRSFHKELGLTIILVTHSMEDVARLAERLIVMHQGK
FT                   IHLDNSPGEIFMKADTLESLGLGVPEVTSLMQTLQKQGYKVPADVFTLERAKQELLPLL
FT                   QRKWDDGDV"
FT   gene            237152..237949
FT                   /locus_tag="Nther_0227"
FT   CDS_pept        237152..237949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0227"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: ctc:CTC02574
FT                   cobalt transport protein cbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83826"
FT                   /db_xref="GOA:B2A4Q4"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Q4"
FT                   /protein_id="ACB83826.1"
FT                   /translation="MFKGVTIGQYLPGESLLHKLDPRVKIILIIFFIAGLFLVNTFVGY
FT                   GVMGAFVLTTIFGNGLPIKLILKGLRPIFFIITFTFILHSLMTTGGDVLFSIAFLTVES
FT                   EGVYTGAFMAVRLVLLVLTTSLLTLTTSPIALTDAIEHLLSPFKKIGVPAHELAMMMTI
FT                   ALRFIPTLMEETDKIMKAQKARGADFESGSLWDRAKNLVPLLVPLFISAFKRADELALA
FT                   MESRCYRGGEGRTRFKQLQTQIRDYFAIIILVTLMAFILYSGI"
FT   gene            237962..238723
FT                   /locus_tag="Nther_0228"
FT   CDS_pept        237962..238723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0228"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: drm:Dred_0255 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83827"
FT                   /db_xref="GOA:B2A4Q5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4Q5"
FT                   /protein_id="ACB83827.1"
FT                   /translation="MDNIKLTIAYDGSNYHGYQLQENAVTVQEKLEKALNTVYYPYKIT
FT                   PYSASRTDSGVHAKGQVANFFAPKQIPIHKIPLALNTNLPNDIAIINAEVVGSNFRARR
FT                   DAIKKEYRYYVYHAPYMDPFWRNYALHYREQNLDYTKLQQAANDFIGKHDFSPFRAIQG
FT                   SNPSIDPVKEIYEFDIDVNAGEDGNLIIFKVIGNAFLYKMVRILVGTLLQIGNGKLEIN
FT                   AVKKALQTGDRLFVGPTASPQGLVLQQIWYP"
FT   gene            238832..239263
FT                   /locus_tag="Nther_0229"
FT   CDS_pept        238832..239263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0229"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13; KEGG: chy:CHY_2274 50S
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83828"
FT                   /db_xref="GOA:B2A4Q6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4Q6"
FT                   /protein_id="ACB83828.1"
FT                   /translation="MRTTYMAKPHEVERKWYTIDATNKPLGRLASEIAEILRGKHKPTF
FT                   TPHVDTGDYVIVLNAEKVLLTGKKRTQKHHYRHSGYPGGLKAINYETLLNTKPEKAIEL
FT                   AVKGMLPKNRLGRKMIKKLKVYAGDEHPHQAQQPEPWEG"
FT   gene            239329..239727
FT                   /locus_tag="Nther_0230"
FT   CDS_pept        239329..239727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0230"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: cth:Cthe_1782 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83829"
FT                   /db_xref="GOA:B2A4Q7"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4Q7"
FT                   /protein_id="ACB83829.1"
FT                   /translation="MAVAKVQYFGTGRRKTSVARVRLVPGNGKIVVNNKAMDDYFGLET
FT                   LKAIIKQPLQTVEMEDKFDVLVNVRGGGHSGQAEAIRHGIARALVKADGELRPVLKKEG
FT                   YLTRDPRMKERKKYGLRKARRAPQFSKR"
FT   gene            complement(239828..240346)
FT                   /locus_tag="Nther_0231"
FT   CDS_pept        complement(239828..240346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0231"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: cba:CLB_0573
FT                   chromate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83830"
FT                   /db_xref="GOA:B2A4Q8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Q8"
FT                   /protein_id="ACB83830.1"
FT                   /translation="MLLLDLFITFVKIGLFSFGGGYVMIPLIREEIINTKGWLSETVFL
FT                   DVIAIAEMTPGPIAINSATFVGFQVAGFWGAVVSTLGVITPSIILILISAKFLQKYYHK
FT                   VQIKNFFAGVRPAVIGLILSAGIVIAQSAVVDLKGLFIAVLVLIIMIVKQPHPILMILV
FT                   SGVLGLILY"
FT   gene            complement(240346..240810)
FT                   /locus_tag="Nther_0232"
FT   CDS_pept        complement(240346..240810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0232"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: cno:NT01CX_0484
FT                   chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83831"
FT                   /db_xref="GOA:B2A4Q9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Q9"
FT                   /protein_id="ACB83831.1"
FT                   /translation="MLPLIKREIVEKNSWLDEQEFLNTIAITQSIPGALAVNTAIYIGY
FT                   NIRGYKGAISSLLGVILPSFLIILTIVSFLFRWQDHHVVERVFQGIRPGVVGLIIAAVY
FT                   KIGKPLLAKNKVAIPIFILALGLALLGVHPIILILSFGLIGVLVYRKGES"
FT   gene            241113..241916
FT                   /locus_tag="Nther_0233"
FT   CDS_pept        241113..241916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0233"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   gtn:GTNG_0140 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83832"
FT                   /db_xref="GOA:B2A4R0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R0"
FT                   /protein_id="ACB83832.1"
FT                   /translation="MILIMDKNKLVKYVKYSAIICLLILTAIIGFKFLNSRTEVQHGKE
FT                   INISTDDYTEPFETIENVELPLQGLVIGVDPGHGSYDPGFFTEGVRESDIVLDISLKLR
FT                   RLLEQGGAEVVMTRETDELMVENDNGTQREELRKRSKLFLNQDVDLYVSIHGNTVASPI
FT                   WRGAQTFFYPEETEEAEENDNKCKNFNLAICIQDELQRVLANTDRPVRIGNYYILRELS
FT                   KPGVLVEVGFLSNPHERKLLQDEEYQELIAWSIYLGIIKYHHTDM"
FT   gene            complement(241990..243297)
FT                   /locus_tag="Nther_0234"
FT   CDS_pept        complement(241990..243297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0234"
FT                   /product="GTPase-like protein"
FT                   /note="KEGG: tme:Tmel_1815 GTPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83833"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R1"
FT                   /protein_id="ACB83833.1"
FT                   /translation="MTKKVLIMGAAGRDFHNYNVYFRDNDDYEVVAMTATQIPNIEGRK
FT                   YPPELAGDKYPNGIDIYAEEELTNLISKHNIDEVVFSYSDVPHEYVMNKASEVNSAGAD
FT                   FKLMGPNTTMLESEKPVISICAVRTGIGKSQTTRRVCDLLREKGKQVVVIRHPMPYGDL
FT                   AKQTCQRFADYDDLDKHECTIEEREEYEPHIDRGIIVYAGVDYEKILKEAEKEADVIIW
FT                   DGGNNDIPFYKPDLHMVLVDPHRPGHELKYYPGESNLRMADVAIVNKIDSASNEGVQEV
FT                   RHNIEKLAPNATVVEGVSPVFPSDIDQIKDKRVLVVEDGPTLTHGEMTYGAGTLAAQKF
FT                   GAKEIVDPRPFAVGSIKETFETYTHLGNLLPAMGYGREQMKELEDTINKTECDTVILGT
FT                   PIDLRRVANIERPAVRIRYELQEMGIPTLEDILKDF"
FT   gene            243753..245036
FT                   /locus_tag="Nther_0235"
FT   CDS_pept        243753..245036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0235"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: drm:Dred_2829
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83834"
FT                   /db_xref="GOA:B2A2R8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B2A2R8"
FT                   /protein_id="ACB83834.1"
FT                   /translation="MKYTQNERINQVKESSLIIGVDIAKAEHVARAQDFRGVEFSKPIT
FT                   FENTRKGFKKFLSWLEVIKQEQAKEEVLVGMEPTGQYWLTLAQFLKQTGIQTILVNPNH
FT                   VKKSKELDDNSPTKNDIKDAKVIAQLVKDGRYSVPNIPTGIYAELRNGMNLRDRLTDDL
FT                   RRVKGRIDNWLDRYFPEFSTVFKNWDGKAALLTLKNFPLPKEILGHSEEEIVSCWKREV
FT                   NRAVGKKRARKLKEAAKNSTGITEGEIMARQELKTLLSQYDALIEELEQVLVQIENILK
FT                   EIPGAEEMMSIPGVGMVTVAGFLAEVGDLSNYQHPNQIKKLAGLNLKENSSGKHKGETK
FT                   ITKRGRPRLRGLLYRCVIPLVAKNPEFKLLHDYYTTRPENPLKKKQSLVALACRLIRVL
FT                   FALGTKKTPYNGRMMLKNSSLNLLQDAA"
FT   gene            245424..246317
FT                   /locus_tag="Nther_0236"
FT   CDS_pept        245424..246317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0236"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: bha:BH2984
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83835"
FT                   /db_xref="GOA:B2A4R3"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R3"
FT                   /protein_id="ACB83835.1"
FT                   /translation="MNTSIIGVPMDLGANRRGVDMGPSAIRYADLRAKLEEIGIDAKDK
FT                   GNISVPLPEIDSMEAEEIKYPKQIEAVTNSLALQVSKEASQNRIPIILGGDHSIAIGSI
FT                   AGMKQAVGELGVLWFDAHADLNTFETSPSGNIHGMPLAFSLGYGNSNLVNCLEKGQKIK
FT                   PENTVLIGTRSIDEPEKELIEKSGVTVFTMYDLDKMGMNRVMEEALSIVTSNTDGVHVS
FT                   LDMDALDPVEAPGVGTPVRGGINYREVHLAMELIAEAQCINSMEVVEVNPILDSVNRTG
FT                   DLAVELVASALGERVL"
FT   gene            246356..247162
FT                   /locus_tag="Nther_0237"
FT   CDS_pept        246356..247162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0237"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: mta:Moth_2295 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83836"
FT                   /db_xref="GOA:B2A4R4"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R4"
FT                   /protein_id="ACB83836.1"
FT                   /translation="MLKWAIFSPHPPLLIPEIGKQMLSQVEKTKNSLEQVFAKVHNVDT
FT                   IIVITPHGFASENAITCYQTDMLNGALTDFSGGCPVIELTVDQDLNEMINQTADNQNID
FT                   VNWITKNSLKFSEELLDHGSYVPLYYALKNLTSTPRIVVINPGFVTIDALWQFGEALQS
FT                   QLADTKKDIGLIISGDLSHRLTQGAPAGYHPEAYKFDQEIKDIIEQGPLSRLKKLSSQL
FT                   LSTAGECGYRPLILGSGMLDNLNLSDKQVLSYEGPFGVGYLVARLF"
FT   gene            247183..247725
FT                   /locus_tag="Nther_0238"
FT   CDS_pept        247183..247725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0238"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: tle:Tlet_0435
FT                   AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83837"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R5"
FT                   /protein_id="ACB83837.1"
FT                   /translation="MSSNKESQLALYLAREGLKHYLRYEKYLEPPEEMPPLFYTKRGTF
FT                   VSLKEKDDNLRGCIGTLEATQNNLAQEIIQNAVSAGVRDPRFPPVKLTELDDIKVSVDI
FT                   ISPLEKVSGLDQLDPSKYGLVVEKGYRRGVLLPDLEGINTPKEQLAISAQKAGLSPSDS
FT                   NLTLYRFEVTRFHETAS"
FT   gene            247709..248785
FT                   /locus_tag="Nther_0239"
FT   CDS_pept        247709..248785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0239"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   tle:Tlet_0436 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83838"
FT                   /db_xref="GOA:B2A4R6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R6"
FT                   /protein_id="ACB83838.1"
FT                   /translation="MKLPHNLFRDKKGEFVNCHLCFRRCLLKEGELGFCGNRKAVKNLQ
FT                   GELQPVFRTVKRIEALNIDPIEKKPLYHFYPGKNVISLGLRGCNMKCFYCQNYQLSQDK
FT                   NFDFKEVGEIKKDLEIEKEENPPLVEQTKSLLKESGEKQSSGAIGVAFTYSEPITWFEF
FT                   LYPVAKNTKKEGFVNVLVSNGMVTEEVRSELSPLLDGANIDVKSFSEENYRHLGGSLTA
FT                   VKSTVEDLHASGIHVELTYLIVPEFNDKDQEIKSFLKWVSEVSPDIPVHFSRYFPSYQA
FT                   QASPTPVEKMIEVYNIAKQYINYVYLGNLGQEKYQSTYCPECEGVVIRRSVFAVSNKLK
FT                   GDECPYCQYKIAGCFIYY"
FT   gene            248942..249760
FT                   /locus_tag="Nther_0240"
FT   CDS_pept        248942..249760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0240"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   mta:Moth_2248 protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83839"
FT                   /db_xref="GOA:B2A4R7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R7"
FT                   /protein_id="ACB83839.1"
FT                   /translation="MWEGLTNLFAQITFIDIFDISLVAFLFYRLTLLIRGTRAIQLLKG
FT                   LFVLLIAMVLSDRMQLTTINFLLEQAMTVGIVAIPIVFQPELRRALEQLGRGKFFGDGL
FT                   FSGDEDRTQAIKELKKAAKVLQTRKIGALIVIERKTGLSDITETGIQINGKISAELIIN
FT                   VFMPLSPLHDGALVLRENHVKAAGCYLPLTEKPDLSKELGTRHRAAIGITENSDAISLI
FT                   ISEETGAISLAEGGKLTRYLDEDELESLLIKLWGGHEHQSKSFWQWRLGN"
FT   gene            249757..251004
FT                   /locus_tag="Nther_0241"
FT   CDS_pept        249757..251004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0241"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: amt:Amet_4312 YbbR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83840"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4R8"
FT                   /protein_id="ACB83840.1"
FT                   /translation="MKQLFSQNGLLKLLSIALALLLWMFVSTDADDMATREISRRYDGI
FT                   QPSVRNQDPDLILVGDPQTVSASLRGTRTMLNRVEKDELVFYVDLEGLEAGTHRVPVSS
FT                   SVPQFDVTDIQPSEVEITLDERIEETFAVDHDVIGTPDEGLQALEPEINPSTVTISGAK
FT                   TYIEQVERVVARVDITGTVDYLEKGIVVDIYDENGEIMEELEVSPGMVEVKIPMNYPEK
FT                   EVPVEVDIEDNLPEFYLESVEISPEQVEVGGWESVINELEYIKTETIGLDRFLEEETVV
FT                   ASLERPEGIKEISDQNVIVEGQISQTQEESFEIPVDLPEELANELANSQWEIEPEIITV
FT                   SVAGEPEDMTALDKNDIEVYLTMDDVPEEDLETVEESEAVEELVEELDVEVQLQNDNLR
FT                   LVKVDPLKVNLIKGEE"
FT   sig_peptide     249757..249849
FT                   /locus_tag="Nther_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.965 at
FT                   residue 31"
FT   gene            251102..252430
FT                   /locus_tag="Nther_0242"
FT   CDS_pept        251102..252430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0242"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: tte:TTE2191 phosphomannomutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83841"
FT                   /db_xref="GOA:B2A4R9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4R9"
FT                   /protein_id="ACB83841.1"
FT                   /translation="MPKLFGTDGVRGVANEDLTPELCLKIGRAAGEYLKSYGDTVLVGR
FT                   DTRLSGTMLEAALSAGLASVGLKVERLGIVTTPAVAFLASREDVAGGAMISASHNPVPD
FT                   NGVKFFDNKGYKLAESHEEQIENYLEKELSRPTGTDIGKVLPENNKLIENYIQELIDKY
FT                   PLDLSNYKIVLDCAYGATYQIAPRLFKKLGAEIIPLHAENRGEKINVECGSTNPELTSR
FT                   TVVEEGADLGFSFDGDGDRIIALDEEGNQVNGDKIMAILAKDMKSRGELKNDKLIATVM
FT                   SNLGLKLALKELGIALEETKVGDRNVLNRMREQDCVLGGEQSGHIINLQDNTTGDGVLT
FT                   GLKLMKVLIDTGQSLKQLASIMEELPQLLVNVKVSNKDSAINSQKVQEEKSKVEKQLGS
FT                   KGRVLIRPSGTEPVIRVMVEGENRETLHEVANHLTQVIKKAAE"
FT   gene            complement(252508..253569)
FT                   /locus_tag="Nther_0243"
FT   CDS_pept        complement(252508..253569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0243"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: cpr:CPR_0784
FT                   ISCpe7, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83842"
FT                   /db_xref="GOA:B2A0U4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A0U4"
FT                   /protein_id="ACB83842.1"
FT                   /translation="MTKVVCPRCNNNCSDKFYRFGFDNHGHQKYQCQECFSQFAPKTLS
FT                   KGGDKRGPNKPRKYPSCPKCGKATFLHHDYEFYSNLRCWDKSCNHSFYVPKPQSIPEPS
FT                   QLDIDGKVDFSNMRHSLHTVIRALYLYFINGSSTRGVSQFLIDCEGIKVSHVTIADWTK
FT                   KFAPLFLYISRYLKPIDLDSSDEWHVDETVIKIKGKRFYAWTVIDAETRFVLAFHLSPY
FT                   RDSQAAFKVLNYAKKHFGQPHSIVTDRYWAYNAPIKVLFPNSNHIRVESFQDDISNNLI
FT                   ESFFQIFKSWVKQRRGFASFQSANKLIAVFVFAFNFVRTSNVLNQSTPAQVAGINYSNR
FT                   NRTFWLLHSNNAA"
FT   misc_binding    253764..253942
FT                   /bound_moiety="glucosamine-6-phosphate"
FT                   /note="glmS glucosamine-6-phosphate activated ribozyme as
FT                   predicted by Rfam (RF00234), score 97.01"
FT   gene            253996..255819
FT                   /locus_tag="Nther_0244"
FT   CDS_pept        253996..255819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0244"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   chy:CHY_2010 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83843"
FT                   /db_xref="GOA:B2A4S1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S1"
FT                   /protein_id="ACB83843.1"
FT                   /translation="MCGIVGYIGDKLAIDELIKGLKKLEYRGYDSAGVAIVEKDDLKTI
FT                   KTKGRLTDLEERIDTQFTSTEGIGHTRWATHGKPSEDNSHPHSDCFGNIAVVHNGIIEN
FT                   FQHLKAELQNKGHKFTSQTDTEVIAHLLEEYYQDDLLECVFKVIERLEGSYALAIMHKN
FT                   EPGKIICARKDSPLIVGQGEGENVVASDIPAILDYTREALILDDGEVALVEKDNITLYN
FT                   SDKKEIEKEPLQINWDAEEAEKGGYDHFMLKEIHEQPKAVRETIRGRIKDGQVNFEELK
FT                   YLNYDKISQLNSVKIVACGTAYHAGLVGKTMIESLANIPVEVDIASEFRYRDPLIKNDD
FT                   LVIVISQSGETADTLAALRESQKRGAKVLAITNVVGSSVSREADEVIYTWAGPEIAVAS
FT                   TKAYVTQLVVFSLLSIYFAQAKATIEEERQKKLVQALSNLSQYIEAIFKEEQQIEETAR
FT                   SISKQENVFFIGRALDWAVAEEGALKLKEISYIHAEAYAAGELKHGTLALIVDDVPVIS
FT                   LVTQPHVYDKMLSNLQEVKARGGNCIAVAFENDREIENEVNHVLRIPEIDPLFSPIISV
FT                   VPLQLLSYYAAVARGTDVDKPRNLAKSVTVE"
FT   gene            255977..256807
FT                   /locus_tag="Nther_0245"
FT   CDS_pept        255977..256807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0245"
FT                   /product="TnsA endonuclease"
FT                   /note="PFAM: TnsA endonuclease; KEGG: bca:BCE_0174 Tn7-like
FT                   transposition protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83844"
FT                   /db_xref="GOA:B2A4S2"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S2"
FT                   /protein_id="ACB83844.1"
FT                   /translation="MSNRVRYPNKVDTYHEIPRREKYKPFIAIRNVPSLGRSSRILGIK
FT                   TNRQHEFLSDLERNYYHILEFSDHVIDIREQFPLQLERTLLIADELGVKHPIHPKTKDP
FT                   VHITSDFNITIKEDKKAKDLVRTIKRKDDLLDKRTIEKFEIEKRYWDVLNIDWGIVTEK
FT                   EIDKTLALNIADVMHYYSFDSLEFYQIIGEEEVKSLIVTFIQRLIDTDKTVREVSTVFE
FT                   RDFQLGKGVGITLFKHLIARKYIKVDLFEPLNLDRPHLRVDLTNKSKVLGEDVS"
FT   gene            256804..258957
FT                   /locus_tag="Nther_0246"
FT   CDS_pept        256804..258957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0246"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   cth:Cthe_1116 HMG-I and HMG-Y, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83845"
FT                   /db_xref="GOA:B2A4S3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S3"
FT                   /protein_id="ACB83845.1"
FT                   /translation="MIFVNAVYQFVDKNERIRIIYVSTEEELCAYVYIEKELSVPIIEE
FT                   VSVVKEEIDSDNLIEITDPYSVLIEEDNLTETQINKREERWAIIEQYWEPQKEKLLNKS
FT                   TRMKKFKEISQLHNISLMRVRRMFSQFWQRGMTPNACLPDYKNSGAPGREKNFIKKTGR
FT                   PRNITNKEFSLGINVDDKVKKQFEVSINKYYRTKQKKSLREVYSQMLEDFYSVTIKEQG
FT                   ETKRILRDPSNVPTYEQFYYWFKKAENPGVDFVKREGQKDYELTKRPITGTTKQEAPGP
FT                   GFRFQIDATPSDIYIVSETDRSKVVGRATIYAIVDVFSRMITGIYVGLETNSWNGAMMS
FT                   LDSMVANKSELCADYGVPLDEELWPSSHLPEAIIADRGEMLGHGVENLINNFKVAVENT
FT                   SPYRADLKPIVERLFRTINEKIKGFLPGAVMKDTRKRGDPDYRLDAKLTLKEIRRIILL
FT                   SVIDHNWSPIEHYQLSPEMVKDNVRPIPLELWNWGIENQKGCLRKVDRLDFRLGILPRA
FT                   KATFSRGTVTFHKLKYGASELLENYNHMKLTDTKVDIVYDPRKIDNIYMIRNDSKPILL
FT                   NLLDQSRGFAGLSLEEVIEINKKASTLKKSADDERLKNRITLNQEINTIAKKATKKTNE
FT                   ESNISTSKSKRLKDINKNRSEEKAIQKKEETLIQREENEDPAEIVSIEEELKEPNNGSE
FT                   GSKSGNSEVYDLIRRRRDERRKK"
FT   gene            258938..260626
FT                   /locus_tag="Nther_0247"
FT   CDS_pept        258938..260626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0247"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cth:Cthe_1115 Tn7-like
FT                   transposition protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83846"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S4"
FT                   /protein_id="ACB83846.1"
FT                   /translation="MSVEKNRTVDVFEYKTAHYTPQKIKDYAGNPLIEALPPILETDEE
FT                   VIDMLYSLPSIDDHERNLSPLLKTHVIKRVKRFIQPLPIHINLESKISVLIRQSYLSRN
FT                   PLTPEYKKRIKLLHTLKKEEEITPDEVESHYRSYSSTAECLFINGVSGMGKTTAVNRIL
FT                   EQYPQIIKHTEYKGQKITTTQIVWLKIDSPYDGSFMTLCRNIFQEIDKLLGTRWMEKYG
FT                   YFTRSTSTMVMYLTTLLANYNVGLLVIDEIQNIYRAKKNDPMEMLDYFVTLTNVISVPI
FT                   LIIGTNRARNLFQDNFRLARRVQSDGYIEIANLKKDSPDWEIFIESLWEFNVLENQGPL
FT                   TDELNDTFYELCQGVIAVAVMLLMFSQNRAISEGKKSLTTDIIKKTYKEDLQLIRPMIE
FT                   ALRSGDPFEIAKFDDITIDEEKILSNYHKDIAMTESVQAAIRQKKDKIESTRESINEKL
FT                   FFEFSASGFFNDIKQEVMKKIINKVVESSDVATEYEDLKELVMELLQKEKRKVKKKPRR
FT                   KNINPDNVTLISLYDSAIDKSQHPYDAFKREKLIKDPLDEFLRVD"
FT   gene            260631..262523
FT                   /locus_tag="Nther_0248"
FT   CDS_pept        260631..262523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0248"
FT                   /product="Tn7-like transposition protein D"
FT                   /note="KEGG: cth:Cthe_1114 Tn7-like transposition protein
FT                   D"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83847"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="InterPro:IPR032750"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S5"
FT                   /protein_id="ACB83847.1"
FT                   /translation="MLTFFTDPYKDELLYSAFARYHFLSGNIDLKDTLRELFGKDSVIP
FT                   NFELGSNLNVLCQKIGTHYNAMELIKKHTVFPYYSPFLPEQRKQEIINNICTSDAVGIF
FT                   NKIGIIAGSISGKEGIWYCPDCAGNDLKEFGEVYIHREHQLQGIWLCPHHDCFLLRYPF
FT                   DKTNTSRIEYIKLNDDLMLKDCNRAEDTDLHSKHKLVSKAAYFLLNNDLSEANKDTILK
FT                   RYKSLLFDRDLANTNLRVRQKDLHNSLVGYFGEHFLNVLQSLPDENDEYNWLRVATRNV
FT                   KRTVPPLRHILLITFLTDGHIERFFDDIKVENKPFGGGPWPCLNTASNHYKKNVINEVT
FT                   VAADYKTRKPVGTFECSCGFTYSRRGPDKSNSDKYRIGRIKNFGPIWEGRLRYLLEQGS
FT                   LSQNAIAKELNCASGTVKKYKQKLFSEGRSTSKSNDIMKKTKSYGRNLLEKYKGLIENC
FT                   VCSKKLSRTEIRTQFSKEYTYLYRHDRDWLFATMPPAKKPVAIPNNRVNWQERDEKLLE
FT                   AYKKAYSKLLNLDEPIRITKTRLGRETGTLSLIQNNSNKLPLSTAYLESISETKQAFQI
FT                   RRCTNIIENKIKEGLPVRLWEMQREAGLNKEDFKKLKPELERIIDSIKGAIRSE"
FT   gene            262516..264039
FT                   /locus_tag="Nther_0249"
FT   CDS_pept        262516..264039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83848"
FT                   /db_xref="InterPro:IPR041419"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S6"
FT                   /protein_id="ACB83848.1"
FT                   /translation="MSKPRIRTKDWPFAKNVKARLMRISKPYKKENRWYIDALFYSHKT
FT                   KRVRLDIARLLRLHLGGTYKDGEFIGFESAIEMDISIPNSVIKNRKITPFLNKDKYNKE
FT                   FDYYTFGIPYKDHFIVIPIIELVRAVLLPDTFWMNQVTQLDALDTSFVSSMSSEVLQVQ
FT                   FDPSINVSYVKLNEKINHLAWIMTNSNIFNMIAELYNNVSNGQGFLFDFGFTSLNMQVM
FT                   AEQVGNKIFVKQIKSFRGKKIKTQKIEVSHPKLYKNSPSNETRDQYHKTIKISGDDKVL
FT                   DASKDGSYKDQDIVDENISKSEYTNYVKITRNKIPKKSKKPIETVETAKLYKEDSNSRT
FT                   TSDLGGKEVVPQLEFLNNFQFLNINDFDEINQVLDLINERGNVVSVQRLVGKLKDHWSY
FT                   GSFCDLKDGKKERRYLLGKITLSNGTEAVLIEIEREDRALTTLMLVSEKTANWNKICHV
FT                   VLKGLVKNSGSWSAEVINKIKTTYGIREHRFKHTRTDIHKKEKRIFSFI"
FT   gene            264590..266428
FT                   /locus_tag="Nther_0250"
FT   CDS_pept        264590..266428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0250"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mxa:MXAN_0168 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83849"
FT                   /db_xref="GOA:B2A4S7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S7"
FT                   /protein_id="ACB83849.1"
FT                   /translation="MLRSIRIKILGVIALLLIVLAINSSWAVNNFQMLDDSIEAIMQAN
FT                   YRSVDAAQNMIVALERQDSAILTYLFEEDEDISQTFREHEREFMKWFTLADDNITEVDE
FT                   PEIIENIDNSYAEFALEFNKLQNIQVEEGTDAARQHYYDQVFPKFEDAKDFTRRLLELN
FT                   QNKMLELQGQAETRASNATKTTAIISILTVVTGTVLALYISGKITRPIRDLTKKMEKVS
FT                   QGDYQQQLDIQGNDEIVKLADSFNTMAKQLNEYTKMNVSKLKREKQKAEAIVQSIGDGI
FT                   IVTNEDNKIILVNKAAEDVFDIREKEVIDTHFLEALNNQEIFDLIKKSKDESQLYYKSY
FT                   TDISMIKDGDTNYYRIIVNPIKAKDSKTMGVITLIQDITKLKKVDELKSQFVSTVSHEF
FT                   RTPLTSINMSIGLLLDKIPGDINDDQKELLQVIQEDSERLNRLVNELLDLSRIESGKMQ
FT                   MDFDYYDIKNIIQHAVKPLRIQAEEKNIQIKINVSDNLPKVRADHTKIGWVVSNLVGNA
FT                   LRYTPTDGTGVINIETKQTANKIVTSVTDNGSGISEEYQKIIFDKFLQVNGGESTQGGA
FT                   GLGLAISREIVRAHGGDMWVDSELGEGSTFYFTLNM"
FT   sig_peptide     264590..264673
FT                   /locus_tag="Nther_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            266468..266848
FT                   /locus_tag="Nther_0251"
FT   CDS_pept        266468..266848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0251"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pth:PTH_1670 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83850"
FT                   /db_xref="GOA:B2A4S8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S8"
FT                   /protein_id="ACB83850.1"
FT                   /translation="MPKILVIEDEKNIVIPLKLYLQKQGFEVLVATNGVDGVSLAQEEK
FT                   PDVILLDIILPKMNGYLVCEALKENEETKHIPIIFITAKSNETEIEKALAMGGDDYLIK
FT                   PFTHTKLYEVIKKYLKEENSHE"
FT   gene            266841..267560
FT                   /locus_tag="Nther_0252"
FT   CDS_pept        266841..267560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0252"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Tetratricopeptide
FT                   TPR_2 repeat protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: aoe:Clos_1079 two component, sigma54
FT                   specific, transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83851"
FT                   /db_xref="GOA:B2A4S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4S9"
FT                   /protein_id="ACB83851.1"
FT                   /translation="MNKKLLIVDDEKNIRMTLKNCLSYEGYELEIALNGEEALEKLRTQ
FT                   DYDLVLLDLKLPGLNGLQVLEKVRDEGRDVKVIMMTAYGTVERAVNAMKLGAIDFINKP
FT                   FSPNQIRALVNDVLSRPNLSEENLQTYKDHVEFAKKCIIESNYTEAEKHLTKALEKDYD
FT                   KPEPNNLLGVLAEYNGELGKARKHYRAALALDPSYKPANTNLERVTRFKYTKDGITFGN
FT                   EEEKGEEEQGEDKNEEQ"
FT   gene            267547..267963
FT                   /locus_tag="Nther_0253"
FT   CDS_pept        267547..267963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0253"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: tle:Tlet_0894
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83852"
FT                   /db_xref="GOA:B2A4T0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T0"
FT                   /protein_id="ACB83852.1"
FT                   /translation="MKNSNDYIIIVGCGRLGSSLANNLSISNKSVVVIDWKEKAFNNLS
FT                   EEFSGFTMEANVIEKETLMNAKADQADVLVAVTNDDNTNIMVAEIAKSIYEIPNVIARL
FT                   YDPARKRTYEELDIKTISSYDLVSKAFTDLILSK"
FT   gene            267999..268664
FT                   /locus_tag="Nther_0254"
FT   CDS_pept        267999..268664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0254"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: tma:TM1088 trk system potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83853"
FT                   /db_xref="GOA:B2A4T1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T1"
FT                   /protein_id="ACB83853.1"
FT                   /translation="MKIILVGGGNKVHYLAKTFISQGHELTLINNEKEYCRDLAKRFDV
FT                   NIVYGDGTKPNILEDAEVLTADLVMAVTPKDPDNLVICQLANKVYEVDKTFAIVNDPDN
FT                   IEIFKKLGVDTVISTADIITSLIKQKISVEDISNIFSLEEGKVTVMEVKISSNFPVTGQ
FT                   KLQDIPLPRQSIIGCIIRNSESIVPSGDTAIEVGDKLLILSLPEVQSKVLQTIRGRLD"
FT   gene            268657..270150
FT                   /locus_tag="Nther_0255"
FT   CDS_pept        268657..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0255"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: tpt:Tpet_1654
FT                   potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83854"
FT                   /db_xref="GOA:B2A4T2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T2"
FT                   /protein_id="ACB83854.1"
FT                   /translation="MISMKYKEILIRKYNYIIGYIGVILLGLSIALLLPLIFLFIFGEE
FT                   SILVRSFLIPAVFSALLGFIMSTPIRKGNNDSHLTLHEGGVIVVLSWLMVTFISAFPFL
FT                   LSGELNFTQALFESVSGWTTTGLSVVDESEIANTLIFWRSLMQYLGGAGIAVTLLAAII
FT                   GPSGGMGLYSAEGRSDKLLPNVFKSIKLIIIIYLGYTFSGIILYMIVGMPWFDSIIHSF
FT                   SALSTGGFSSRPESIGAFDSLAIELVTIILMILGTTNFAAHHVFLRGKIKEFFKIGEIK
FT                   FMFILMGITIPVVIFVALFPLYGNFAESLRFGTFELISSITTTGYSTGVDYDSWGSFAV
FT                   FVIIVLMIFGGGAGSTAGGVKLIRIYVLFKSVVWHIQEHFLPKNIVRENYILKPGEKFY
FT                   VYQRHITQFANFLLLYLATYILGVLIFLAHGFQLEDSMFEFASTLGTVGLSVGLTSPDA
FT                   PLFILWTQIFGMLLGRLELYIIFFAFIRIIKDIKQLVLK"
FT   gene            complement(270364..270633)
FT                   /locus_tag="Nther_0256"
FT   CDS_pept        complement(270364..270633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0256"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bcy:Bcer98_2284 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83855"
FT                   /db_xref="GOA:B2A4T3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T3"
FT                   /protein_id="ACB83855.1"
FT                   /translation="MKMSRKKYSEDFKKTIVDLYHSGSSVKDLSSEYGVTEVTVYKWIK
FT                   QLTPVQSGEEEVTPKDINEMQKEMQRIKQESEIFKKAMAIFAKK"
FT   gene            271802..272362
FT                   /locus_tag="Nther_0257"
FT   CDS_pept        271802..272362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0257"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ckl:CKL_1679 predicted RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83856"
FT                   /db_xref="GOA:B2A4T4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T4"
FT                   /protein_id="ACB83856.1"
FT                   /translation="MIAAKGVQTKLTTEIQVQKAVKGDEDSFVNLIQSRKEKMYRIAFS
FT                   YVKNKEDALDVVQEVTYKVYISIDKLKQPEYFDTWLVKITINTAVNYIKSNNKYVYMEA
FT                   NKEVRDSRYNKDEIVEMMDLNNALDNLEQKNKEIIILKSFEDLKFKEISEILGYPLNTV
FT                   KTNFYRGLKKIKDNLEGGYNSEG"
FT   gene            272352..273278
FT                   /locus_tag="Nther_0258"
FT   CDS_pept        272352..273278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83857"
FT                   /db_xref="GOA:B2A4T5"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T5"
FT                   /protein_id="ACB83857.1"
FT                   /translation="MKVKHKLQNFKKDYHKSIDIPEEIDDYIMKGVEKGMQEKARKNFK
FT                   NKIKKISLSVAASLLLIFTVSINTMPTFANAMHDIPIAGQLVRILHFSEEHQEGGKITD
FT                   GSDVEFISLVEKDNKEHIVINFSQDIKEEEFASHYEIDYSEYPYTLNFKISGVREFSAE
FT                   DEFEKMKDGNMIQDIYRLMTLDDSMVRFSITMDKPFSYQVTEYKEPGQLVVTLEEKPES
FT                   KEESIYSIRSESYPYGEKIGILEEQLFSLDTRRMLKDEDEEFLIEVDYFTSKEKAEDKK
FT                   KGLIEEYPVISDFVIEKRGPNDIPKNY"
FT   gene            273687..274636
FT                   /pseudo
FT                   /locus_tag="Nther_0259"
FT   gene            274897..275265
FT                   /locus_tag="Nther_0260"
FT   CDS_pept        274897..275265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0260"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 4 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: csc:Csac_0456 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83858"
FT                   /db_xref="GOA:B2A4T6"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T6"
FT                   /protein_id="ACB83858.1"
FT                   /translation="MGDIELTELLVSETFYQVLSEITNLRSTNNFHTYVFTVARELILA
FT                   RCDSNSSDSKIPAYFKYFHDHKLFKSFKKLTDRQQEVIYLRFCQRLNSNEISEITDSQE
FT                   QEVKNLLYTGLKKLAKVI"
FT   gene            275420..276010
FT                   /locus_tag="Nther_0261"
FT   CDS_pept        275420..276010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_1809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83859"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T7"
FT                   /protein_id="ACB83859.1"
FT                   /translation="MIIFSVGCNDEDHDADKKINISQNTDSKYEKTFENLSLGRLFDFN
FT                   FKLPNPDESWIEIWVEGYKEGEPVEPFPLAKLSYGLGPSEEAEGNLGAGFLELDSDNPQ
FT                   IFIYSKGAQSKPVDIDNDLFSDINAKSWDYAIDDEEVGLNFGEEKVLAVYRLGKDSMRA
FT                   SYDYQDSDELDKMIKEDAVVFVMKIVVEEREDL"
FT   gene            276274..277110
FT                   /locus_tag="Nther_0262"
FT   CDS_pept        276274..277110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83860"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T8"
FT                   /protein_id="ACB83860.1"
FT                   /translation="MSNTKRLLTIFVILAITIVISSCNEQEELEIEDDLLTKSKILEVL
FT                   EEEYELEEIEAKSPVDELKEESNMIDASYQFDDLPGELFIYIFESIEERNEHFSHEFSY
FT                   TRPLEEEQGVDYSAYNAQNAAIVYRPLDQENVLGQTAQLSEIILYQLNDINETSYKGEG
FT                   ENWQVELNASYYDYELETEDENDIFGLLTYEIYYKGDNHDEVIDMMLYFPHSDGQGKAG
FT                   GGRGAGEPFLEKGEPVKLDFSGKTLPDGLGNDQTEVIIEWEEDSEQLEEVITLGKE"
FT   sig_peptide     276274..276351
FT                   /locus_tag="Nther_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.756 at
FT                   residue 26"
FT   gene            277221..277931
FT                   /locus_tag="Nther_0263"
FT   CDS_pept        277221..277931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83861"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4T9"
FT                   /protein_id="ACB83861.1"
FT                   /translation="MIKLNNKFFVSLLIFIVTASLIAIGCTETENKVSEEKKEELESEI
FT                   TDLENEIDDLETRLDEYSELPRELSFAEKAADDYTIFLEKALENLNEEEVKEVAKQGYQ
FT                   HELTIRPTGTTKNREEIPSDGRVKTALDEFSVEISEKQRAIPDIGDSFIKKAEENKLEH
FT                   SENYPSEQELLVVKTEGVDYKHGVSSSPIDRGHSFWLTFEEIEKGKTLEIEVDSQIKER
FT                   VGLKTDVLEIEVEE"
FT   sig_peptide     277221..277298
FT                   /locus_tag="Nther_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            278068..278265
FT                   /locus_tag="Nther_0264"
FT   CDS_pept        278068..278265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83862"
FT                   /db_xref="GOA:B2A4U0"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U0"
FT                   /protein_id="ACB83862.1"
FT                   /translation="MKNTKLIVLVLVVISAFLGPLLFSEIMPGGDVNTNLIWGSIIVLA
FT                   AVVSMSTSLILEKLDELKNK"
FT   sig_peptide     278068..278142
FT                   /locus_tag="Nther_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.952 at
FT                   residue 25"
FT   gene            278434..279321
FT                   /locus_tag="Nther_0265"
FT   CDS_pept        278434..279321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83863"
FT                   /db_xref="GOA:B2A4U1"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U1"
FT                   /protein_id="ACB83863.1"
FT                   /translation="MLRKSYLNEAAILIAVIVLLLIFNITYGNWNLSLMFNEKTVDLEG
FT                   EMTTSDGYLTLEPRELILDHSKVTLLVDYQVDDKLRELGFQFSDTTTPRLLLAKESDVD
FT                   RENSTLRMAKGTHPDSSEKITEDDEEYFKYEYWYQDFPYELEENLTISIDKAYMSKSHQ
FT                   EEFSVEPGDSVEVEIPGIGKYQGELGEPEKNLDDLDTITFKGETTSEHFDYGFEVRDYL
FT                   KSVIEDQEITPKQIGGSRSSGRDSSHQTIERTYRVEDSQFWEGELLFSIGRVRIPLGNR
FT                   FEAPYMDINVTGKK"
FT   sig_peptide     278434..278520
FT                   /locus_tag="Nther_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.742 at
FT                   residue 29"
FT   gene            279407..280684
FT                   /locus_tag="Nther_0266"
FT   CDS_pept        279407..280684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0266"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: drm:Dred_2829 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83864"
FT                   /db_xref="GOA:B2A4U2"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U2"
FT                   /protein_id="ACB83864.1"
FT                   /translation="MIGLWTYFKKVNAGHVFFPFGVLGSSFIVDESKKYAIQEFKKIYM
FT                   GVLSVLLLLQLSTRDPYIFGLNITSAFFVGVILRIIVTRLLVLNSQKSMEKLTLEKRKQ
FT                   ILFDQDKKDSFLVVMLSSIVLFSLSIYLLIEFGFGGTFSLVISILSTIYYLLLTDDLRR
FT                   VKGRVDNWLDRYFPEFSTVFKNWDGKAALLTLKSFPLPKEILGHSEEEIVSCWKQEVNR
FT                   AVGKKRAKKLKEAAQNSTGLTEGEIMARQELKTLLSQYDALIEELEQVLVQIENILKEI
FT                   PGAEEMMSIPGVGMVTVAGFLAEVGDLSNYQHPNQIKKLAGLNLKENSSGKHKGETKIT
FT                   KRGRPRLRGLLYRCVIPLVAKNPEFKLLHDYYTTRPENPLKKKQSLVALACRLIRVLFA
FT                   LGTKKTPYNGRMMLKNSSLNLLQDAA"
FT   gene            281218..281472
FT                   /locus_tag="Nther_0267"
FT   CDS_pept        281218..281472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83865"
FT                   /db_xref="GOA:B2A4U3"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U3"
FT                   /protein_id="ACB83865.1"
FT                   /translation="MDIRLIILLLGVLSGGSLIIFEKIKGKKLISRDRWELYSSIFFTV
FT                   LMFISSIKSFFESGALISLVFVGFFIAGIIMVVKAKQKL"
FT   gene            281732..282643
FT                   /locus_tag="Nther_0268"
FT   CDS_pept        281732..282643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0268"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: rca:Rcas_2234 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83866"
FT                   /db_xref="GOA:B2A4U4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U4"
FT                   /protein_id="ACB83866.1"
FT                   /translation="MCINNELKKYRIKFFLQEFSRNAKYIGIFSVVLTFFFDSIVFSLL
FT                   SLFAIFAIVEVVLDFSVHKAGILQYVGIIINKIKHGNKTPSISNYENEIEYSLPFKGKW
FT                   IAINGSYTKEHSHSWSIPTQRYAYDFVIIDEKGKTFENELNKNKNYYCYDKDILAPADG
FT                   EVVEVYNKAEDSIILKPGKFLSRSPHVAGNYIIIKHTENEYSTLAHLKKDSIRVNKGDK
FT                   VLRGEVIAKCGNTGNSTEPHLHFQLQGGRSFYNSIGLPIKFRDIMIETPPMEYKKIDPR
FT                   TTISKEEIIEGYITRGYIVYNN"
FT   gene            282792..284063
FT                   /locus_tag="Nther_0269"
FT   CDS_pept        282792..284063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0269"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: pho:PH1043 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83867"
FT                   /db_xref="GOA:B2A4U5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U5"
FT                   /protein_id="ACB83867.1"
FT                   /translation="MTLNLQSILHEAKEMEQEIVNFRRIFHENPELGLEEHVTSDKVME
FT                   ELKQLNLDEVIKIGTKESVIEELSLLNETIKDTHGPTGVLGVIKGQAGPGPTVLLRADM
FT                   DALVVNESTDEDHIPYSKGFSSKNDRVMHACGHDAHTAMLLGAAKILSKFKDKLSGTIK
FT                   FIFQPDEERGCGAKIMCKEGIMEDVDAVFGIHVWKTVDSGKVMIHQGPTMASVDNFWIN
FT                   INGGGGHSSSPHETKDPILASSEMVNSIYRMHDRELNSVNASLVTVEQIESKADWGVIP
FT                   SSAQLRGTIRTFSESDRNYIIKRMTDLCNVTSQFHNLECSFESLNVFPPLNNNREMAIL
FT                   AQDTVSDLLGEEKIETGDPIMSGEDFSYYLKESPGAFIFLGNYNEDKGIIHPHHNPKFD
FT                   IDEDILHKGTALYISLALKFLNNQ"
FT   gene            complement(284240..285442)
FT                   /locus_tag="Nther_0270"
FT   CDS_pept        complement(284240..285442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0270"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: amt:Amet_4404
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83868"
FT                   /db_xref="GOA:B2A4U6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U6"
FT                   /protein_id="ACB83868.1"
FT                   /translation="MIESILIILIAGFIMGKAFEKLNLPGLLGMLLAGILLGPNYLDLI
FT                   SSEILAISDDIRLLALILILLRAGLGLRRETLNKVGVLSLKLGSLPCLMEGFTVLLLAY
FT                   YLFELGFVEAGILGFIIAAVSPAVIVPSMLKLKDRGLGKDKGIPVMILAGASIDDVFAI
FT                   TLISIFLGLVNGGAGGTLLSLLAIPREIIGGILFGLFVGFILTKIYQKFEMADSDRMVV
FT                   LAVGALFAYVVSSYLQVAGLLAIMIAGAYLLEKHKLFAEEFSKKLKGVWSFGEIFLFVL
FT                   IGSIVDVSLAISAGPLGILIITVGVFIRMLGVYISTLGSNLNPKERLFCGISYSPKATV
FT                   QAAMGGVPLSMGLPGGELILALAVLSVIYTAPLGALGINFFADKLLDSESDETAELSSI
FT                   E"
FT   gene            285848..286564
FT                   /locus_tag="Nther_0271"
FT   CDS_pept        285848..286564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0271"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: amt:Amet_1416 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83869"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U7"
FT                   /protein_id="ACB83869.1"
FT                   /translation="MIKVGLNERIKELSLQHGVTHFGVAYLSKAKQAILSQGGSEIASF
FT                   PYSISLGISLINHIVDQLPRRSERSVALNYRHHAYDVINQRLDTIASIVSGFIQQQGYT
FT                   VLPIPASKRIDDERICASFSHKMGASLSGQGWIGKNCLLITPDSGPRVRWVSILTDAPV
FT                   EPTGQLMEEQCGDCSACVDVCPVKAFTGKPFNEEEPREVRYDAKKCNKYFEKMKEKGQI
FT                   EACGMCLYVCPYGRKQ"
FT   gene            complement(286706..287644)
FT                   /locus_tag="Nther_0272"
FT   CDS_pept        complement(286706..287644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0272"
FT                   /product="GumN family protein"
FT                   /note="PFAM: GumN family protein; KEGG: amr:AM1_4632 GumN
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83870"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U8"
FT                   /protein_id="ACB83870.1"
FT                   /translation="MDFLGVTRSKVVKILGMLSVLILLTACGPEEAAVDEESKGIFYEV
FT                   EGGTNQVYLFGSVHVGHEDMYPLSPKVEDAFQEADVLGLEIDMAGMTEMEIGQQMATLG
FT                   MYHDGTKMTDVVSEETFEEVADMAVSIGIDRETLNNFKPWYGALIASEIAINEAGLSPE
FT                   YGIENYFIEQLEDKEMETISLETIEDQIGIYNKLSDESQEIYLENTLEEIEYVEEELEE
FT                   LITLWQEGNTEELADIREQQIEESETESIKDYQLAMWDGRDEQMTNEIEDILNDDSEDT
FT                   YFIVVGSMHLAGENSIPDQLRDRGYDVESLH"
FT   sig_peptide     complement(287546..287644)
FT                   /locus_tag="Nther_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.799) with cleavage site probability 0.764 at
FT                   residue 33"
FT   gene            287876..288757
FT                   /locus_tag="Nther_0273"
FT   CDS_pept        287876..288757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83871"
FT                   /db_xref="GOA:B2A4U9"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4U9"
FT                   /protein_id="ACB83871.1"
FT                   /translation="MLLQKKFVKETILFVAVIILLFSFLVWYGNWNLELLFNEKVIDLE
FT                   GDMTTSDEHLTIKPREMIIDHSKITILVDYQVNPELRQLDLEFTTPPRLLLEKENKVDN
FT                   NNSTLTMPSGAYPDSSEKIETIDESYFKYEYWYQNFPYELEQDLTLILDRTYMSKDHSQ
FT                   EISVDPGDNVEVEISDIGKYKGKLKEPQKTDEGLDTITFEGEILSDQFEYGFRVRDYLI
FT                   SMVNGEEVRPTGAGGGGSPGSNSNYQFEREYRIEDKMFWEGDLVLQVGRIRVLIGNRFE
FT                   SPYMDLNITEEL"
FT   gene            complement(288775..289806)
FT                   /locus_tag="Nther_0274"
FT   CDS_pept        complement(288775..289806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0274"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: rca:Rcas_4299 sodium/calcium exchanger membrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83872"
FT                   /db_xref="GOA:B2A4V0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V0"
FT                   /protein_id="ACB83872.1"
FT                   /translation="MNNIILTWLVFIGTAAAIFFSGKRLSTVADKIGKVTGLGGAFVGV
FT                   LLLPIVTTLPELSVTISAIIIDAPNLALGNLFGSNLLNLSLIFFMDIAQGKGPIAKKLS
FT                   FDHILAVSMLTIILTIALTGIVEQELFTIGHLGGSSLLIFFVYFVSHTIHYRYHKRNPN
FT                   LSTDPVDSSEPPDERNDSKNNTRSSESLKKLVFEFAVLGIIIIVSARFLSGAADTIAEN
FT                   TGLTEGLLGVVFLALSTSLPELVITLSAVKKGFFDQAFGSILGANILNMGLIFIVDTIY
FT                   LKGPILQFSEQEIFNAAVIGILMTNVIAAGIIYRSKRSYFYLGIDAIVILILYIIFLIS
FT                   SIA"
FT   sig_peptide     complement(289726..289806)
FT                   /locus_tag="Nther_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.810 at
FT                   residue 27"
FT   gene            complement(290052..290552)
FT                   /locus_tag="Nther_0275"
FT   CDS_pept        complement(290052..290552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83873"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V1"
FT                   /protein_id="ACB83873.1"
FT                   /translation="MSSPNLDHENDKLSVKYDSGPLLKKQNSKSIITKVLNMNNFPVNF
FT                   NVSINILDKEVVEPHYVSQKQVYSKSSSSIDIIDISNRNFLCFNITFDFFSEEYPIKDH
FT                   VYIMAIGRSDKPTEPAENSHLISDLTLKTSDFCKELTSKSDYMDEANEDFSPMFDLGRL
FT                   FYE"
FT   gene            complement(290558..291763)
FT                   /locus_tag="Nther_0276"
FT   CDS_pept        complement(290558..291763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0276"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: cpy:Cphy_1689
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83874"
FT                   /db_xref="GOA:B2A4V2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V2"
FT                   /protein_id="ACB83874.1"
FT                   /translation="MTIYDQSLGIAVILLLGFCGGKLVQRFKVPMVVGYIIIGLILSPS
FT                   LLNVIPSELNESLNIIRILGLGIIALFIGSELEISKLKQLGKAIVGITVVQIFGAFFVV
FT                   FFAMFYLLNLSLEVSLLLGAMATATAPASPLAVVRETKAKGPFTSTLLGVVAVDDALCI
FT                   IFFGIISAIVGGLIAGNGFTVASILEPIIELGGSTLLGAVLGCFLCLLLKATGNRQHKV
FT                   LLLVGIALLNSGMANLLNLSPLLANMVSGFVVANLYSKPKEITYLEDIELPIYIGFFVL
FT                   AGAELHLDILLENWVFAAVYIVARSIGKVGGAFLGARWSQAPILVQKYLGFAMFSKAGV
FT                   TIGLLMIVQSQFPDIAPIITAIELAAITVFELFGPLGTKYALVSSGEANIQYDFSPSTK
FT                   EV"
FT   gene            complement(291822..292139)
FT                   /locus_tag="Nther_0277"
FT   CDS_pept        complement(291822..292139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2092 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83875"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V3"
FT                   /protein_id="ACB83875.1"
FT                   /translation="MLNETEYLDELLKKFIEIGIPGGTVIDSEGMGNALVCQNKIPIVG
FT                   GVRQLFEHCKEGNKTIFSIVDSEEKLSQATELLEGKLIDLNEPGVGIAFYYKIDNVIGL
FT                   S"
FT   gene            292422..293021
FT                   /locus_tag="Nther_0278"
FT   CDS_pept        292422..293021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0278"
FT                   /product="putative nitroreductase family protein"
FT                   /note="KEGG: bcz:pE33L466_0369 possible nitroreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83876"
FT                   /db_xref="GOA:B2A4V4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V4"
FT                   /protein_id="ACB83876.1"
FT                   /translation="MEGNFYTAVEKRRSIYGISKEAVISDDKIKKIIEHAVKFIPSAFN
FT                   SQSGRVVLLLGEHHDKLWEIIKDILREKVSEKKFPKTEEKLNSFKSGYGTVLFFEDQEP
FT                   VQELQQKFPKYKDTFPIWSHHSSGMLQYVVWTALELEGFGASLQHYNPIIDDAVKKEWD
FT                   IPENWELVSQMPFGKPTAPPGEKEFKPLDERIKVFK"
FT   gene            293093..293716
FT                   /locus_tag="Nther_0279"
FT   CDS_pept        293093..293716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0279"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; O-methyltransferase family 3; KEGG:
FT                   aoe:Clos_1657 O-methyltransferase family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83877"
FT                   /db_xref="GOA:B2A4V5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V5"
FT                   /protein_id="ACB83877.1"
FT                   /translation="MDQEIFNYIQNYIVRDNCKSDTIKEEEYQRDDVQPSIELETGKFL
FT                   GLLIRLINAQKVLEFGTCLGYSTIWLGEAVKQTGGKVISIEKDPKLYQEAKTNIEEAGL
FT                   SNSVELVYGDISEKIRDLTGPYDIIFQDAQKSLYPKVLENSINLLNQGGVLVADDTLFK
FT                   VKGAPRNLGAPVDEYNRKVMSDDRLYSTILPVGDGVTLSYKIRQ"
FT   gene            complement(293706..294263)
FT                   /locus_tag="Nther_0280"
FT   CDS_pept        complement(293706..294263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0280"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="TIGRFAM: proton-coupled thiamine transporter YuaJ;
FT                   PFAM: thiamine transporter YuaJ; KEGG: bsu:BSU30990
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83878"
FT                   /db_xref="GOA:B2A4V6"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V6"
FT                   /protein_id="ACB83878.1"
FT                   /translation="MENVSKNVRILAETGIAVALALLLSMIKLYTMPQGGSVSLEMLPI
FT                   FIIAFRWGLKPGILAGVTFGILQLAVAGFIVHWIQFFLDYPVAFAGLGLAGTFSSWIRK
FT                   ANSSANIILPIVTGVILGGMVRFVSHFLAGAVFFGDYAPEGQSVWMYSLLYNSSYLVPE
FT                   LIITIIVIVLLTLTRVKKYFTV"
FT   misc_binding    complement(294462..294572)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 69.28"
FT   gene            complement(294704..294967)
FT                   /locus_tag="Nther_0281"
FT   CDS_pept        complement(294704..294967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83879"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V7"
FT                   /protein_id="ACB83879.1"
FT                   /translation="MKVIMKPIEMIAWFKEDGIPKPLKYRITTSEGTKKVVSVDQVIST
FT                   SEEKLTGNKMIVYTCQSTIGETQKIYELKYEISSCKWYLAKI"
FT   gene            complement(294982..296247)
FT                   /locus_tag="Nther_0282"
FT   CDS_pept        complement(294982..296247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0282"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   dsy:DSY4185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83880"
FT                   /db_xref="GOA:B2A4V8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V8"
FT                   /protein_id="ACB83880.1"
FT                   /translation="MSDPIIFHIDVNSAYLSWEAAYRLQKGAQLDLRQVPSVVGGDSQK
FT                   RRGIVLAKSIPAKSKFKIQTGELLSSARKKCPDLFVVPPNYDLYLRCSNAMVELLYEYS
FT                   PFIQRYSVDEVFLDFTNMEKQFGDYLTAANTIKARVKEELGFTVNIGIGPNKLLAKLAS
FT                   EFKKPDRVHTLFPEEIPTKLWPLPVGELFMVGRATEKKLLDRGITTIGELAKTPRNKLK
FT                   LWLKSHGLLIWDFANGIEESSVRPEGFPMKGLGNSTTTPENVADKETARLWLLSLTEKV
FT                   SSRLRDAHCYAQVVNLSIKTSQFISYGKQKKLLNPTNSTKVIFETGKKLLNELWDEEEP
FT                   LRHIGISLSSLSSSKSYQLSMFDKLSIDTDSEESFYKAIDKIRAKHGETSLIRSCFLHS
FT                   TVPPLAGGVDAEEEYPMMSSLL"
FT   gene            296481..297020
FT                   /locus_tag="Nther_0283"
FT   CDS_pept        296481..297020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0283"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: mma:MM_1036 bioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83881"
FT                   /db_xref="GOA:B2A4V9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4V9"
FT                   /protein_id="ACB83881.1"
FT                   /translation="MNSNIRDLVVISLFAAVTGVLSYVYVPISPVPVTGQTMGVMLSGA
FT                   LLGPKRGFISQVVYLLLGVVGMPVFAGGMGGVAVLFGATGGYLWAYPFAAFIIGYIVEK
FT                   GDRYTGITYWLVLVLALLTGGVFMIYTTGVLQLALVTQVPIGVAVLEGAVPFLLGDIVK
FT                   ITASAFVTKSCRTLSL"
FT   gene            297194..297895
FT                   /locus_tag="Nther_0284"
FT   CDS_pept        297194..297895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0284"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: fps:FP1553
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83882"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W0"
FT                   /protein_id="ACB83882.1"
FT                   /translation="MENSFKQTEFLSLSTRAQILLSREEGFDVEFKQTLNAVDSEDIVA
FT                   FANSKHGGAILAGIREEQEESGRQGTEIVGCPIGDEEKLTILNKAASCHPPVYLELYIE
FT                   NSQKTPFYRIEIPSGKEKPYCTPKGTYKIRGDGRTNVLLPDQLLSLFVEEESEQFIGRF
FT                   KEATKELEKSHSELQNAISGDMRKFLENFYGEFARKINKIESIEDRMESLENKFDKLIK
FT                   NLDLDTDTDKS"
FT   gene            297993..299222
FT                   /locus_tag="Nther_0285"
FT   CDS_pept        297993..299222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0285"
FT                   /product="protein of unknown function DUF418"
FT                   /note="PFAM: protein of unknown function DUF405; protein of
FT                   unknown function DUF418; KEGG: amt:Amet_1491 protein of
FT                   unknown function DUF405"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83883"
FT                   /db_xref="GOA:B2A4W1"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W1"
FT                   /protein_id="ACB83883.1"
FT                   /translation="MVQRHGAPTDPNKRVEIVDIIRGFALFGVLLVNMTLFKSTLFYWE
FT                   QIPHYSGDINVFFGWMIELLATGKFYPIFSFLFGLGFYFFVSRAQKKGLKVGKLYRRRI
FT                   LGLLIFGLIHLVFIWSGDILHLYSVGGLFLLVFSTMSDKTIKKLMVFFFCLAVIIQGGI
FT                   VFAETLTAEEDLTAEIDPREKRLQLKEDATGVYQEGDFLDILRFRVVNEVPYVMLNILL
FT                   SLPDILFLFLLGLYAGRKKIFMKIGEYRQKFRWTLNRTLPIGVIGTLVYYLIMVDSIGL
FT                   GPIAGDVLAEMIFYVASISLAVTYICSLSLLSQYNFPMRILSPLSNVGKMALTNYLTQS
FT                   LISVSIFYGYGAGLFEQVSVTGGVAITVGIYTLQMIWSWIWMSRFRFGPFEWLWRSFTY
FT                   QEFPPIKLSS"
FT   gene            299297..299830
FT                   /locus_tag="Nther_0286"
FT   CDS_pept        299297..299830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0286"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tte:TTE0537 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83884"
FT                   /db_xref="GOA:B2A4W2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W2"
FT                   /protein_id="ACB83884.1"
FT                   /translation="MKKKIRQGKISDFSRLSWAWDNNPSTLKVFKQRMNMGIQEFWVIE
FT                   SLEKDNNGNLPVELAGEFHIVWDSPDPDEADGEARAYLCAFRVHPDYRGLGLGKNLMEG
FT                   VLSRVSQVGRTQVTIGVKQNRPEIKEIYHKWGFTELVKLKTVDHHNFNEQGEPNPTDFP
FT                   IELYLKYLSKNNKN"
FT   gene            299845..300984
FT                   /locus_tag="Nther_0287"
FT   CDS_pept        299845..300984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0287"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: bha:BH1771
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83885"
FT                   /db_xref="GOA:B2A4W3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W3"
FT                   /protein_id="ACB83885.1"
FT                   /translation="MSQFELIATSTFGLEALVKQEIKDLGYEIVSVENGKVTFKGDEKA
FT                   ICRANLWLRTADRVKLKIGEFTAKSFEELFEQTYQLPWEELLPQNAEFPVEGKSVKSQL
FT                   YSVPNCQSIVKKAVVKKMGQAYGQSWFEEDGPFYKIEVALLKDIATLTIDTSGPGLHKR
FT                   GYRALVSHAPLKETLAAALIMLARWYPDTALIDPLCGSGTIPIEAAMIGRNIPPGLNRN
FT                   FSASSWPIISDKIWQNVREEGQDKAEFDKELKIYGSDFDEEMVQLSQDNAEKVLGKNIP
FT                   EFTCMPIDKISSNEEYGKLICNPPYGERLGEEPEVDDLYRQMGQIFNKRFPTWSYYILT
FT                   PHNNFEKLFGKKASKKRKLYNGRIRVDYYQYFGPKPPNL"
FT   gene            301100..301879
FT                   /locus_tag="Nther_0288"
FT   CDS_pept        301100..301879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0288"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   amt:Amet_1086 protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83886"
FT                   /db_xref="GOA:B2A4W4"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W4"
FT                   /protein_id="ACB83886.1"
FT                   /translation="MVGTTKQVLLTTVVVMAFMVMTGFSIAPDVHDEDAEIIDPKSNNS
FT                   LIGVSGEGEVKVEPEVAYVTLGVETSSPDPQKAQAENSDIMEDVVETLRDQGIAEEDIR
FT                   IGHYSIGQQYVRPDEEEEPDYQVANHIDITVHDLDNVGSVLEASVNQGVNNIRSLEFGV
FT                   LDEEEYKMKALDNALENAEQKADRIASFYDKSLDDIKQVLESDTSLGRMQMDMDMEYTV
FT                   SEEALEMSDDVYGTAGLDAQPGEVTFEADVDVIYEMQ"
FT   gene            302049..303230
FT                   /locus_tag="Nther_0289"
FT   CDS_pept        302049..303230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0289"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   cbf:CLI_1497 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83887"
FT                   /db_xref="GOA:B2A4W5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W5"
FT                   /protein_id="ACB83887.1"
FT                   /translation="MTGARFDQIIDRTGTHSYKWDDVGEVFGSNELLPMWVADMDFQSP
FT                   DSVIEAVVERAQHGVYGYAGDFDGYFNSVKDWFNKRFNCKIEKDWIKTTPGVVPALNMA
FT                   VRTYTNPGDKVIIQSPVYPPFFNVVRNNGCHVINNELIEEKGKYYIDFEDLDKKASDSR
FT                   AKILMLCSPHNPVGRVWSREELKKIGEICQKNNLILISDEIHGDLTFPGNNNIPYFKIM
FT                   SELNFNNVILCTSPAKTFNVAGLQTSSVIIPDQCLRSSFNNTLEANGFSKPNIFGLIAA
FT                   ESCYNYGEDWLDELREYLYQNFLFIEDYLKNNIPALEVTKSQGTYLAWLDIRKTGKTTK
FT                   EIQKLLVSQGKVALIPGTKFGPNGEGFLRLNFGCPQKQLHQGLDRIAKVINSL"
FT   gene            complement(303428..303781)
FT                   /locus_tag="Nther_0290"
FT   CDS_pept        complement(303428..303781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0290"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rrs:RoseRS_2126
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83888"
FT                   /db_xref="GOA:B2A4W6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W6"
FT                   /protein_id="ACB83888.1"
FT                   /translation="MWSGSVIFLGTNDLEKVHDFYHNVLQLPLFKDQGACRIYEIPGGG
FT                   MIGFCTHMEVKSEGKAPIITLLTEEVDRAYGSLIDNGYQPFNKPKTNPDFKIYHFFSED
FT                   PNGYSLEIQKFLD"
FT   gene            303951..304406
FT                   /locus_tag="Nther_0291"
FT   CDS_pept        303951..304406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83889"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W7"
FT                   /protein_id="ACB83889.1"
FT                   /translation="MRGCLVAILIFAVLGLSFYFFVAGPTENIDREYPGIMYTTDGEIE
FT                   EQITVKLRGALTEPLMSEPTFEGEIEITGDEIYYSESIPEIECAEGIFFLGFPEQETPE
FT                   GIVSGSVTISDDLEKLIGSLSLNNKYTYYFGAPGESLEEILAIKMYE"
FT   gene            complement(304440..305621)
FT                   /locus_tag="Nther_0292"
FT   CDS_pept        complement(304440..305621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0292"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: fno:Fnod_1307 pyridoxal phosphate-dependent
FT                   acyltransferase, putative; TIGRFAM: pyridoxal
FT                   phosphate-dependent acyltransferase; PFAM: aminotransferase
FT                   class I and II; aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83890"
FT                   /db_xref="GOA:B2A4W8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W8"
FT                   /protein_id="ACB83890.1"
FT                   /translation="MSSQEKLNFIQTELEELKEKGLYKDIKTLEGPQGAWVQIKGKKML
FT                   NFCSNNYLGFANHSQIVEAAKKAIDEYGVGPGAVRTIAGTMDIHHQLERKLAEFKGVEA
FT                   ALSVQSGFKANLSAIPALVGKGDTIISDELNHASIIDGSRLSRADIKVYSHNDVDSLES
FT                   VLKENPPGKKLIITDGVFSMDGDIAPLPEIVEVAKKYDAMTMVDDAHGEGVLGRSGRGI
FT                   VDHFNLHGEVDIEIGTFSKALGVMGGCIAGSAQLIEYIRQKSRPFTFSSALTVPDTAAT
FT                   LEAIKILSDSDELVTKLWDNADYFKKGIKELGFDTGESETPITPVMIGDAKAASEFSEK
FT                   LFEENIFAQAIGFPLVPHGKARIRAMISAAHSKEDLDFALEKFSKVGKELNLI"
FT   gene            complement(305667..306710)
FT                   /locus_tag="Nther_0293"
FT   CDS_pept        complement(305667..306710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0293"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   tte:TTE2405 L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83891"
FT                   /db_xref="GOA:B2A4W9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4W9"
FT                   /protein_id="ACB83891.1"
FT                   /translation="MTGKMKALMKQDRSSGAVLEQVDIPKPKSNEVLIKVESAAICGTD
FT                   LHIYNWDQWADSRINPPLIFGHEFSGEVVELGADVKDIETGTRVTAEGHFVCGKCFFCK
FT                   TGQAHICENVEIIGVDTTGCFAEYVVVPRDNVWILDKSIPPEIGAIHDPIGNAIHSALI
FT                   DEITAKDVLVTGCGPIGLASIAIARKAGASKIFATEVNSYRIELAKKMGADEIINPMEQ
FT                   DTVELVKSKTNGAGVDVLLEMAGKDTAINEGLAALKGGGWVSFLGLPPGKTQIDLSNGL
FT                   IFKGAKAYGINGRIMYETWFKMHNLLKSRLADDLMPMVTHKFSFEQFEEAFQLAQEGNT
FT                   GKIILHP"
FT   gene            306871..307200
FT                   /locus_tag="Nther_0294"
FT   CDS_pept        306871..307200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83892"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X0"
FT                   /protein_id="ACB83892.1"
FT                   /translation="MKNFLKKGVNFGLGLAVMSKEQIEKMVDELVKKGEIAPEESKRVI
FT                   NNMMERGEEERSKLNDMIQEQTRQVFRELDTATGEDIQELRIKLEELEQRIEKLEQDNG
FT                   ENNLS"
FT   gene            307215..308891
FT                   /locus_tag="Nther_0295"
FT   CDS_pept        307215..308891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0295"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: gka:GK1754 ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83893"
FT                   /db_xref="GOA:B2A4X1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X1"
FT                   /protein_id="ACB83893.1"
FT                   /translation="MFKRRIRHFNRYREIVSILARHGFGFLIEELGLHHMLSLPSRIRK
FT                   ESSKQKPKPVGLRMRLAFQELGPTFIKFGQLLSTRPDMLPEHIINELDKLQDRVDPFPY
FT                   EEAKENIEDEMETSLEELFAEFDEEPLAAASIGQVHSARLKNGDEVVIKVQRPNISSVI
FT                   ETDLEILADLISLAETRFSFVSQYNLKEIVDEFSISIRKELNYTLEARNAEKFKSIFSE
FT                   DDSIYIPGIYWDLTSKRVITMERVKGTNLNNLEEVVAKGFKTSAVAKNLTESFLNQILI
FT                   EGFFHGDPHPGNFILLDDGRLAFTDFGIVGQLTPELKDSFASLMISVVRQDVDDIVKNI
FT                   MKVGFLPDEVNINRLKRDVMTVRDKYYHLPLKQISFSEAIEDFFDIAFRHKIQIPSELS
FT                   LLGKTFLTLEGVVKNLDPDVSVVEIAEPFGSKILKEKLRPENVWQKFTDNIKDYGEMVL
FT                   ELPGELRDFVRILKKGKGTVELQMPQLDSLQKKLDRVSNKLSFSIVLLAFSIIMSGLII
FT                   GASLGGQSMVIWQVPAVEIGFLIAMFMFFWLLFSIFRSGRF"
FT   gene            308909..309571
FT                   /locus_tag="Nther_0296"
FT   CDS_pept        308909..309571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83894"
FT                   /db_xref="GOA:B2A4X2"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X2"
FT                   /protein_id="ACB83894.1"
FT                   /translation="MNFDDVIEELKRSWQKYQIQTVLIINLVFGLTALGITYATADSLA
FT                   FFELFLRLIAVFTPLILLILFMLRGYHVLFLSQFNNEQMYWWSMTDISVGAPLFTFWLI
FT                   TLLLWEGVSILAILLIYLKLLIYIMLILSAALTAMVLANKFWIALTAGIVLHLGLYGLS
FT                   VILPDVQFLGLRFLPYHLITNFRQILELNLGMWELLTPLAVSGIILWVIRNVAVQNY"
FT   gene            309593..310891
FT                   /locus_tag="Nther_0297"
FT   CDS_pept        309593..310891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0297"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: rfr:Rfer_0891 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83895"
FT                   /db_xref="GOA:B2A4X3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X3"
FT                   /protein_id="ACB83895.1"
FT                   /translation="MVGIAPNLQASLFELTMSFSDAMDLVSPEVVDHHKKVAYIAGELG
FT                   REYGLDVDKTKDLVIAGLLHDSGALSLRERLDALSFEAKAPHRHAEMGYRLFKNFKPLK
FT                   QVAKAIRYHHVAWNRQEEIKKQTGEEVPIESHIIHLADRISVLVNRDKTMLNGYDRQKI
FT                   TARVVKEKGELFSPELVEVFQQIAEREYFWLDITYPGLGERLLAKNYQSKIDLTITELV
FT                   ELAEVFRHLIDFKSSFTATHSSGVAATAKELAAKTGFSQLECDLMDIAGSLHDLGKLAV
FT                   PNKILDKPEKLTEEEYDIIKNHTYYTYRSLERIPQLDLVNQWASLHHERLDGKGYPFKY
FT                   SEYNLPLGSKIMAVADVFTAITENRPYRKKMPDEKVKRILTEMGDTKKMDKYIIDVLIQ
FT                   NFEHFNYLRDSAQQISQQRFKAYNEHAENASEI"
FT   gene            complement(310943..311596)
FT                   /locus_tag="Nther_0298"
FT   CDS_pept        complement(310943..311596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0298"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tte:TTE1399 glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83896"
FT                   /db_xref="GOA:B2A4X4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X4"
FT                   /protein_id="ACB83896.1"
FT                   /translation="MFQNTTVLIPAYNEENRIHKVLEIVTKLPFKRIIVINDGSLDNTY
FT                   HEAIKFPIEVLTHKTNLGKGAALQNGIDFVQHSPYWVFLDADLINLSTSHIEKLLSPLE
FT                   EDSETAMAVGMFTEGGKLHVDLAQRFFGILNGQRSFSQSFIESLPSITWARFGVEIFLS
FT                   KYADHQGVKVHYPVLEGLTHWTKEEKFGLVKGFSYRLQMYRECLSSLKNWHHYI"
FT   gene            312198..313663
FT                   /locus_tag="Nther_R0026"
FT   rRNA            312198..313663
FT                   /locus_tag="Nther_R0026"
FT                   /product="16S ribosomal RNA"
FT   gene            313846..316974
FT                   /locus_tag="Nther_R0027"
FT   rRNA            313846..316974
FT                   /locus_tag="Nther_R0027"
FT                   /product="23S ribosomal RNA"
FT   gene            317100..317216
FT                   /locus_tag="Nther_R0028"
FT   rRNA            317100..317216
FT                   /locus_tag="Nther_R0028"
FT                   /product="5S ribosomal RNA"
FT   gene            317229..317303
FT                   /locus_tag="Nther_R0029"
FT                   /note="tRNA-Asn1"
FT   tRNA            317229..317303
FT                   /locus_tag="Nther_R0029"
FT                   /product="tRNA-Asn"
FT   gene            317499..318425
FT                   /locus_tag="Nther_0299"
FT   CDS_pept        317499..318425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0299"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: cpr:CPR_1963
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83897"
FT                   /db_xref="GOA:B2A4X5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4X5"
FT                   /protein_id="ACB83897.1"
FT                   /translation="MINNVNQEILRAFVENNRPLAHDGRLPTYIPALMNANKQDFGIHI
FT                   TELDGNSHYYGSFQIPFTVQSISKIITLAMAIMDNGEELVFSRVGMEPTEDKFNSILPL
FT                   EMSSAYPPNPMINAGAIVVTSLIKGRTAGEQFERILDFTRALADNKNIQVDENAFLSER
FT                   ETGNMNRSLAYYLKDANVINGNVEEILETYFRHCSILVTAEDLSRIAYIFANDGKDIEG
FT                   KQLIPAKVCKIVRAIMAMSGFYDESGEFAVRVGIPAKSGVGGGIIGVVPGYMGIGLYGP
FT                   ALNNKGTSIVGFNVLEELTSYLQVGIY"
FT   gene            318462..318839
FT                   /locus_tag="Nther_0300"
FT   CDS_pept        318462..318839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0300"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: cca:CCA00469
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83898"
FT                   /db_xref="GOA:B2A4X6"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A4X6"
FT                   /protein_id="ACB83898.1"
FT                   /translation="MIIGLGVDIIEIARIKKVYNKFPWKFVNKLFSDREQKKLMTLHNP
FT                   NEYISGRFAAKEAVAKAFGTGIGQVRWKDIEILTADEGYPVVNLHGEALNKAEELGVTK
FT                   VYLSISHSKTSAVANAILWSD"
FT   gene            319008..319475
FT                   /locus_tag="Nther_0301"
FT   CDS_pept        319008..319475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0301"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   mta:Moth_1653 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83899"
FT                   /db_xref="GOA:B2A4X7"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X7"
FT                   /protein_id="ACB83899.1"
FT                   /translation="MCVNVKLSTKGEYGVRALVHLACNYNEGPISLREISKIEDISYQY
FT                   LEQIFLDLRRNSLVLSVRGAKGGYTLASHPKEITVGDVIRAVEGPIAPVSCVAKSTNSE
FT                   NTECDRSSTCAPRGVWLELRDRISEVLDEFTLQDLAVTDNDIEKLRGEHNE"
FT   gene            319468..320646
FT                   /locus_tag="Nther_0302"
FT   CDS_pept        319468..320646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0302"
FT                   /product="cysteine desulfurase NifS"
FT                   /note="TIGRFAM: cysteine desulfurase NifS; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   chy:CHY_2199 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83900"
FT                   /db_xref="GOA:B2A4X8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X8"
FT                   /protein_id="ACB83900.1"
FT                   /translation="MNKIYLDHGATTPMREEVFETMKPYLQDNFGNPSSIHSFGREVRK
FT                   AVDEAREQVANAINAQPEEIIFTSGGTESDNLAIQGVIEKIGDKGNHIITTQIEHHAVL
FT                   DTCEAMEEKGYKVTYLPVDKYGLVNPKDLQEAINEDTVLITIMHGNNEVGTIQPIKELA
FT                   EIAKDNDVYFHTDAVQTVGNIPIDVQDLGIDMLTLSAHKFYGPKGIGALYIKKGTKLQR
FT                   VVHGGAQERKIRPGTENVPGIVGLGKAIELATEELDTKGKHIQKLRDKLIEGLSKVEDS
FT                   RLNGHPERRLPNNVNMSFEYIEGESLLLNLDMKGIAASSGSACTSGSLDPSHVLMAMGL
FT                   SHQTAHGSLRLTLGRDNTEEEIDYVIEAVPEIVNRLRDMSSIWKGKEANYSN"
FT   gene            320661..321074
FT                   /locus_tag="Nther_0303"
FT   CDS_pept        320661..321074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0303"
FT                   /product="FeS cluster assembly scaffold protein NifU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold protein NifU;
FT                   PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   chy:CHY_2198 putative FeS assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83901"
FT                   /db_xref="GOA:B2A4X9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4X9"
FT                   /protein_id="ACB83901.1"
FT                   /translation="MYNEKVMDHFQNPRNVGEVESPDGVGEVGNVTCGDIMRISIKVNN
FT                   NEEIEDIKFKTFGCGAAIATSSIVTEMAKGKHINEARDIKNKDVADELDGLPKNKLHCS
FT                   NLAADALTKAIKNYLGEEDDEEQEHEDESNETQ"
FT   gene            321285..322886
FT                   /locus_tag="Nther_0304"
FT   CDS_pept        321285..322886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0304"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: cth:Cthe_2696 carbohydrate kinase,
FT                   YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83902"
FT                   /db_xref="GOA:B2A4Y0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Y0"
FT                   /protein_id="ACB83902.1"
FT                   /translation="MLKVVSPEEMAQIDKMAIDEGRIPGIVLMENAATAVTNVVLNFLN
FT                   NMKADYNQTQVTVLAGIGNNGGDGFAVARQLAMKEINVSLVLIGKADKLSGDALTNWEI
FT                   IKHRDDIKIHTIDQRSTDNLTSLNNLIIESDIILDALLGTGLAGAPKEPFNTCIQIANQ
FT                   SRRKDCLTISVDIPSGVSGSGGEVDGNAVMADITVTFAQPKTGLLFYPGAHFTGELLTV
FT                   PIGIPNWIVTKNESQNYLVTEGSAANLLPQRLPDTHKGHYGRVTIIAGSSHMLGAGVLV
FT                   SMAAVKSGSGLVTWAVPESEERTAQSKVGSEVMTWCLPSKDGVLAQQVHEKLEKTVTGL
FT                   EHGPDVMAVGPGLGTEKGTEEVVKKALLDFNTSLVLDADGLNVLVGNTNWLSSSATPKV
FT                   LTPHIGEYSRLIDKSIDEIKSNPINLVTQSAQEWNSVIVLKGTPTIIASPHGSSYIVST
FT                   SNSGMATGGSGDVLTGIITSLIGQGLTVEEGAILGVYLHKIAGEKARSQSGEASMTATD
FT                   LWNSLPDAFQYLNDKS"
FT   gene            322952..323395
FT                   /locus_tag="Nther_0305"
FT   CDS_pept        322952..323395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0305"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   amt:Amet_4166 CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83903"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2A4Y1"
FT                   /protein_id="ACB83903.1"
FT                   /translation="MRAKDIMSTDIVTVSPESTVEEAAKLMADREISGIPVINSQNDLV
FT                   GIITEGDLLGKHKRISPPGYIEFLGGIVFTESQDEFFEQLRKYVATQVKDLMSDQVVTV
FT                   GPEAGIEEIATTMDQKNVKRLPVVGEGKLLGIVSRADLLKALL"
FT   gene            323403..324488
FT                   /locus_tag="Nther_0306"
FT   CDS_pept        323403..324488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM_1024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83904"
FT                   /db_xref="GOA:B2A570"
FT                   /db_xref="UniProtKB/TrEMBL:B2A570"
FT                   /protein_id="ACB83904.1"
FT                   /translation="MEQIPRVKGIFILIIIPVTLMVVTTSCQKLTTEELQTWSQETLAD
FT                   LDDYYLSGHLTVGEEGAENLRDYAVEERYLHPNKLRVDITEKNQATGSHQTFIAKNGEI
FT                   DIFHRDLEEHYHISEGDLSNKLSFLFINFLELMAAGELTPEVASLKEGYKLEGVFKESG
FT                   LGTYRLYLDKGLYPEKIQLYREDKSSPYLELVYQEVKWNQSHISHTDFDEKLLEMAFEE
FT                   PLEPKCELHEYKKENLDELALNFDPKVPELDDEFIKSIYACEHSDWLSMRIIAEEIEEK
FT                   IEEEYIVTQTLLENKDKEDPSILSDEGDYEHKSKENVDFWLETVEDKNIIYWRYGDIKF
FT                   TIIGAEDEEKMLSLAKSFVSK"
FT   gene            324660..325832
FT                   /locus_tag="Nther_0307"
FT   CDS_pept        324660..325832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0307"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: cno:NT01CX_1264 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83905"
FT                   /db_xref="GOA:B2A571"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B2A571"
FT                   /protein_id="ACB83905.1"
FT                   /translation="MSESIPVRPTFSEINLDNLSYNFNRIREHVNNKKIMGIIKADGYG
FT                   HGAVEIAEELLNQGVDYLGVAILDEAVELRKAGIAAPILILGYTPVEHVDVCLKYGITP
FT                   TIYTYEMAEALSQTARKMGKTAFVHVKIDTGMGRIGIAPENSAEFVKNISKLPSLEVEG
FT                   VFTHFSVADEEDKTYTQQQINSFEKALKMLEDEGIEIPLKHAANSPATIDLPDAYFDMV
FT                   RVGLALFGLYPSPHMKEKISLKPVMSLKTQVSHVKQVPKGTSISYGRKFITEDESIIGT
FT                   LPVGYADGFTRLLSNIGEVIVNGKRVPIVGAICMDQCMFLGDDVPEIGIGDEVVIIGEQ
FT                   DGTQITVEDIADKLGTINYEIVTMVDKRVPRLYLKNGKLIKKKSLNSKMY"
FT   gene            325976..326248
FT                   /locus_tag="Nther_0308"
FT   CDS_pept        325976..326248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0308"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: bha:BH0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83906"
FT                   /db_xref="GOA:B2A572"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="UniProtKB/TrEMBL:B2A572"
FT                   /protein_id="ACB83906.1"
FT                   /translation="MSKTERIMISLPENLLEEIDGIVSNEQCSRSEFVRKAMRLYIEER
FT                   RKREIRERMQKGYQEMASINLEIANEALEAENEANQLAEDIVSGV"
FT   gene            326254..326604
FT                   /locus_tag="Nther_0309"
FT   CDS_pept        326254..326604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0309"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: amt:Amet_4143
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83907"
FT                   /db_xref="GOA:B2A573"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B2A573"
FT                   /protein_id="ACB83907.1"
FT                   /translation="MNIKRGDIYYADLSPVIGSEQGGVRPVLVVQNDIGNKYSPTVIVV
FT                   AITSQIQKAKLPTHVEITAEDYNLDKNSVVLTEQLRTIDKQRLKEKITHIDKELMNKIS
FT                   EAIKISLGLIEF"
FT   gene            326660..327667
FT                   /locus_tag="Nther_0310"
FT   CDS_pept        326660..327667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0310"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: pat:Patl_2666 pyridoxal phosphate-dependent
FT                   enzymes, D-cysteine desulfhydrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83908"
FT                   /db_xref="GOA:B2A574"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2A574"
FT                   /protein_id="ACB83908.1"
FT                   /translation="MEEFKKALTKRVSLVSEPTPLRESKNMSDKLNQQLLIKEDDTTGI
FT                   CLGGNKVRKLEYLIYDALEKEVDTVITTGGLQSNHARLTTAIARKYNLQPELVLKDQGK
FT                   KSNGNVLLNQLMDANFHLVQDEKEIDQKISQLRDELQNQGNKAYTIPLGGSNVIGVMGY
FT                   VRAALELREQLDNRNIGEATVVLPVGSGGTLAGLVLANNLWDLNLNFVGISVSRSKDTM
FT                   NNLISEFVDEVVDKYSLNVSRENIPKIFDEFVGPGYGIPDEDTIDAIKFAAKAEGVILD
FT                   PVYTGKAMKGLLHLKETNTLSGPGSSFDPEHPIIFWHTGGMPAVFAYEEECKNN"
FT   gene            327700..328704
FT                   /locus_tag="Nther_0311"
FT   CDS_pept        327700..328704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0311"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: chy:CHY_0780 putative
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83909"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B2A575"
FT                   /protein_id="ACB83909.1"
FT                   /translation="MSKVAVEKTRGDLVESLHRATIAVVDKKGTLFAKLGDADKVTYWR
FT                   SAAKPLQVIPLIQRGGVEQFGFTNKELAVMCASHAAEDIHTEAVQSILNKIGLTEEYLQ
FT                   CGTHPPVDLEVRKRLIRNDQEETEIYNNCSGKHAGMLALAKLMETSYDNYWQTEHPVQQ
FT                   EMISIISKVTETPEADIKLAQDGCGVPVFGLPIHNMAYSYALFGSQEMEQELQESYRVV
FT                   AQAMNTNPKMVAGTERFNSKLMEVMDGKVVAKGGAQGVFSFAVPDKGLGVTIKVDDGSN
FT                   QVIAPITVEVLCQLDLITDNELEQLKKFHYQEIKNAKKDIVGQVRPAFTLNFV"
FT   gene            328751..329566
FT                   /locus_tag="Nther_0312"
FT   CDS_pept        328751..329566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0312"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   aoe:Clos_1006 peptidase M55 D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83910"
FT                   /db_xref="GOA:B2A576"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:B2A576"
FT                   /protein_id="ACB83910.1"
FT                   /translation="MKVYISADLEGITGVVGREHVNPEGSEYQRARDLMTREVNAAIKG
FT                   AYQGGAEHVVVNDAHGPMTNLMIENLETEAELITGTPKPQGMMAGLTEEFDLVFLIGYH
FT                   SKKGDPGILSHSYSGGTVKQIKLNGLEVGEPGMNSYLAGYYQVPVGLVTGDDRVTTNTK
FT                   DLIGEQLKTVAVKSALSRSAAKCMTPTKACKLIEERATQAVSELSKKKYTILTAEKPLE
FT                   LSMSFLDRGMAEKAAQLPNTKLENTTVIYQHDDMLSIYEAMQAMLMLVR"
FT   gene            329673..330701
FT                   /locus_tag="Nther_0313"
FT   CDS_pept        329673..330701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0313"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M20; peptidase M42 family protein;
FT                   KEGG: rxy:Rxyl_0252 peptidase M42"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83911"
FT                   /db_xref="GOA:B2A577"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B2A577"
FT                   /protein_id="ACB83911.1"
FT                   /translation="MELLKKLTQTPGIPGREEPIAELIKEEMNQICDEVWVDPLGSVIG
FT                   LKKGNGNKKVMVAGHMDEIGFIVKHIDKNGFIRLQPVGGFDPRSLMAQRVIVHGKEDLI
FT                   GNLAPATKPIHVLSPEEKKKQLQVKDYFVDLGLSGEKVKELVEIGDPVTLKQDFEEIGN
FT                   MYSSKSLDDRVGVYVMLEAAKQLKDHDADIYLVATSQEEVGIRGAMTSSYGIEPDVGIA
FT                   LDVTIAADTPGSEESEQVTKLGEGAAIKIMDSASITNRKVLQTLKDLANEKDINHQMEI
FT                   LPKGGTDAGSIQRSKSGIPVGTISIPCRYVHTVNEMIHKEDLDASVNLLSAFLAEANFN
FT                   EF"
FT   gene            complement(330821..331453)
FT                   /locus_tag="Nther_0314"
FT   CDS_pept        complement(330821..331453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0314"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: sfu:Sfum_2480 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83912"
FT                   /db_xref="GOA:B2A578"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A578"
FT                   /protein_id="ACB83912.1"
FT                   /translation="MKDKFSAQREKMVQKQLAKRDIEDPKVLDAFRKVPREEFITESKQ
FT                   HQAYGDHPLPIGHGQTISQPYIVAMMTQALEPSSHDIVLEVGTGSGYQTAILAELTKKV
FT                   FSLERIPELSEQAGRILSKLGYQNIVLKISDDDNDLTIHEQKEFDKIIVTAAASQIPPE
FT                   LTQQLKEGGTLVIPVGELMFQELLVVTKHNGELRKKSLGGCRFVPLK"
FT   gene            complement(331476..331775)
FT                   /pseudo
FT                   /locus_tag="Nther_0315"
FT   gene            complement(332067..332417)
FT                   /locus_tag="Nther_0316"
FT   CDS_pept        complement(332067..332417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0316"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: amt:Amet_4319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83913"
FT                   /db_xref="GOA:B2A579"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2A579"
FT                   /protein_id="ACB83913.1"
FT                   /translation="MTARWKRIKGLMDELITNSFKAGATVLESKIMDEDDKHIVYVKDN
FT                   GKGMSEEKLEQAKKLLDQPRRDELEEYYGELAGRTAKNSGLSIVGMMVDEFEIKSEKGQ
FT                   GTEIKLIIYKED"
FT   gene            complement(332417..333625)
FT                   /locus_tag="Nther_0317"
FT   CDS_pept        complement(332417..333625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0317"
FT                   /product="protein of unknown function DUF1576"
FT                   /note="PFAM: protein of unknown function DUF1576; KEGG:
FT                   amt:Amet_4320 protein of unknown function DUF1576"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83914"
FT                   /db_xref="GOA:B2A580"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:B2A580"
FT                   /protein_id="ACB83914.1"
FT                   /translation="MLLYLCALIIAGFIFGFEEGFIQDLREITTVPAVLVTDFFVVGSL
FT                   GAALVNSGLVGIVGLFFAFFLKVPIKGPIIAAIFTMAGFSFLGKTIINIWPIFLGVWLY
FT                   AKTQRETIHHYILNALFGTALAPIASSVSFGLGLGIWGGLILGALGGFLVPPLAGHFLA
FT                   THQGMNLYNIGFTAGFVGTLFAGLFRGFGASKDLVEMWGTGFNPAIFIPLTIYLSSMII
FT                   VGLILNKGQLKPYFEIHKMSGALVSDFVTQKGIGSTLMNMGIVGLIGTLYVIIVGGELN
FT                   GPSMAGIFTIVGFGAFGKHSLNMTPVMLGAFLSLQLFHWSPTEAGPILGVLFGTTLAPI
FT                   SGSFGPIAGIIAGFLHMSMVMNVGYLHGGLNLYNNGFAGGLVATMMVGVLKHFQTDSEK
FT                   EGD"
FT   gene            333835..335031
FT                   /locus_tag="Nther_0318"
FT   CDS_pept        333835..335031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0318"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF362; KEGG:
FT                   mac:MA1031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83915"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A581"
FT                   /protein_id="ACB83915.1"
FT                   /translation="MENKLVKVGIERCLDYKHEQLKSTVIKTLNYFGGLEKLVNQGDKV
FT                   LLKVNLLSPKEPEQAVTTHPQLVKVICELVKELGANPIVGDSSGGMTSKGSRTNRAFQI
FT                   SGIQQAAEEAGAEIVNFDEAGSVEMTSQVQGNTYQFYVAQPVIEADVIINLPKLKTHGL
FT                   TYFTGAVKNMYGVLPGNQKRDLHRKYPDTDEFSRLLSVLYDTVKPDLTIMDGIWSMEGN
FT                   GPSAGTRKDLGLILASKDGVALDEVACNIIGFRPLQVKTTRMAQALEFGTADLGQISLP
FT                   DNISKYRVDNFQLPDTRFVEMVPSWLTRAVINQLRTVPQIDSNSCAHCGICQKSCPVDA
FT                   IKTQRSTNGDKNLYTITPDNCIECYCCHELCPEKAVNIEFRGKLGKLINRLQFFMNFI"
FT   gene            complement(334993..336138)
FT                   /locus_tag="Nther_0319"
FT   CDS_pept        complement(334993..336138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0319"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pmo:Pmob_1665
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83916"
FT                   /db_xref="GOA:B2A582"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2A582"
FT                   /protein_id="ACB83916.1"
FT                   /translation="MQFRTIPKLNISVSALGFGCLRFPIHNNDYENIDEEQTIKLLRHA
FT                   IDNNINFIDTAYPYHGGNSETVVGKALQNGYRDKVYLATKLPVPKMESEEDFDKFLDEQ
FT                   LQKLNTDWIDFYFLHALNPVNWEKTNKFNLLTKLDKAKQEGKIRYPAFSFHAGTELFKE
FT                   IIDAYDWPLTLVQFNYLDEYHQAGIEGIKYAAQNDVGVAIMEPLRGGRLGQNLPHEANN
FT                   LFNSVNENRSPAQWALSWVLNYPEVTTVLSGMNSFKQLKENMTIATDTYPNSMTREELK
FT                   TIEDVKEIYKERIQIGCTDCRYCLPCEPENIPISSIFNLYNELHLFKDQDKAKQTYQKL
FT                   IDGERDGGRCIECGACEQECPQDIHIRSWLNKIHKELQAIN"
FT   gene            336297..336503
FT                   /locus_tag="Nther_0320"
FT   CDS_pept        336297..336503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0320"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: chy:CHY_0155 cold shock protein CspC"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83917"
FT                   /db_xref="GOA:B2A583"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B2A583"
FT                   /protein_id="ACB83917.1"
FT                   /translation="MRGTVKWFDPKKGYGFIEKEDDGEDVFVHFSAIQQEGFKTLEEGQ
FT                   KVEFEVTQGDKGPQAENVVVMEG"
FT   gene            336690..337415
FT                   /locus_tag="Nther_0321"
FT   CDS_pept        336690..337415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0321"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   csc:Csac_2112 protein of unknown function DUF421"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83918"
FT                   /db_xref="GOA:B2A584"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B2A584"
FT                   /protein_id="ACB83918.1"
FT                   /translation="MALTIFLRTVVIYFTILLIMRILGKREVGQLSTFDLVVSIMIAEI
FT                   SVVTIEDETMPIYIGVIPLFTLMSLEVLFVKWGLKNKLVQKLITGTPSVVIERGRILEN
FT                   ELRKVRFDLNDLISQLRQQNVHNIRDVEYAIVEPSGQMSVITKSDKRPVTRQDLNIQTS
FT                   FDGIPVHLIMDGEIEYGHLQELNLSEEWLVSELNKRGFDSPQEIFYACLDTQFNLYVSP
FT                   MDKYAYKQKTPPPSSSSSS"
FT   gene            337661..338332
FT                   /locus_tag="Nther_0322"
FT   CDS_pept        337661..338332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0322"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: amt:Amet_1502
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83919"
FT                   /db_xref="GOA:B2A585"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2A585"
FT                   /protein_id="ACB83919.1"
FT                   /translation="MVTEKFTNIEPEKQDRVITAALKEFSEHGYEKASTNRIVKQAGIG
FT                   KGMLFYYFKNKKELYYYLIDYSIDYVTNEYLGHINENVVDFIERYRQIAQIKMKKYAEN
FT                   PHVFNFLGSIYINKDVKLPQELQKRFIDAREYGYRVLFRNVDTSLFRQDIDSDKILKLI
FT                   YWTLEGYEQEILKKLEGQKLSQIDYEPYWDELDQYLDILKKVYYRQEGGKNDHFDSRQY
FT                   Y"
FT   gene            338301..339209
FT                   /locus_tag="Nther_0323"
FT   CDS_pept        338301..339209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0323"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1003 ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83920"
FT                   /db_xref="GOA:B2A586"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A586"
FT                   /protein_id="ACB83920.1"
FT                   /translation="MTILIADNITKKFGKFTALKKVNLEVKKGEIFGFIGPNGAGKTTT
FT                   IRILLGILKATEGAATIFGKDAWNDAVELHKRIAYVPGDVNLWPNLTGGEVIDLFAKLR
FT                   GSLNKKRRKELIDKFNLDPSKKCRTYSKGNRQKIALISAFASDADLYILDEPTSGLDPL
FT                   MERVFQECVNEAKAAGKSIFLSSHILSEVERLCDRVSIIKEGEIIEAGTLDELRHLTRT
FT                   DVMVETKQAIPSTSLEGFDGVHDIQEQGNRLSFQVDSEKLGVVIKYLSQFDIIKLESAP
FT                   PKLEDLFMRYYSEDRVSSDGR"
FT   gene            339199..340803
FT                   /locus_tag="Nther_0324"
FT   CDS_pept        339199..340803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83921"
FT                   /db_xref="GOA:B2A587"
FT                   /db_xref="UniProtKB/TrEMBL:B2A587"
FT                   /protein_id="ACB83921.1"
FT                   /translation="MADKMYSNTGQLVRFILRRDRISIPIWLTAVILISMITAQGFVEL
FT                   YPTELERQAIAQTMRNPAMTAMVGPGYGLNNYTIGAMMGHQMLLFTAIAVAIMNILFII
FT                   KHTRADEEEGRIEMIRSLPVGRLSNVLSTIIVSFGINVILALCLGFGLFALGIENMELE
FT                   GSLLYGAVVGVTGMIFAASTTLFAQLSANTRSTIGLSFGFLGLAYLVRAIGDVSNETLS
FT                   MFSPLGWVLRSEVYVNNYWWPILLTLAAAFGIVAYSLYLNSIRDLGAGFIPARPGRRKA
FT                   TPFLLSPLGLGLRLQRTSIIAWAIGMLVLGASYGSVFGDLEAFFTDNEIMQQILPPGQG
FT                   HTLTEQFLTLLMVVISILSTVPALMMILKLRGEENKNRTENLLTRAVSRNQLMASMLVI
FT                   SLFTGFIMLLLAMLGLWSAGTVVMEEPIPFYTAFNSAMVYLPAMWVMIGAAVLLIGIWP
FT                   QATVLTWLYLGFSFFVVYLSGILQLPEWLAKLSPFGNIPQLPVEEMNYFSVIVMTVFAL
FT                   VLMIVGFKGYNNRDIQG"
FT   gene            complement(340939..341250)
FT                   /locus_tag="Nther_0325"
FT   CDS_pept        complement(340939..341250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83922"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:B2A588"
FT                   /protein_id="ACB83922.1"
FT                   /translation="MGHEMKRVNLQAKEGEQLNVNIKVHDEKRAIIHGVVVDKDNKPIK
FT                   DAVVLLFKDLNYDPCKVEPYYSTFTDDCGQFIFGPLHPDCDYTIKVWANGSCTFNLYK"
FT   gene            341374..344172
FT                   /locus_tag="Nther_0326"
FT   CDS_pept        341374..344172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_3446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83923"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:B2A589"
FT                   /protein_id="ACB83923.1"
FT                   /translation="MSMIPVTIMTSNENVISISDKENIILKSLGEKKTDVQLIAGNRTC
FT                   WIKLKLVSKKGFDNIFYMTESVKEELMLSDSYQLNLKLTEQGLELGPFLGVLISESKHE
FT                   KLVIGDFDSIYSNFQNWMAQKNGLIYFFTLKDIDINNLIVTGHYWDKDSNWSQKKFPFP
FT                   KVVYDRCFGLEGRADSYKLRSLVNTHGLNTFIYNWPVKIGKLETYESLKTFPYLKGVIP
FT                   PFIDYSRENLQKFINDHKAIILKPDKMYKGKGIASLEKKDEKYILKYSLEDETNESDND
FT                   QIKHEFEDLDSAIQKINEILDISRGYVIQKKITLGTFLGNNFDIRVMLQRRHRYKWEVT
FT                   GINARISPTDSIITSPRSGGKVIAIDKLLKRVFPGKEEYVKNRIISVSKRIGTSLEEKY
FT                   GFIGELGVDLALEANGAISLIEVNSKPLKVSFNRLKNKGLKKRINQIPILLGCELSGFD
FT                   PAKIHPKQKLTSEYNKNDVFQFKKSPNKIIGNELEYPPIYLNNYQIKLFKLNEYDKVEV
FT                   QIGQKSEEMIVKQQNFDSDPNFVYLDSKAYEDFAIPSNTLVKFIAKKGSKLQFGITMGI
FT                   TISSTTFKFLKSNEQGTELDETVHLASQYGVMFYCIDLESIDWNKQTIKGLYYDINSQK
FT                   WRESQLQFPQILYDQATYPGEPVRRQTIKEQNQSLRQNLSELEAINNKRFFGKWETWDS
FT                   VNFFEELKQHLPETRILTSNNLHEMLAKYQMIYCKSNYGSHGTEVVRIYNYNHGYCCEI
FT                   GGKTVETWTFLDKKVLIKFVIELVGENGIVQQPVYLANLNGRPFDMRILAQKDHSNSWS
FT                   LTVISIRIGQKNAVITNVAGGADELIVVPGDKLAYPIPGWEILHEFTTKICDAIEASFG
FT                   MQGEIGLDVAVDVNQQLWLIEANSKPDIAGLNNVMPQIDYRRILSMPILYATYLLDQME
FT                   YG"
FT   gene            complement(344383..345117)
FT                   /locus_tag="Nther_0327"
FT   CDS_pept        complement(344383..345117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0327"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mae:Maeo_0471 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83924"
FT                   /db_xref="GOA:B2A590"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A590"
FT                   /protein_id="ACB83924.1"
FT                   /translation="MTDKVIYNLQNISKTYSDKTVLDIDSLTIRKGEILGLVGPSGAGK
FT                   STLLRILNFIEHTDSGEVHFLGKVYNKDSLPDLHTRRKVTTVFQRPYLMTSSVYQNIIY
FT                   PLKIRKQNYDSQRVEKIINKLGLTQLKNQRADKLSGGEAQRVSLARALIFNPEVILLDE
FT                   PTSNLDPANVKIIEDMIADYRNEFNATVVMVTHNVFQAKRLATKVSLLYKGKIVEINDK
FT                   DEFFTNPKHKVTKQFLSGDLVY"
FT   gene            complement(345110..345814)
FT                   /locus_tag="Nther_0328"
FT   CDS_pept        complement(345110..345814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0328"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ava:Ava_4039
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83925"
FT                   /db_xref="GOA:B2A591"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2A591"
FT                   /protein_id="ACB83925.1"
FT                   /translation="MDAFISGLSEAIELLISFDPYVMNIISVSMMVSGIALLIAAIIGI
FT                   PLGAFLGLTNFPGKHLVVALLYTGMGFPPVVIGLFVFILFSNVGPFGSLEWLYTTRAMI
FT                   VAQSVISFPLVAGFTMTAVMGVNQNLLLQLKALGATRRQILWATVKEARLGVLVSVIAG
FT                   FGAIISEVGAVMMVGGNIAGKTRVLTTAIVLETRQGNFGLAMSFGLILLTITFIVNFIM
FT                   LHFQKRKLIGRD"
FT   gene            complement(345842..346735)
FT                   /locus_tag="Nther_0329"
FT   CDS_pept        complement(345842..346735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0329"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="KEGG: aoe:Clos_2434 extracellular solute-binding
FT                   protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83926"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B2A592"
FT                   /protein_id="ACB83926.1"
FT                   /translation="MRYVCHDIALAYSNEVITIMLQKTLALILGLTLTLTLIGCSEDET
FT                   SVLTMATTTSTEDSGLLDELLPIFGDETGYEVDVITVGTGQALEIGRSGDADILLVHAK
FT                   ELEKEFVNDGYGTERFPVMYNDFVILGPTEDPAKVSEANDLDEAMSLIYQIGKEGDSTF
FT                   SSRGDKSGTHVKETTLWEEFQLDIEGKEWYDSLGQGMGDTLIAANEMRAYSISDRGTFL
FT                   SMEDSIENLQIVFEDDDMLTNPYGIIPVNPDTHENVNYEAANELVEFFVRDDIQQKISE
FT                   FGIEEYGQPLFFPNTD"
FT   gene            346902..347252
FT                   /locus_tag="Nther_0330"
FT   CDS_pept        346902..347252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0330"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: wsu:WS0837
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83927"
FT                   /db_xref="GOA:B2A593"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A593"
FT                   /protein_id="ACB83927.1"
FT                   /translation="MKIKFKLWVENNDGELIIGEGLLKLLLAIKETGSISKASEKLNMS
FT                   YRTAWGRLKKVEDRLNCKLIEKKYGGESGGGTTLTEKGDILLKNYDELYHKTENYVQEQ
FT                   FEEFLDSNFFKD"
FT   gene            347713..348858
FT                   /locus_tag="Nther_0331"
FT   CDS_pept        347713..348858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_1990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83928"
FT                   /db_xref="GOA:B2A594"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2A594"
FT                   /protein_id="ACB83928.1"
FT                   /translation="MFKLFKSFVKMFVILSLLVVLTGCGGEDMTDQKEDSANGEVADEY
FT                   PGEKDVITIVCEEDGEFEFSVEELMELKSVTEDIVRTDDDGEIEDEYPIKGTLFKDLLA
FT                   LIDKDSDNLDAIRLTAGDGYSVKVPDEILENRDVILAYEIDNEPLHEDTRPIRAFIPEE
FT                   EAMYWVSNLVEIELVGYDAEISDQEASTLEEINFLETLVLELDEIDYEGEDEGKAVKTS
FT                   DLFSDLDTTQDVYLLASDGFDKNEEYKTFIDAYILTEGDNTPAFRSPELPRGMHVRDLV
FT                   WILTGETGFFSVEQGMEKFEEMSVEDDTGVSLKDLVDKFGLSESDKYELEAIDGYSVEI
FT                   DREDLSSGIVYIRDSGEVSSAFDGLPRSKAVKDLLSIRPVK"
FT   sig_peptide     347713..347793
FT                   /locus_tag="Nther_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.648 at
FT                   residue 27"
FT   gene            348894..349445
FT                   /locus_tag="Nther_0332"
FT   CDS_pept        348894..349445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_1953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83929"
FT                   /db_xref="GOA:B2A595"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:B2A595"
FT                   /protein_id="ACB83929.1"
FT                   /translation="MAAINTILKRFSIFDLIVISLMAGLGLATKPVIVPLAHIITGPLF
FT                   IPGGVVAGGFYMMWIVIGAGLVGKLGTATLIAAVQAIVIMAIGFLGTHGFMSLFTYILP
FT                   GLAVDLIFLVSRHRGCCIGCCFVAGIAANISGTFLVNLVFFRLPFIPLVLSLSAASLSG
FT                   GLGGIIANAVVKQFKSKLQI"
FT   gene            349473..351020
FT                   /locus_tag="Nther_0333"
FT   CDS_pept        349473..351020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0333"
FT                   /product="metalloenzyme domain protein"
FT                   /note="PFAM: metalloenzyme domain protein; KEGG:
FT                   swo:Swol_1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83930"
FT                   /db_xref="GOA:B2A596"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2A596"
FT                   /protein_id="ACB83930.1"
FT                   /translation="MLILDKKINWNIKRYKKLVVVVIIIPIIFSLLFLGCSRDDTSQEE
FT                   SKDIDYIQPLEIVGDVEDFVSIENINDISDTVSLEHREEELEALPLNKLLDKSQPYTED
FT                   FKVLYVSHDGFSASISSDNLDECYIAFTQENGWEAINNNHPVSSNIKDIESIAVVANNL
FT                   SLEDGFNIIKPGENITSISPGEIYKNGYHVSTMYRGSSSVSQNGEDLEASTFNRKKIID
FT                   IENYVTLDDSDEIIVVGKKGEVENYRQDGTFVLNKNNIGYMAGDDIEIDQAAGIVLDPP
FT                   DKMITEVYHDSKELLTQDEQVLLILIDGLGYHQYEYAIDNGYAPFLKELPAPEKAMVTY
FT                   PPVTPVNVASSLTGELPHINGVYKRGIRRTEVPTIFGYCEDHGKKSTAIIGPKGTIELE
FT                   IDPILSMDGNDDGSTDYEKTENALNEMSKDYDLMFVHYKDVDIVGHDYGDMAEETMEAI
FT                   AWNDKLVEELVTTWEGKVIIYADHGMHETEEGGDHNSLMTEDMFMPYWKFDGGEIND"
FT   gene            351013..351525
FT                   /locus_tag="Nther_0334"
FT   CDS_pept        351013..351525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_1958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83931"
FT                   /db_xref="GOA:B2A597"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2A597"
FT                   /protein_id="ACB83931.1"
FT                   /translation="MTKKVLAATAVLIVIVVVFAYLNAAESEDRLQSQREAEIYLKSDG
FT                   EDIATVEFEDILELDEHEFEETLRSSDSPDRDNMYTGILMKDLIEEYDISLSDSEQVVT
FT                   RAADGYTVALTPDEVLDEENVYIVYKVNGEPLSPKEEGGSGPYQVIIRQDEFGQRWNKF
FT                   LMEIDVN"
FT   sig_peptide     351013..351087
FT                   /locus_tag="Nther_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.884 at
FT                   residue 25"
FT   gene            351522..352208
FT                   /locus_tag="Nther_0335"
FT   CDS_pept        351522..352208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0335"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: swo:Swol_1952 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83932"
FT                   /db_xref="GOA:B2A598"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A598"
FT                   /protein_id="ACB83932.1"
FT                   /translation="MSFPVEINNLGFRFPSNSSDLLQNINLKVKEGEVLAIVGLSGCGK
FT                   STLCYCISGIIPLIKQGVMEGEVLINGRSTQELSLSQIATNLGIVFQNPETQLFSPTVE
FT                   DEIAFGPENLCFARDAIEKRVDESLKKVGMEQQRYKNPHHLSGGQKQLIALASVLSLNP
FT                   KILIFDEAMSKLDPDGKKMIKDLIIDLKNEGRTIIMVEHDMANLNIADRVKLLDGGKLT
FT                   DFTGSL"
FT   gene            352285..352971
FT                   /locus_tag="Nther_0336"
FT   CDS_pept        352285..352971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0336"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: SMC domain protein; ABC transporter related;
FT                   SMART: AAA ATPase; KEGG: swo:Swol_1951 ABC-type cobalt
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83933"
FT                   /db_xref="GOA:B2A599"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A599"
FT                   /protein_id="ACB83933.1"
FT                   /translation="MIKLIRVDNVSYSYNGTEQVLDGMNLTLSDGKLTALIGANGSGKT
FT                   TLGKLMAGVLQPTSGQVLIDDKDTREMSLGEIGKRIGYLFQEPDRQIFAPTVEEELSFV
FT                   LKVRGFSDNEISELVNDMLSLFHLDHLRSSFPFYLSKGEKQRLALASILINKPDFLILD
FT                   EPTTALDIKRKSELLEILKKLLDNDVGMLIISHDYEFVTQYADRIIKIAGGEIISDTRT
FT                   SAEQSI"
FT   gene            352937..353707
FT                   /locus_tag="Nther_0337"
FT   CDS_pept        352937..353707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0337"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: swo:Swol_1950
FT                   ABC-type cobalt transport system permease component CbiQ
FT                   and related transporters-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83934"
FT                   /db_xref="GOA:B2A5A0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A0"
FT                   /protein_id="ACB83934.1"
FT                   /translation="MTHEQVQNNQYDPRTKLFIVMCLSSLAVFLEDLVLMTGVLIVALG
FT                   ISFYFQSEVLKAIYKLRKFLWIFVAMVFIQSIFTSGGEELFSIGDITVLSSLGVTRGIS
FT                   IILRIMIILVSATIMGTSSSRDIVQGLYQWKIPYELAFMVAIAIRFLPLLKEEAVDIIT
FT                   AIQLRGLELEKVPWGKKIKIYSYLIMPMISSVIVKSRELAIAVEMRGFRAYPTRTSYRV
FT                   LHLSIKDYAVMFSAGLITAAILSIYFGDFINLAG"
FT   gene            353719..354486
FT                   /locus_tag="Nther_0338"
FT   CDS_pept        353719..354486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0338"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="PFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis MobB region; Fe-S cluster domain protein;
FT                   KEGG: tko:TK0934 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83935"
FT                   /db_xref="GOA:B2A5A1"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A1"
FT                   /protein_id="ACB83935.1"
FT                   /translation="MRVLSVAGITGSGKTTIIENIITELTKRRYSVGSIKEIHYEKFAI
FT                   DEEGTNTDRHYKAGADLVTARGYFETDILYKKRLSVQDILRQYDHDYVVLEGVEDFFVP
FT                   KIISAHNIEEIEAKLDETVFAISGRISNEIEEYQGIPVINTITNIDQMVDLIEQKVFPA
FT                   LPNLPEKCCGTCGYSCKELTGEILRGERDRNDCPIGSENSVQLKVDGHEIDMVPFVQDI
FT                   LRNAVEGVVKELDGYKKNARIEITIGDKNGTSR"
FT   gene            354470..355174
FT                   /locus_tag="Nther_0339"
FT   CDS_pept        354470..355174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0339"
FT                   /product="Mn2+-dependent serine/threonine protein kinase"
FT                   /note="KEGG: mth:MTH915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83936"
FT                   /db_xref="GOA:B2A5A2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A2"
FT                   /protein_id="ACB83936.1"
FT                   /translation="MVLPDNFIKNWQIKDYDFVQQFKSKKNQVLKLKVITKNNEEHFLV
FT                   CKSFTNYRKYYQELSTLNKLSKIDAPVPRLLYSSNKIIITEYIDGFLLVDELFKGGNSL
FT                   INELGKTLERVYNALAVDSYKNNVILGDMNLRNFIIDKNKNKIYRLDFESVEKGHLSKD
FT                   IGKLCAFCISYDPPFTDYKLNLTKELFDYFKNRFLLSSSFITNEVLIELSNIEKRREIV
FT                   VPEKVKYNIYKW"
FT   gene            complement(355266..355475)
FT                   /locus_tag="Nther_0340"
FT   CDS_pept        complement(355266..355475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0340"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: mma:MM_0224
FT                   molybdenum-pterin-binding-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83937"
FT                   /db_xref="GOA:B2A5A3"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A3"
FT                   /protein_id="ACB83937.1"
FT                   /translation="MQISGRNKITGTVTNVNPGTVNSEVEIETPGGDKIVGMITKSSQE
FT                   SMKITEGEQITALIKASSVMFIKE"
FT   gene            355784..356476
FT                   /locus_tag="Nther_0341"
FT   CDS_pept        355784..356476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0341"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   chy:CHY_1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83938"
FT                   /db_xref="GOA:B2A5A4"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A4"
FT                   /protein_id="ACB83938.1"
FT                   /translation="MRIFKEITIEVLQAVLPLTIVVFLLQVVALSSPAEEVLQFLVGLI
FT                   FVVLGLILFLVGIRIGLLPMGESIGNSIPQTGKLGLVVFYAFLLGFLVTAAEPDVRVLA
FT                   SQIDMVSDGAIPHHVLIYTVAIGVGVFVSLSMIKVVLDIPLKYILIVCYIGVFIMSVFT
FT                   PTYFVPISFDAGGVTTGPLTAPFIIALGVGVSSVLSSRTTANDNFGFVALASIGPIIGV
FT                   MILGVIYG"
FT   gene            356473..357234
FT                   /locus_tag="Nther_0342"
FT   CDS_pept        356473..357234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0342"
FT                   /product="protein of unknown function DUF1538"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   chy:CHY_1193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83939"
FT                   /db_xref="GOA:B2A5A5"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A5"
FT                   /protein_id="ACB83939.1"
FT                   /translation="MSEVVIFEGLWNTIIEVFIALLPLIAFFAYFQLVYLKLPRVEVAN
FT                   MAKGVILTFLGIVFFLQGVHVGFLPIGELLGQGLVQHTEKWFVIPVGFILGAVATFAEP
FT                   AVRALSDEVEKVSAGYIPQIILLVTLSLGVGLSIALAMIRIIVGIPLMYLLLPGYGLAL
FT                   ATTFITKENFVSIAFDSGGVATGPMTVTFIMAFSVGVASEIEGRDPLIEGFGMIALVAL
FT                   IPILSVLILGLIYSRKEKQDERDLEYEEKES"
FT   gene            357197..357556
FT                   /locus_tag="Nther_0343"
FT   CDS_pept        357197..357556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0343"
FT                   /product="PII family protein"
FT                   /note="KEGG: chy:CHY_1194 PII family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83940"
FT                   /db_xref="GOA:B2A5A6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A6"
FT                   /protein_id="ACB83940.1"
FT                   /translation="MNETLNMKKKNHSVIVTIVKKGKAKKICQVAKDAGAKGGTTLLAR
FT                   GTSIKDFRKVFGISIDEQRAVVLTIVKQELEDKVFEEILDKCELNKPGTGITFIVDLKK
FT                   VDGIAHLLKEASQND"
FT   gene            357549..357929
FT                   /locus_tag="Nther_0344"
FT   CDS_pept        357549..357929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0344"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="KEGG: chy:CHY_1194 PII family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83941"
FT                   /db_xref="GOA:B2A5A7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A7"
FT                   /protein_id="ACB83941.1"
FT                   /translation="MTERCRGKECKIKFDLIITIVNKGRSRLVVEAAKNAGAEGGTVLG
FT                   GRGTGVREKAKLLGITIEPEKEIILTLVPREDAEDILDAIIKEAELNKPGKGISFILEV
FT                   KRVAGITHLLDDELRDKLEDNL"
FT   gene            complement(358066..358842)
FT                   /locus_tag="Nther_0345"
FT   CDS_pept        complement(358066..358842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0345"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   amt:Amet_0452 heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83942"
FT                   /db_xref="GOA:B2A5A8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A8"
FT                   /protein_id="ACB83942.1"
FT                   /translation="MNILKQGIGKLIYVTSLTIYKFFDLIIIFLEASVSLVKSIMSLFF
FT                   GLVMVGGCFLLLILIGPVTLTLLTNPRLLITVIFLLIYPLLGTILTAYSKYLKYMITEY
FT                   LFDYANFLIDGKERRFNSFLKYGEEYKRFEYERKERERRERQYQQQKQWEETFRRWQQQ
FT                   SGYGQGHYGQYNWHGNHNTHTNPNVNLKQKYEESCDILNVDYNADKDEIRKAFRKMAKK
FT                   YHPDINDSPEATKTFKKINNAYEFLSDNIERYKNIQ"
FT   gene            359147..359443
FT                   /locus_tag="Nther_0346"
FT   CDS_pept        359147..359443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH2143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83943"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5A9"
FT                   /protein_id="ACB83943.1"
FT                   /translation="MTVLIVGGDKVDKIKEYLEQEVGATRVKHVTGRKERSMELPSELD
FT                   LVLTDFINHNLCKNIKCQAKEKCVSTLFSKRSLACITKSIYCWKGGGCKGLHS"
FT   gene            complement(359478..360359)
FT                   /locus_tag="Nther_0347"
FT   CDS_pept        complement(359478..360359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0347"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aeh:Mlg_1916 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83944"
FT                   /db_xref="GOA:B2A5B0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B0"
FT                   /protein_id="ACB83944.1"
FT                   /translation="MRLKGVGFIMLAAICWGLSGGIGDILMNKGWDPIVISFYRGAVGL
FT                   VCFFAWFLLRSGQNWISSTHFHIWSVLAGVGVAGNFTFYFLSIELSSVAVAVTLMYTAP
FT                   VFVLLISILLRLEPSTWFKWGSIFVVLMGIILLTGAYNIGSISSSFSFLGTAAGIAAGL
FT                   SYTLFIFGFKNASSVGKPQASLTTAFFSFCLILFMIMDKGQAVQVLTSRDIGWFILLGI
FT                   MGAGISFILYVIGIRRTTPTNASMVAMVEPVTASLFGVFLIGDSLTFMQLLGMALILVT
FT                   TTLFSVKQTTEN"
FT   sig_peptide     complement(360297..360359)
FT                   /locus_tag="Nther_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.491 at
FT                   residue 21"
FT   gene            complement(360510..361439)
FT                   /locus_tag="Nther_0348"
FT   CDS_pept        complement(360510..361439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0348"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: amt:Amet_1196 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83945"
FT                   /db_xref="GOA:B2A5B1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B1"
FT                   /protein_id="ACB83945.1"
FT                   /translation="MRPIELTSDKIGYVLVFLGASMWGTTGTIGNPIFETNLDTMQIVS
FT                   AQTSIAASTLIVYLFITKPGLLKIKFSHIPFFIMFGLITQVIYAYSYFNAIRYIGTTGA
FT                   VILSFTAPIFVCLYSRCFLDEKLTKEKILGLTFSIIGCFLTVGGFNIDQYDITPLGIAF
FT                   GLMTGLSFASYTVMGKIALSDYSSLTVTTYSLFFGAITLSVFYPPVGGYLSDFDTTLWL
FT                   SILGLGLIPTVLAFIFYTNGLDKIESSKASIISTAEVISATILAYLVLGEEFTPLRVIG
FT                   IFMVIIGVIVTRTSSTSSLKELVSKPTR"
FT   gene            361953..362675
FT                   /locus_tag="Nther_0349"
FT   CDS_pept        361953..362675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0349"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cno:NT01CX_1191 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83946"
FT                   /db_xref="GOA:B2A5B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B2"
FT                   /protein_id="ACB83946.1"
FT                   /translation="MLKLDISNIEKKFESVQAISEFSTTIHGGQIVGLVGPNGAGKSTL
FT                   LKIIAGFLEVTQGSVNIYKADDPYSKSSVSYMPERPDLFPVLNVWEHFKFMGIAYNISD
FT                   WEIRAKSLIERFSLYDKETAFAGELSKGMKQKLMLSLSLLREPEIILLDEPFSGLDPHS
FT                   TYQLRELISQLKSDNRIIFVSSHSLNDLYRLSDKILIINRGQLIRDQSKESIMAELKKK
FT                   DYLSIEDLFLEVTDYECR"
FT   gene            362662..364212
FT                   /locus_tag="Nther_0350"
FT   CDS_pept        362662..364212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83947"
FT                   /db_xref="GOA:B2A5B3"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B3"
FT                   /protein_id="ACB83947.1"
FT                   /translation="MSAVKALLYLEKRSIINRIKEAKKFKLQVLGMLLFGIAVIFSFVS
FT                   SNYSHSTDISEWFVIYSEELIYLLIIITIGLNIAIGSKRIPLQVPYASNQLIFEITSST
FT                   KIIIGYFFGKQLLFNVITTLVATYALIIFLTDGILTTGMVITWLGLLLLNIWSQSLALL
FT                   TYGIKKRFNINIELIFIIIGVSIGSYVLTKLIIDGPTSLIETWGELINNFLWPLEWLFN
FT                   LISFGFFTRLDLPYIDILLGIILIGLTIVLAFKCLPNSREPIITAMLSSQRISESTNDE
FT                   MDIQEALMTISRPNPGQLISRLNIGTGFLSAIVWKDLIYWERLKLNELKLVLIAVTVVS
FT                   GGLGWIVAYFNLSMWLILLPIIYSSWNGGKAAIELKRLLIYQLPTKGWKKILSVSIFPI
FT                   IENILNHIIAIIVFGTFVFLGSGNLEFQKLFSILIVGIGMNILLTILGLIVNLATIDLI
FT                   GFYRKIIQLLIMALHFTTIIAIANLVLWNPLVINLLIGLILLYSFVFLIFTSKWCLKL"
FT   sig_peptide     362662..362817
FT                   /locus_tag="Nther_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.702 at
FT                   residue 52"
FT   gene            complement(364329..364859)
FT                   /locus_tag="Nther_0351"
FT   CDS_pept        complement(364329..364859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0351"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   aoe:Clos_2018 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83948"
FT                   /db_xref="GOA:B2A5B4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B4"
FT                   /protein_id="ACB83948.1"
FT                   /translation="MGKEIVERGHELENHSLTHPHMTNLEKEQIEHEVERVHHQIVDLT
FT                   GHEPELFRAPFGDYNNLLIDTLEEMNYYPIQWSLDSMDWQAPDADYIEKKVMDDVGAGD
FT                   IILFHNNATYTPEALDTILEQLIGEGEEEGYEIVPISELIYKDNYEIDTNTGVQKHEST
FT                   SIDLENSDLDEND"
FT   gene            complement(365186..366397)
FT                   /locus_tag="Nther_0352"
FT   CDS_pept        complement(365186..366397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0352"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pyo:PY02999 guanylyl cyclase enzyme Pfam:
FT                   Guanylate_cyc PROSITE: ASN_RICH LYS_RICH PHE_RICH NLS_BP
FT                   GUANYLATE_CYCLASE_2"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83949"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B5"
FT                   /protein_id="ACB83949.1"
FT                   /translation="MYDMYKKPLILLGFILLLLITGLVIPIEETSEADSDDDYLTIKEI
FT                   NKIAEEKAEKYSDYDVLELATKDEYKGLDTSIEFNDNIHNNREYWINYHLKAHDYGAKY
FT                   APNEEEIKKNLFIMDLLDLELRLPQTKYDTVTPGIDYEEYQHFRNYLPDEFDADKIKRE
FT                   ENKQYVEEITKTKEYLKNSSIFDFRSRSFELLGDSSTITWKLKEHFSDEKSQVNFMTTP
FT                   DLMNFISKDNTMSLKTIAGYIIIKTSDEDNKFDVPADERPYKVPVHVYLESKSNEEQEK
FT                   IIEENDVGFWDISLYAHKFNKISHLEIIDNEHLSTEKVDCKRTIEYYFPYEKMEQIGYE
FT                   EIIPKLRRTPRYMNNSSPNHYHAIKPFRWHEQRPHVLYHVYEDITPSYIEIDDPDVLNE
FT                   MFFY"
FT   gene            366599..367540
FT                   /locus_tag="Nther_0353"
FT   CDS_pept        366599..367540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83950"
FT                   /db_xref="GOA:B2A5B6"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B6"
FT                   /protein_id="ACB83950.1"
FT                   /translation="MDKKVIIGLILIVAAVVMAFTGNSYHSSGYETYLLKDMEEGESMM
FT                   RMGNILQYTGYGIGAVGVALLIAGFVGVQLPVNKGSKKEERTEEVAEVSKSEPSTNQPD
FT                   SGQEEKTTPIKQNVTESQEKARKMLDYTKSSASTYFNFVKSFLKDPYIYLNDQDLSFKK
FT                   EGLITLASVVVVTMLYRMSDLVFTPRSPEFTQIFTSMIGEGFTLAISIGLLLFIGKAIL
FT                   EKWEYKQISLDYMIEKIGLVFIPVLVLMGAALVLNPFGIGLDSYLFRLANILQFIGIFY
FT                   LGIVELHKEKIYTPLSLVVVYFLVFNILGSIV"
FT   sig_peptide     366599..366658
FT                   /locus_tag="Nther_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.936 at
FT                   residue 20"
FT   gene            367571..369181
FT                   /locus_tag="Nther_0354"
FT   CDS_pept        367571..369181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM_0066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83951"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B7"
FT                   /protein_id="ACB83951.1"
FT                   /translation="MLLKWENLNLPKLKTSAIALALIGFMSFIITGCSGDEEVGDIIVP
FT                   EDYETIQEAIDASEDGEIIMVEPGTYEETIDFKGKDITLMSTDPHDEEVVSETIIDGGG
FT                   DGSVVTFQSGESKDAQIRGFTITGGTGTEIELKLIPDSDEVAESWILGGGVLIDDDSSA
FT                   AIKHNKIHDNYATYGGAITVSNESDAVVEDNMIKDNKTEFDASAIQVVKESDIKISDNV
FT                   ISNNISEDGVSTISAYSHSEALIDNNNIKDNSTKLGVTILANYKSELQVKDNIIENNFA
FT                   EVSDVDSRLEGMRQIGYSQPSGSVLINSSTATIKSNVISDEDEMTGISIKSDQVPVVTE
FT                   KGEVESEFKIPEVLVKENEITKNWVSGIYTLDAEVDIINNLIHNNNSFGISSLDNTTIN
FT                   ITDNEIVDNRGSGVYDFRSKEGVLKNNKIKRNVAREIEELGFDEPDGGGVLIMHGGYEW
FT                   KIIGNDIVGNEAEGFGGGIALTNSATYEDHIIEDNHIVDNKAQIDGGGIFSLEMGDKDI
FT                   FLGDNEIESNVPNDIAESQ"
FT   sig_peptide     367571..367678
FT                   /locus_tag="Nther_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.834 at
FT                   residue 36"
FT   gene            369322..369654
FT                   /locus_tag="Nther_0355"
FT   CDS_pept        369322..369654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0355"
FT                   /product="TM2 domain containing protein"
FT                   /note="PFAM: TM2 domain containing protein?; KEGG:
FT                   mmq:MmarC5_1652 TM2 domain containing protein+B7201"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83952"
FT                   /db_xref="GOA:B2A5B8"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B8"
FT                   /protein_id="ACB83952.1"
FT                   /translation="MYQSIQVKNPGVAAVLSFLWAGLGQIYNGQIGKGIAIMIVQVINA
FT                   FLIFVMIGFITYPIVWIWMIYDAYKTAERINKEQQEYYSTQFQGQSPGQGVQQSTLDTD
FT                   SNEQQE"
FT   gene            complement(370877..372166)
FT                   /locus_tag="Nther_0356"
FT   CDS_pept        complement(370877..372166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_480920 hypothetical protein PROSITE:
FT                   GLU_RICH LYS_RICH SER_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83953"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5B9"
FT                   /protein_id="ACB83953.1"
FT                   /translation="MQDIYKKPLILLGFILLLLITGLVIPDEEKSEADSEEQHASDSHN
FT                   QGDTSDEKGGKEKFLTIEEINEIAEEKAEEYSNYDLLELTRKDDYKGLETNLETRAYDE
FT                   QFNNREYLYKQLLRARDYGAKYVPDDETMRKNLFIMDLLNLQTKLPQPEYDTVVPGIDY
FT                   EEFQHLKNNLPDDFKKDKLQYNDGEELSDRLINPSTEFLYASNENNDIDSRFIELNMTF
FT                   NDFNDSVYHKFNDDKTQAEFVSSPDLINFIENASGSSDLTSMIGFLIIKTADEDNQFDI
FT                   PADENAYKVPIYLYIEPIPRDKQFEKMEEKDLKFGEAHKIGHKINEIIHFEIIEDDNLP
FT                   IKEVDSERTLEYYFPEETMEENEYYREEFFYKMRAHPQYRNRSIYGDEMLPARWHEQSP
FT                   ARIVSIFRTIQDDHRIPIDDPDKINSLFFY"
FT   gene            372561..373091
FT                   /locus_tag="Nther_0357"
FT   CDS_pept        372561..373091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0887 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83954"
FT                   /db_xref="GOA:B2A5C0"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C0"
FT                   /protein_id="ACB83954.1"
FT                   /translation="MLKKLIRIFLSTGIPFGILMGIFTSLRHGMSGVVSGLLAGAIFGG
FT                   FMAGVLGYLHNRSVKQKTINRSESDYDVKQSKEIELPVSYEKAYDLCIESLDKLNKAEI
FT                   ENKDHSQGVITAKTGKTWDTWGDTVSFVLTDKSDNVTNVLVSSEPTHYQVVDYGKNLEN
FT                   VNTIIAYLKERGV"
FT   sig_peptide     372561..372650
FT                   /locus_tag="Nther_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.784 at
FT                   residue 30"
FT   gene            373467..374267
FT                   /locus_tag="Nther_0358"
FT   CDS_pept        373467..374267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_C0041 probable ATPase of HSP70 class,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83955"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C1"
FT                   /protein_id="ACB83955.1"
FT                   /translation="MIVAVDAGNYETKVVNSHGKYSFYSDIGEYRERKLNQKHGSDDME
FT                   WEYQGERGFAGSLAKFESEYGGSMMGDSKYHRDGLLRVLLALHQYCDDNNFKIVVGQPI
FT                   SSHTQAEKQRIKEMLEGDHILTVNGVKKTIRILNCQVAAEGASAFWIHPQGGCVRMLDI
FT                   GSGTINAATILDRRYVDKDSFTINFGANSNLTNDVKEMANAIIRKSHKWNKDDRVWLIG
FT                   GIAEEIEPYLTGHFKNLKVLKPNGLHSKWANVLGYYALASGLYE"
FT   gene            374260..374484
FT                   /locus_tag="Nther_0359"
FT   CDS_pept        374260..374484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83956"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C2"
FT                   /protein_id="ACB83956.1"
FT                   /translation="MSKKIKIRSVAFNLNDPDQAKMFEHASKRTNFSSYIKRLIQRDIE
FT                   GGIHQNEEDVKPEEMSIDDEDKKFMKDFI"
FT   gene            374512..375042
FT                   /locus_tag="Nther_0360"
FT   CDS_pept        374512..375042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83957"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C3"
FT                   /protein_id="ACB83957.1"
FT                   /translation="MTREKGKVIEFPISRVTNQEDLHHEEELEDEIYEDDEPDEGVSSE
FT                   VIEYEVIEEPPKLHHKNNLKFQDMLLHKIRAHRKKSNLELSREEKIRQVAYIFENEFYY
FT                   LGSAFSVELSLINCRQTGLKILLLLEREHKRMYGRSLINNSSVDDLKSSVKDFVFGYIA
FT                   CQKDRKEPTHVPF"
FT   gene            375306..375638
FT                   /locus_tag="Nther_0361"
FT   CDS_pept        375306..375638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lac:LBA0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83958"
FT                   /db_xref="InterPro:IPR018597"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C4"
FT                   /protein_id="ACB83958.1"
FT                   /translation="MSAKETMDIIFQILERLEKAMDEEQFNWEKEISHEALDISETRWT
FT                   LIIEMMEENNLIKGLNIDRGAKGDISISIHSPRIRLQGLNFLIENSQTAKVINAAKLLK
FT                   DTVPGL"
FT   gene            375718..378969
FT                   /locus_tag="Nther_0362"
FT   CDS_pept        375718..378969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0362"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: cth:Cthe_0521
FT                   helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83959"
FT                   /db_xref="GOA:B2A5C5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C5"
FT                   /protein_id="ACB83959.1"
FT                   /translation="MSQIKMLDNKRNGKVGEELKKNIKKGSKLSVISAYFTIYAFKELY
FT                   NELKKVDEMRFIFTEPSFTKDKQEEIKRQYFIDRSTESKLSGNEFEIKKRNELNQAYIA
FT                   KECAEWIKNKAEMKSLKEKNPAHQRLIFLENPDDNLSINGTVDFTADGLGFSTSNRNDM
FT                   NTCINGQEETLHFLQQFDELWNDESQVEDVKDKVLEQMQVIYKENTPEFIYFVTLYNIF
FT                   YEYLDELTEENIVKTQTGIKNSSVWNKLYKFQRDGVVGAIDKLEKYNGCIIADSVGLGK
FT                   TFSALAIIKYYELRNDRVLVLAPKKLRENWTIYTQNDTRNLLVKDRFNYDVLNHTDLSR
FT                   YNGYSGEINLETVNWSNYDLIVIDESHNFRNSNPRKDKPSRYSRLLNEVIKSGVKTKIL
FT                   MLSATPVNNRMNDLKNQIAFITEGEDTAFKSAGINSVEQTLRKAQLVFNKWQELPSSER
FT                   TVDKFVEMMNTGYFKLLDTITIARSRKHIEKYYDINEMGKFPVREKPKNIYSEIDTADE
FT                   FPELQYVNKKIRNLNLSAYSPLKYVLPEKREEYSAKYDMEVKDGKSIFKQADREQALVN
FT                   LMRVNILKRMESSINSFGLTVSKLLQQIDNILEKIERNNFDYEEDLSIEDIEVDDDAYE
FT                   DLLIGSKIKVLLQDLDLIRLKEDLEDDKSILEELLIEAFKINEERDAKLNELKEVISNK
FT                   ISKPINKGNKKVVIFTAFADTAEYLYEKISSWARDEFGIHSALVTGTGSNQTTLKKIKR
FT                   KDLNAILTNFSPRSKERDSVYPHIKEDIDILIATDCISEGQNLQDCDFLINYDIHWNPV
FT                   RIIQRFGRIDRLGSTNESIQLVNFWPNLDLDEYINLEARVSGRMVLLDISATGEENVIN
FT                   TDDKDKMNDLEYRKKQLQQLKEEVIDLEEISGGISITDLTFNDFKMDLMEYMKNNRAKL
FT                   SKAPLGMYAIADNSELDEEAKPGVIFTLRQVYNSAKPEENNPLYPYYMVYVLEDGSVKY
FT                   TYIHTKKVLDIYRKLCKGKNEVIHDLVGAFNEETKDGKYMDQYSELLEKAINSIIGKTQ
FT                   EKGVASLFSKGGTTLQQNLFSGIEDFELISFLIIK"
FT   gene            378978..379730
FT                   /locus_tag="Nther_0363"
FT   CDS_pept        378978..379730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83960"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C6"
FT                   /protein_id="ACB83960.1"
FT                   /translation="MKEILSENMKVPDSCEVNKPIYKKLFYENAYLGKKDQELLSKNIE
FT                   KITWLYSFKPDTINILPYNDKEREYEEIAVIEVLLREQSHIKRIAEIIQLTIPYPLIII
FT                   FNYGQKILFNVAHKRVNMSDESRNTYEELIFTDWVDLASLNKNDKKFIKSLDITKFSFT
FT                   NFYWFYSDFVDRINIFNVSLYADEYLLEHDANDLKQIHDEIKDLEQRISQLQSDLKKED
FT                   HFNKKVKMNVEIKKLKEEKKNLIDKLNS"
FT   gene            379761..381674
FT                   /locus_tag="Nther_0364"
FT   CDS_pept        379761..381674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0364"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   cth:Cthe_0519 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83961"
FT                   /db_xref="GOA:B2A5C7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C7"
FT                   /protein_id="ACB83961.1"
FT                   /translation="MKKFNGESKDIVAENISKLKELFPEVESEGKIDFERLQEILGEYI
FT                   EDKEEKYRFEWNGKSKAIKLSQTPSTGTLRPCKEESKNWDETENLFIEGDNLEVLKLLQ
FT                   KTYHSSIKMIYIDPPYNTGGDFVYEDDFQDNLNNYLKITGQINEEGKKNSTNTENGGRF
FT                   HTKWLNMMYPRLKLARNLLNDQGVIFISIDDNESGNLWKVCNEIFGETNFVAEITVIVK
FT                   TEGRRYGFFAKSHEKIYVYAKNIDNLALNEIDIKGKKFTYRDEFGGFNIKELRNQNTRA
FT                   FNSSNRPNLRYPFYVNTDNVDENGFMEVSVDYQEGWEEVYPMITNGLKSVWRWGKESAR
FT                   QQENKNLVARRGRDGIIRIYQKYRKLTEIPKTVWKDKEIISIKGTKEVQELLGSGIFDF
FT                   PKPVKLLSDIITIATDQDSIILDFFSGAATTAHATIKKNAEDGGTRKYIMVQLPEKSDE
FT                   KSEAYKAGYKNISEIGKERIRRAGEKILDENKDKEGIENLDTGFKVFKLDSSNLKEWNP
FT                   DYDNLEMTLEDMVENFVDGRTEEDVVYEIMLKYGIDLTFPIETTEIDGKKVYNIGFGAL
FT                   FVCLDDEITLNVVKSIAKLKEDIDPEITRVVFKDNGFQSDAAKTNAIEILKRHGIEEIM
FT                   SI"
FT   gene            381686..384622
FT                   /locus_tag="Nther_0365"
FT   CDS_pept        381686..384622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0365"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: cth:Cthe_0518 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83962"
FT                   /db_xref="GOA:B2A5C8"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C8"
FT                   /protein_id="ACB83962.1"
FT                   /translation="MKLQFNPNLDFQQEAIRSIVDIFEGQPITHSNFTVANLSGQIGIH
FT                   ETNIGVGNKLDPSFDEEDILKNVRKIQLRNGLPQTENIEKDDYHFTVEMETGTGKTYVY
FT                   LRTLFELNQKYGFKKFIIVVPSVAIKEGVVKSINIMSDHFKLLYDNVMFRAYEYQSQNI
FT                   ERIRDFATSDHIQIMVMTIQSFNKDKNVINNDHERTNGLKPIEFIRDTNPIVVIDEPQS
FT                   TVSTKKAEDAVMSLNPLCTLRYSATHRKKHNLMYKLDAVDAYQRQLVKQIEVASVTSKD
FT                   YHNDAYLRLVSVDNSKTPITAKIEIDKRTKNGGIKRQSVQVKKGDDLFEKSGGREQYSG
FT                   YIVSEIYAKEGSEYVDFTSRKHIELGEVRGELDDEVIKRTQIRKTIEEHLEKELRLKQE
FT                   GIKILSLFFIDRVSNYRYYDEEGNPQKGKYAIWFEEEYKDIIQKPKYRTLFNDVDIETE
FT                   AEAVHNGYFSKDRKGKVKDTRGNTQADEDTYNLIMKDKERLLDFNSKLKFIFSHSALKE
FT                   GWDNPNVFQICTLNETKSEIKKRQEIGRGLRLAVDQNGERRHGFNINTLTVMANESYED
FT                   FAKALQKEIEEEEGIKFGVVEKHTFANLKVEREGEYQYLEQNASEELWNDLKSKEYIDD
FT                   QGKITDKLKEDIKNKNFEVPEEYKEVEDQVVATLKKIAGSLRINNADDKKEIKLNKQRY
FT                   LSPEFKELWDRIKYKTTYNVEFDTEELIQECVEEIKKNLMIDKAKVIYTKGEVDISAAG
FT                   TVAEEKGRYAMVVDDAKFRLPDIITYLQNETSLTRKTIVRILKESGKLYQFKNNPQKFM
FT                   DEVSKIIKTKMRHLIVDGIKYEKIGEEAYYAQELFENEELFGYLSKNLVKSEKSVYDHV
FT                   ICDSDVEADFAQKFENNDLVKVYAKLPDWFKIDTPLGDYNPDWAVLIDKDGEERLYFVV
FT                   ETKGSVLFEELRPREEGKIKCGEKHFEALGNHIEFEKKDNFEEFIENV"
FT   gene            384658..385462
FT                   /pseudo
FT                   /locus_tag="Nther_0366"
FT   gene            385493..386404
FT                   /locus_tag="Nther_0367"
FT   CDS_pept        385493..386404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0367"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   sth:STH1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83963"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5C9"
FT                   /protein_id="ACB83963.1"
FT                   /translation="MKKFTMGLIVGILLSLSVSGTASHQEISLFVDNEEIEPDVVPQMI
FT                   DGRVMVPARFVAEPLGASVEWDGQNNKVLISSDDQELNGIEEEDKKKEDKISLREFIEE
FT                   YGEEYNLTVEGDGYVYRNDETLFNWEEEGETVDGRIYIPEILIEETIAELETSKTTEEE
FT                   MDSKSSEGKKTAQVGEALKVEGLEITINDISYSVNHEEFTAQDGREFAIISFTIVNESA
FT                   ESNDWASVGNWDADAYDDHGRYDEWKENFSYRASSPHPEVSEWIYEGEELSSEVRFNVF
FT                   EGMQLNEIHYNGISNKDIVFEK"
FT   sig_peptide     385493..385561
FT                   /locus_tag="Nther_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.384 at
FT                   residue 23"
FT   gene            386436..387344
FT                   /locus_tag="Nther_0368"
FT   CDS_pept        386436..387344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83964"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D0"
FT                   /protein_id="ACB83964.1"
FT                   /translation="MIPIPTIKPLSGRGKQISYKKLTHNLEITWGEAKFNVTKEQITHI
FT                   MKNFFIDDGTWYPLGASMDQPIKGGLGEFIKENFKGLTPRHATAIAAVMENEELILVKG
FT                   NKPIMLKKQSDLVDHRSSKSIKNLRNELHKNIINTWKKIKKDYDEGWLYREGTLVNAFY
FT                   HHLRNDLGDDYFINNDIRIYTEFYVGTKKRVWVDMCIVKLSKDQNYFLDYLSIIEFKFL
FT                   SGQASLDYFYNDVTKIKELSKEFPSTKFYIATIHEDYWQRDVYSWLSTNQRENWAKGKV
FT                   TELNAFYSDETGEFVTEVVEA"
FT   gene            387442..388362
FT                   /locus_tag="Nther_0369"
FT   CDS_pept        387442..388362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0190160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83965"
FT                   /db_xref="GOA:B2A5D1"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D1"
FT                   /protein_id="ACB83965.1"
FT                   /translation="MILASIVYIPYLILALLFIVSQDIELALFFITFTVFIASVVGIIT
FT                   ALLNKSQLKNYAIMTAVSFVLVTGSLTSIAEEDIEADNDAFSNETEQTEEEEEKDEKQE
FT                   EKINELKDKLEIEIKQFEWETTAEGTLTITAHTNLIEGTKVGFEFIELNPSIMPLQDDY
FT                   KLTTDHYLPFDQSWLPEDSYEKITSIDEEGKAEVTIDISSRPDPAGLAIEFFSSTITLD
FT                   QKEEVIELYGDRFENIYGYNVYEISREHIEDEENKRGVETVMTMYLETGEETIAAFPDI
FT                   TEYSVGEQVGDDPPGRDSILYKLLN"
FT   gene            388436..389530
FT                   /locus_tag="Nther_0370"
FT   CDS_pept        388436..389530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC2093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83966"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D2"
FT                   /protein_id="ACB83966.1"
FT                   /translation="MRKVSMFILLVVTALFLAGCGSPTPPDEVVNEYWGLFQDRDTEGA
FT                   LELVIDGREDEVGDLDMEMEEVDEIEEVLFERFTVEAEGYEEDGEVAIVDVTVTKPDLH
FT                   ETFATFFEEGFEELMALAMEGASDEEMDEKAEEFLLEAMEDAEDISHDQQVELHLEDGE
FT                   WKIYDWLFDDIEERMDELDFEDESVEQNGMDEESDEAAGDIDEGEAEVGDTVTTEAGDM
FT                   TLIAQNDDIDAIETGPFRIDIEQVNAVSGDLNPQSAEMFDTEQLEYIQLDLQVENTSDE
FT                   DLIFYAGQAQIVTNTGEQLESDMWMSDHIEGEFMGGVTQEGTLIYPLEQSQAEEVETVR
FT                   IVIGAPQDEDWQEVGEEVDFEVEL"
FT   sig_peptide     388436..388501
FT                   /locus_tag="Nther_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.574 at
FT                   residue 22"
FT   gene            389599..390279
FT                   /locus_tag="Nther_0371"
FT   CDS_pept        389599..390279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83967"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D3"
FT                   /protein_id="ACB83967.1"
FT                   /translation="MLFKRVLLLLLIAIVLFSIVGCGEENDSEENDTMLEEEQESEDNG
FT                   YIHEFVETETSLPSPDEVGAEYVDPSEGETIEGSEWTVFWEKWNEVAQEVSAPNLRVNE
FT                   EVEVLFVDPRMMFDYEITNYLNVYGDICYKTNELEHVGVDWELGSEVDGSLIAASWYTL
FT                   VNAAHPEKSEEEITGILEELGIYDVSPQDITEHDMITVMEDIEYDFYSTETMGYFELWA
FT                   DPID"
FT   sig_peptide     389599..389670
FT                   /locus_tag="Nther_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            390339..391376
FT                   /locus_tag="Nther_0372"
FT   CDS_pept        390339..391376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmo:Pmob_1622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83968"
FT                   /db_xref="GOA:B2A5D4"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D4"
FT                   /protein_id="ACB83968.1"
FT                   /translation="MPLYKVSSSDIFKMIPQRDFAKESYERKLEHWIIKNPTIITEGEN
FT                   ILFIKQEEPLEKSEDLLGIDEQGNLLVIELKRGRTPREVIAQALEYAARVSRMDYDKLN
FT                   NIAKKHFKKYDIKYSDLFEAYCDYFGKNSDKDKFSLQINQRQRIFIVAQDISEDVLSTA
FT                   DYLKKFDIDIQCVSFNYYNEGDLTVVDIDPDVRSSFDEPRVSAPSIESSDTEKFLKEVR
FT                   EQILDLYYDHISYATKKPNRVLSFQLESSKFSIGIKLEDSGELKLGASIQFEDLDMNEK
FT                   ICEALSDKIKKQNEDILIEDQKDKKDIKELLEWNSDLLQDDEFLGKVIDHTKTWIETWV
FT                   EEINV"
FT   gene            391567..392175
FT                   /locus_tag="Nther_0373"
FT   CDS_pept        391567..392175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_3024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83969"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D5"
FT                   /protein_id="ACB83969.1"
FT                   /translation="MNKQLILDYIISLVNLYGLVHKEKVAEIYNMQNTDRIKLEDLDNI
FT                   LKEEPQQLSDYFVEIHGDYFVSETILEFDEFEWYLAQKRNKPYYIPDKKELLKYKDEFY
FT                   FEKNKEYQALLSYVTKNIFDGDKDKAQEICEDIQGICGLGFSMGTVFEEFNRRDLSFDS
FT                   EDQAKEVMQLVMDLANNTRIWENNGILLTKYFIRWRNRI"
FT   gene            392684..393253
FT                   /locus_tag="Nther_0374"
FT   CDS_pept        392684..393253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83970"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D6"
FT                   /protein_id="ACB83970.1"
FT                   /translation="MVLLLKGLLMLYKDSVEEVEQEFQEMYPHLNSHIENGNVRKVFNE
FT                   LLTIEEKEANFIVRIEEGKCMINKKITYGFKAQRYSSPENKLDTEDNDYSLSFISWDEI
FT                   LGMEIDERILIAYRPTKILAVMIHEMTVYGFDSKSVQSQKNDFIKAILNNYKGEDLNID
FT                   DEDEIKLYIVSEDDEDEDFDDEDTEE"
FT   gene            393375..394055
FT                   /locus_tag="Nther_0375"
FT   CDS_pept        393375..394055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PFF0795w hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83971"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D7"
FT                   /protein_id="ACB83971.1"
FT                   /translation="MAKKVLDKPLILRLNEKDAKKMKSISGNFRGVINRWISDYIENKL
FT                   ESYLKNDIEVTEDQLDYSRKIRVNSDDYNHFSNKAHQEGYDPEGLIRSWMKSYNFYKQT
FT                   GKLYTTDIPENELHKRLSIIRDHLLKLNKESNLEPFNYFVKWLEITGLWKVELSHFAKF
FT                   LDTSDEEKIYEKIVSYYLNGGSKRSEQLINSMEFKYRIGIYADDFVRLKEEYLEFCEKL
FT                   CEKN"
FT   gene            complement(394292..394474)
FT                   /locus_tag="Nther_0376"
FT   CDS_pept        complement(394292..394474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83972"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D8"
FT                   /protein_id="ACB83972.1"
FT                   /translation="MASEKRHEKIREIEELVNDLKALLKKHGEKLDLKTDTEIIEIASQ
FT                   LNKVLEDYNEKYIEK"
FT   gene            complement(394467..394607)
FT                   /locus_tag="Nther_0377"
FT   CDS_pept        complement(394467..394607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83973"
FT                   /db_xref="GOA:B2A5D9"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5D9"
FT                   /protein_id="ACB83973.1"
FT                   /translation="MAEKRVCPFCGNSNYSADTGEIWICTHCKKEFHKKESQATRRGAC
FT                   G"
FT   gene            394745..395107
FT                   /locus_tag="Nther_0378"
FT   CDS_pept        394745..395107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0378"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   chy:CHY_1862 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83974"
FT                   /db_xref="GOA:B2A5E0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E0"
FT                   /protein_id="ACB83974.1"
FT                   /translation="MIEHIDTSRIGDRIREERERLDLSRKKLGRLIGVTEHHIGQLERG
FT                   ERNTSLTTLAKISQVLKVSIDSFVFDTGEPNNDEKSERSTERAELENLIERCSDQEIEV
FT                   IFDMLKVVIPHLKVKG"
FT   gene            395544..396089
FT                   /locus_tag="Nther_0379"
FT   CDS_pept        395544..396089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83975"
FT                   /db_xref="GOA:B2A5E1"
FT                   /db_xref="InterPro:IPR036614"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E1"
FT                   /protein_id="ACB83975.1"
FT                   /translation="MLNRIRKVQDDLSAIQVELAKASEEHELELLEEVETGDSTVKLEK
FT                   NQNGVKLTVDVVAPKISIYKFQTFENGNFTNRQHKEVRDYWYSIIKRALAGQNLDPIKP
FT                   AIVYIRYYLDKNCDVGNFLSKFIQDGLVYNGVLEDDDLNNVTLLSEAKLKKEKAPRTEI
FT                   YVVHDNGKVGDMITSQFK"
FT   gene            396335..397297
FT                   /locus_tag="Nther_0380"
FT   CDS_pept        396335..397297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83976"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E2"
FT                   /protein_id="ACB83976.1"
FT                   /translation="MSKKKLQLQDRDVKMLEDVIDFNGLPTEAIIQVHFENKRKYAYER
FT                   LKQLKKSGYLKEKYYYKSENKMGKRMSAILYASSKTVKLLRPTLNPTSVQPRDDELDVH
FT                   YLLGSLYNEIPNMMPARRAKKVLKLKSFDPFDVAIDGDPVIFLYVLNKKAGVDALNRVY
FT                   AFAKSHGENGLNFVIANHNPSKKIFSPPLRYITWDMSLEVIPNILKDQNYYMKEFEEIM
FT                   KNGYNNQLEYAGSSGAFLKYNYKNKDIYLAELITGDNYLRRELYIPPKTAFVYIKNRKQ
FT                   LEDVKIQSDNKFYAFSRDEKKRYKMEKQFSKTIIEEVDS"
FT   gene            397395..398051
FT                   /locus_tag="Nther_0381"
FT   CDS_pept        397395..398051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83977"
FT                   /db_xref="GOA:B2A5E3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E3"
FT                   /protein_id="ACB83977.1"
FT                   /translation="MSKTTFTMSVDKELHEKAKEAIKGLGVTLSDFYLYAAKVYLDDGS
FT                   PSIKNRYSDKYQKIIIYLPSGEKKELKKQAIKLGLTMSELFSYALHYYFGNESANYFAI
FT                   IRYTIKLNRIDESREESSSSRRVINFYLNPELSRELDYYCIENDTTRTDVIYKAVQRYK
FT                   DSDDMEQVDYQGTLDQQSSIVEKASLNFQLNQHSKRLGISKSELINRAVYLYINN"
FT   gene            398284..398868
FT                   /locus_tag="Nther_0382"
FT   CDS_pept        398284..398868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0382"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: ckl:CKL_3621
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83978"
FT                   /db_xref="GOA:B2A5E4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E4"
FT                   /protein_id="ACB83978.1"
FT                   /translation="MTETVRFMTQKELDKLFRTIEKSKDKHWLRDITMFRIAYRCGLRA
FT                   SEVGLIQVSDFNPKMNELYVRRNKNSLNNTIRLDNKTARYLKKYIKSYQLKENEIMFKS
FT                   QKRSPISRQNLDRIMKKYCEKAKIKDVTNWHFHVMKHSIAVHLAETGLDVKELQHYLGH
FT                   RNIASTLVYFQFTTRQQDEMYQKISKNNQLV"
FT   gene            399383..399697
FT                   /locus_tag="Nther_0383"
FT   CDS_pept        399383..399697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83979"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E5"
FT                   /protein_id="ACB83979.1"
FT                   /translation="MKRIIDGLVYDTDKAELLAEYYYSHKGDFNYIKEKLYKTSNGRYF
FT                   LYGEGGPKTEYFENVGNSSYSGGNTIIPLTKEGVLDWVERREIDDKKILKELSEVLDEA
FT                   "
FT   gene            399973..400287
FT                   /locus_tag="Nther_0384"
FT   CDS_pept        399973..400287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83980"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E6"
FT                   /protein_id="ACB83980.1"
FT                   /translation="MKRIHNGMVYDTDKAERIASYKYGDLNDAKYVIEELYKTKNDRYF
FT                   LYAQGGALSEYGEKVGTNSYSGNSVILPLSVDEVFDWAEDRNINSQKLVEELSDYLDEA
FT                   "
FT   gene            400344..400628
FT                   /locus_tag="Nther_0385"
FT   CDS_pept        400344..400628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83981"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E7"
FT                   /protein_id="ACB83981.1"
FT                   /translation="MSKVTSFHSTEILALTPTEIEERIEELLVERNRGELQPEGYFYDG
FT                   IWYPSETQEKASCCFNINHKLELYDHCKTENHLKILAVETLIGSVKNFV"
FT   gene            complement(400654..401778)
FT                   /locus_tag="Nther_0386"
FT   CDS_pept        complement(400654..401778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0386"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: gka:GK0877
FT                   transposase of IS654-like element"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83982"
FT                   /db_xref="GOA:B2A5E8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E8"
FT                   /protein_id="ACB83982.1"
FT                   /translation="MKSFVQEFLQEKIELIMREEIRNFLKEQDEKNYRNGYYTRSLDTL
FT                   FGQIEDLNVPRDRNGDFQTQLIEPYQKRDCWLEEAIIRMYQKGMSTRDVAKFIETLLGD
FT                   SYSPSTVSNITEVALEDIQEFQNRPLKKRYSVLYLDGMNIKLRRDSVENESVYIACGVD
FT                   EEGYREILGFYVGGRENALGWQELLNDLHSRGVQEVLLGVFDGLPGLADAFKKVFPKAD
FT                   VQQCVIHQVRNTLNAVRKKDQYEVAEDLKPIYKSFSKEEAHHHFEKFKEKWGSRYPRVV
FT                   DSWEKNLPNLLTFLDYPSDIRAVIYTTNWIERTIKEIRKRLKTMNSLTSPKAAEKVIFF
FT                   AIQDINVRWANKKLRGFKQCQHKLQEMFELRYDC"
FT   gene            complement(401875..403239)
FT                   /locus_tag="Nther_0387"
FT   CDS_pept        complement(401875..403239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0387"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: pth:PTH_2713
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83983"
FT                   /db_xref="GOA:B2A183"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A183"
FT                   /protein_id="ACB83983.1"
FT                   /translation="MFCENVTMTKKVTYQMTQEEIKKLNIINQTIDGYLTIRDAARALN
FT                   LSDRQIKRLKKGVQLEGPSFVIHKSRGKKPDHSVPESTEKHIISLKLEKYPNANFTHFT
FT                   ELLNEREKISISRPVVHRILSKAGISSPKKHKKSKSHHRRKRKDRMGLLVQIDASPYDW
FT                   FDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIF
FT                   RSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLP
FT                   TLFKLHNITTMEKANEFLQKDFLPDFNKRFALKPENELSAFTCLNQDINLDHILCSKFK
FT                   RTVDNSATFSFEGSYYQILDKNSQLVPKSKVTVLSNPKFGVKVKYKDMVFETQIVDKPS
FT                   TTKMTKKVKTTQSPKNRIVPDENHPWRKQSERTNLNYDLTDQELLDTILNTRDRV"
FT   gene            403622..403729
FT                   /locus_tag="Nther_0388"
FT   CDS_pept        403622..403729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83984"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F4"
FT                   /protein_id="ACB83984.1"
FT                   /translation="MFKKIAKLRQAELKSVGETQTKQAANLNEFIKILG"
FT   gene            403798..404367
FT                   /locus_tag="Nther_0389"
FT   CDS_pept        403798..404367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83985"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F5"
FT                   /protein_id="ACB83985.1"
FT                   /translation="MITKFDGMEILNRPIIEIEEKVKEMYEDRKNRDTHPEGEFDSKQR
FT                   WTPDEHSEEAICCYSIRTPSASWPFSLIKHCRSKKHLKHLASETLVKASIIKIERMENI
FT                   QDRLEIVKDLDNRICRIYDLQKEELVLTENHTNLIQNWHKAQLDELFFEQSDKRIQELD
FT                   SQHGENNIANIKDLVQMIETAVNSDP"
FT   gene            404504..406288
FT                   /locus_tag="Nther_0390"
FT   CDS_pept        404504..406288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83986"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F6"
FT                   /protein_id="ACB83986.1"
FT                   /translation="MQQNVNLQKFFKLFHEKDIIFQLVSTGGTQKQDNPQLRLNDLSEL
FT                   NQFVEKLEARADQGYKVYFITNPGGTKNDDIFGVNAQFIDIDFHEFEDATQKEQKKNET
FT                   VKMLKELKLKPTAIVMTPNGVHAYWHLKEEESKRHKVLERFIDTQKMMAEYFGSCTGVT
FT                   NRLGQAMRVPSPKFGGKIVEINPDQLYTQEEIRSSFYAETEKPKARNQQNTGQIERVNN
FT                   KIKIYNISDFFEVAKQQDIRKYLKTNVLLNKSFNCFYHHDNNPSAVISKKNGRYQYFCN
FT                   SSNCRAYNGRSGLTIIDLLQLDGMTKWQDIISQITNTFNIELVSTKWMEGQKNKYIANL
FT                   TFLKDELEEMKSTDILTRYGIIILEKLLNIGLTKITPELHDENGEAVFFTSNRYLSREK
FT                   NKPIEKVNAYLNLFCMLGLLNKVDPPKNHKVTQESLKRARENNRRVINFYSVPNYYEIK
FT                   NQIENRAFDLRKQGFSINTVSQVYVKNYDEELAKKVYHSNENISEFGIKVREKILEKAE
FT                   SQIYHYGYTHDKLLAGLKVSGRRIKKERLKQEFKKVIPILIDKGYILKPANNKLKSKFN
FT                   IKSKGYPKILLKPEDHEL"
FT   gene            complement(406499..407020)
FT                   /locus_tag="Nther_0391"
FT   CDS_pept        complement(406499..407020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gfo:GFO_2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83987"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5E9"
FT                   /protein_id="ACB83987.1"
FT                   /translation="MLFKDLFKQNVNFVAEIEDKIVELFPHEKENVEKGNYRKLMNQIL
FT                   NLKPLLVNLITDIEKIETDEGIIYDFGVNEYHSPKDKLNIKKEFVLEHVPWEAYLGIEI
FT                   SETDLLEFGSIELIAIFLENMAGLGFDYEDGLSIRMDFLEKANVKHIKGEVIESDVEFG
FT                   DNYFDGDEFQ"
FT   gene            407608..408783
FT                   /locus_tag="Nther_0392"
FT   CDS_pept        407608..408783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83988"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F0"
FT                   /protein_id="ACB83988.1"
FT                   /translation="MLFNLDENSKRILEVLEEEGITYTDVITFQFFILHFELELRNDTS
FT                   KTVQMIESLVKLPKNKKDKLYKNDEDAFKWTIKKLAKRYYKQSELRNDANIAELLKESI
FT                   IFSFMQDVESLYLDSESSMGQYMKDKNYFQLLNFYLIIQVVTNHPELHENQIQRFFKNE
FT                   FDPIKPHLNFVKNIKEQGKFDILSVLIQDGILNHGTVLYYFNKTGEDKIEAIISANDYK
FT                   EIDTKYMKQLEEETLQNWSQKEEERKEYSKTVDKLQSELAEKEKRIKELERELEKYKKQ
FT                   QSSNNFSGSKVLVIGDTQRKDGYKNIIEIYNGEFIFLDGNDDHHLVKEKAQATDVIFHV
FT                   TDYGSHSVHFQLKKFKKVVFVNNAGLDSLRYAVEDYLGYDCKNCSRSAGNN"
FT   gene            complement(408933..409361)
FT                   /locus_tag="Nther_0393"
FT   CDS_pept        complement(408933..409361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0167578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83989"
FT                   /db_xref="GOA:B2A5F1"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F1"
FT                   /protein_id="ACB83989.1"
FT                   /translation="MIDFNAITSKIHELQYILENSVRDEHVIIGFVLLFIPLMIFLRIR
FT                   EKKWKKRKEELIEYAMLLIKENQQQERAKQKETPKKQNTRKPKPQKQYVQNVYRNDIDE
FT                   TSPPITESHRQPVDQQYNPCQDFFQGFLEYYPPTMPWY"
FT   gene            409837..411462
FT                   /locus_tag="Nther_0394"
FT   CDS_pept        409837..411462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0394"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   spi:MGAS10750_Spy1717 site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83990"
FT                   /db_xref="GOA:B2A5F2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5F2"
FT                   /protein_id="ACB83990.1"
FT                   /translation="MVTTIKYAKYMRYSRVDGDREKESIQNQDKIIENYIKDRETKYNE
FT                   KWLLVGEYVDLDYTGSNFNRPEFLKMKEEVENDKIDVIISKDASRFGRNVATEVYFEEI
FT                   FPKYRTRFIGVVDNVDTASENQAFERKIRGLMNENYCSDISQKVKSSLKTKMIEGKFIG
FT                   ASPPYGFERDLDDKHKLIVDEEVRPIILKIVDLYLKGYGFSAIAKILNAEKIPSPSAYK
FT                   KMKKSNYKNPRANRRLWSPSTIRKILTEPIYNGTLVQGKHPKINYKINSRKKSGESELI
FT                   KVDNAVEKIIDDETFELVGKKINSRSKNVKNNDSPSVLPDNVYSGLVYCEDCGSKMVYR
FT                   SDRDMYMCGTYAKYGKKYCSNHNIKTKVINEVVIEQLNLIIKLTIDIRTLLNDIKKKYQ
FT                   EVSGKDVIEIKRKKRENRLKTLKESLKILREEYADGIIDQEEYKETRSEYVNEINTIEN
FT                   ELGKLQVSSSKESVINDWEEKVKDLEKFYNNFLKINKIDREIALKLIDTITVGTDQISE
FT                   IKFAGASPFELAQELKSEISSVAL"
FT   gene            complement(411566..411802)
FT                   /locus_tag="Nther_0395"
FT   CDS_pept        complement(411566..411802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0395"
FT                   /product="polysaccharide deacetylase"
FT                   /note="KEGG: aoe:Clos_2018 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83991"
FT                   /db_xref="GOA:B2A5P3"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P3"
FT                   /protein_id="ACB83991.1"
FT                   /translation="MFFTVNFRRKMSTIIMIGFFIFIGLFGYFSIYHQETATVIPVVNE
FT                   EEKEEEEEKKAPIYSVETDQNKLAISFDAAWGA"
FT   gene            complement(411957..413267)
FT                   /locus_tag="Nther_0396"
FT   CDS_pept        complement(411957..413267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0396"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   deh:cbdb_A494 PmbA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83992"
FT                   /db_xref="GOA:B2A5P4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P4"
FT                   /protein_id="ACB83992.1"
FT                   /translation="MDKLLSLAKKKNEQAELFEVSVTRTPVEFENNKLKNIKTKEQKST
FT                   ALRLISPDNRLGFCTTTSTEDKAEDLLNKARETSQFGRSFQPSLPKVNPEELDNMYDQD
FT                   VMDLPTEKMIEMGEEIVDSIRSKNSEALASASIEKTQLQVKIKNSEGLNTEYERTAFSV
FT                   RGGAMLLVGKSFLRIGQGKKLPRLFTDLTALKNELMQDLHYGSKEKEINSGSYKVIFAP
FT                   EAMSDFMRPILASLNGQSVEKEVSPFKDKLDQQLFDEKVNLTDMPHRPFSPGMCPVDDE
FT                   GVPTKETDLIKNGTIKTFPVDLLTAHSLGVEPTGHGIRQSPYSLPAPDLHTCVLSPGEM
FT                   AYHDMIGELDRGIIIKDLMGAWAGNPYSGEVNGNISLGYLVENGKIIGRIKDCMVAVNV
FT                   FEALQNQLVSFSQEAKWIGNRLFPYALLEGIDITAKN"
FT   gene            complement(413260..414642)
FT                   /locus_tag="Nther_0397"
FT   CDS_pept        complement(413260..414642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0397"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   deb:DehaBAV1_0503 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83993"
FT                   /db_xref="GOA:B2A5P5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P5"
FT                   /protein_id="ACB83993.1"
FT                   /translation="MRDFLQSALKGKSADFIEIRVQKTLQNRIEFQGQDLDRIDSSNDY
FT                   GGNVRAIVDGGVGFVSFNKLDDIHEKVNLAIEQAKLIGDRIPENTSFSDVEPVVDHVTV
FT                   EPQEDPRKLSLTQKKELLEEYNDIILSYGKPVTSSRIRYFDNFTKLYYINTDGSYIEQE
FT                   KLDLGGGIIAIAADQGHSQMSVVGFGSSDDFGVVRNLHDRINKACQKATQMTKADPIKG
FT                   GSYPVILDPSLAGVFVHEAFGHLSESDQLYENKRLREIMKLGTKFGGRHLNIYDTGDTP
FT                   GARGYLKYDDEGVRTQKTDLIKEGELVGRLHTRESAAKMGEKPTGNARAINYNHPPICR
FT                   MRTTCIAPGDATWEDMIKDVKLGVYAVDAYGGQTNGEMFTFKAGEAYMIRDGKLAEMVR
FT                   DVNLTGNVFETLNNIDLISSDYQVKDTGGGCGKGEQGPLPTSQGSPSIRIQNVIIGGKS
FT                   DG"
FT   gene            complement(414908..415957)
FT                   /locus_tag="Nther_0398"
FT   CDS_pept        complement(414908..415957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83994"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P6"
FT                   /protein_id="ACB83994.1"
FT                   /translation="MRKNEVVSLPVISIDTGKAFGKVIDIILDVNKKAVTSIMFGEGKF
FT                   FSNRPSHLVSLDNVQTIGPYAVTIPSEHVILQQGETEWEREHLEKSPIGKKVISDHGEF
FT                   LGICNDYQFNFPGGQLDSLILSKSKRAEQLFEVPAQQIVTLGTDYIIMSYYEQESTLNT
FT                   SPVTPQSDIPDYQEPDQLIGKIATQTVQDGQGGVIIFEGEKITPEVVDLATHHNVLKTL
FT                   AFVANDQQTPPRFAQQASTPGAQYSDARQRYEPDQEWQTRLKEILDQAGGDIEEKLKGF
FT                   LINKKPAYNVVSQDGHIIKEKGQPIEISDIEQLRDRNDLMRLAASITATEIDDFITSLE
FT                   QKFQRLMKN"
FT   gene            416124..416606
FT                   /locus_tag="Nther_0399"
FT   CDS_pept        416124..416606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0399"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   mta:Moth_2160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83995"
FT                   /db_xref="GOA:B2A5P7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P7"
FT                   /protein_id="ACB83995.1"
FT                   /translation="MNINTIEERQTISIAEQLAALLGPGDIVLLTGDLGAGKTTFTKGI
FT                   AQGLDIDEPVTSPSFTLMNQYSGSIPLYHFDLYRIEDPEEFLELGIEEFLYGKGISVVE
FT                   WSEKLPELPNSYLQVSLKLGADPEGRQIIIEPYGGYYQELVSKLRQEVFSDEGTRN"
FT   gene            416587..417297
FT                   /locus_tag="Nther_0400"
FT   CDS_pept        416587..417297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0400"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cno:NT01CX_0503 glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83996"
FT                   /db_xref="GOA:B2A5P8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P8"
FT                   /protein_id="ACB83996.1"
FT                   /translation="MKVLGIDTATKTCCVALIDGNKLMGEFILNNFQTHSERLMPLIDK
FT                   LLDSLGIKIDEIEGIAVSRGPGAFTGLRIGIGTAQGLAMGNEIPLVGVSTLDALAYQRA
FT                   TLGYICPIMDAKKQELYTSLYYVNEKEIEQVWDYSIMKPKDLIAELNNDLTDRDIITFV
FT                   GDGFSPYKEELLSDVVASVNYSTGDLELNRGFSIARLGLNKINVGEGCAPEELTPLYLR
FT                   KSEAERKREEEDNG"
FT   gene            417290..417781
FT                   /locus_tag="Nther_0401"
FT   CDS_pept        417290..417781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0401"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: tte:TTE0537 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83997"
FT                   /db_xref="GOA:B2A5P9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5P9"
FT                   /protein_id="ACB83997.1"
FT                   /translation="MASRDLFPEFRIRAMTQDDLDQVLEIEGQSFNSPWSENAFRHELQ
FT                   ENFLATYLVFEDINSNLQPTIFAYGGYWLIRTDAHITNVAVSPNYRGLGAGKLVVEALL
FT                   EHAKNRGANKATLEVRKTNTVAKKLYQALGFKIYGIRPNYYRDNNEDALIMYKSMENNH
FT                   "
FT   gene            417978..419012
FT                   /locus_tag="Nther_0402"
FT   CDS_pept        417978..419012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0402"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: drm:Dred_2885 putative metalloendopeptidase,
FT                   glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83998"
FT                   /db_xref="GOA:B2A5Q0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q0"
FT                   /protein_id="ACB83998.1"
FT                   /translation="METQRETVYILGIETSCDETAVSVVSNGQKVLSNVVSSQTDVHSL
FT                   YGGVVPEIASREHSKLLPPLVSKAVDEAGLNMNDINAIAVTQGPGLVGPLLVGVSFAKS
FT                   LAYSLKIPLIPVNHIKAHLYANFILADDDKDSNLPSFPLIALIVSGGHTNLYYLYDHDN
FT                   WKLLGRSRDDASGESFDKIARALDLGYPGGPAVEKEAQKGQPNVDFPKPKLENEYDFSF
FT                   SGLKSAVLNYLNRKKMKGEQYSSSDICASFQQVVVDSLVEKTISAARDNQVDTIVLAGG
FT                   VSANGQLRANFKETTAGEGINLFLPRLEYCTDNAAMIAALGYHNYRRGWIASLDLNAVP
FT                   NLSP"
FT   gene            419445..420842
FT                   /locus_tag="Nther_0403"
FT   CDS_pept        419445..420842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0403"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: drm:Dred_0676
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB83999"
FT                   /db_xref="GOA:B2A5Q1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q1"
FT                   /protein_id="ACB83999.1"
FT                   /translation="MLKGFKKIHFIGIGGYGMSALAQVLIEEGYQVSGSDISSSSRIDF
FT                   LKELGVEIYLSHKAENINSVDLVIYSTAIPGDNPELLAAKQRGISLWHRSELLAELINS
FT                   RYGIAITGAHGKTTTTSMLSLILEEASADPTCIIGGELPNFGSNARVGDSEYVVAEACE
FT                   SDHSFLRYSPQIAVITNIEADHLEHYNGSFDQLLKSYRQFIENIDDSGKVFIYSECEYH
FT                   DYLLEGMSKNCKTFGFSQDADFRATDLKLNKGTTEFTIESDLADSFKVELMVPGEHNIL
FT                   NALAAASVALDLKISPTAIKRALQKFTGAKRRFMEIGQLQGATIVDDYAHHPTEIKATL
FT                   KTAQEQSDNKVIAIFQPHRFTRTQYFMDDFASSFEEADTVILHKVFAAGEDEIPGANSK
FT                   NLKDKIKENVPGLEVYVTDDMEDIAEIVSNIVDKGDYVITMGAGDIWKVAHWLVDEDYQ
FT                   KQLNSEG"
FT   sig_peptide     419445..419513
FT                   /locus_tag="Nther_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.763 at
FT                   residue 23"
FT   gene            420847..422223
FT                   /locus_tag="Nther_0404"
FT   CDS_pept        420847..422223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0404"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mta:Moth_1235 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84000"
FT                   /db_xref="GOA:B2A5Q2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q2"
FT                   /protein_id="ACB84000.1"
FT                   /translation="MCYQSPMDQFYNEIITTISQNNILPLGSGCNLNCVFCSNKQNPDQ
FT                   LQTFSLPYLSVKKIKELLDFLDPTKKIIIGESATRITEGEPFVNPDILEILTLIRKKFK
FT                   DTTIQITTNGSFLDRDKIEFLKSLEPLELNISVNGLKAEDRYYLMGDTGQEDFKFILEQ
FT                   LAVNNIDYHGSTVWIPQILDENQLEDLITHLEFYGAKSCRVFIPGYTRFSTKNYQITSN
FT                   MEQTMKKALSKINQKVNYPVLIEPPDITDLNCIVEGIIPDSAATHSGLMTGDQILAVDS
FT                   DPVASRVDGFNKLKERANPQVTVLRDGVKFDCEIPKVAKEPSGIAVNFDISWEVIDKIN
FT                   KVAQKYPRNSVTKILVSELGYNPIKLALNQLNEDLAKEVQIVKNSSFGGNIRCAGLLTV
FT                   ADFRKKLNNLLTKGYSKHKDIDIKQLILPAKPFENGLDLFGMHYKDLEKEFNVTVDLLT
FT                   "
FT   gene            422229..423467
FT                   /locus_tag="Nther_0405"
FT   CDS_pept        422229..423467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0405"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tte:TTE0949 predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84001"
FT                   /db_xref="GOA:B2A5Q3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q3"
FT                   /protein_id="ACB84001.1"
FT                   /translation="MALCFFVFREIIHIGRDKRDNLKELKQLCIKGVQKNMKVLQVYRP
FT                   VEGGIKRHLEILDQNLPNHNIIPVFCGPQDDMNSLNISDNYQLEITDGLNIQVLANNVY
FT                   RLRNIVSKVKPDIIHSHGYKASAVVYGLSPFLRIPWISTLHGYKTWGRNITTKRTVFDL
FT                   MSKQVLQRPQKVLCVSKALQKELHSIGMEEDKCKVVYNGIPISQYHQNVDDIFGGNYHR
FT                   PNSKLITYIGRMMPDKGLDTFLTAIKILVDKYKSYIDSMNLQFVIAGDGPWRNYYEQMS
FT                   WEWKIAPYITFLGYRKDISNILKQSYALCIPSRYEGQSITAVEAMASFCPVIASRTGGL
FT                   QEILSHGETGLLIRRNDPLELAQKIILILKNKHLRRQLIFKAYYKALKNFSDKKMTSEI
FT                   VETYNEVAKNVRV"
FT   gene            423454..425721
FT                   /locus_tag="Nther_0406"
FT   CDS_pept        423454..425721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84002"
FT                   /db_xref="GOA:B2A5Q4"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q4"
FT                   /protein_id="ACB84002.1"
FT                   /translation="MLGFNIHFIKTKSLYVRGKCFGILLLTLLLVSFVNISHGEASEQN
FT                   VYPKALDPERDLIIFMVPSFSMEKALELQLPELEKMASQGAMGLINTGVAESYHPSAAY
FT                   LTLGTGARSTCDDELALALESQEKYQQATGKELYRRNLGASPAVKNGDLALIPRIPKLT
FT                   EENDDLMHPVKTGGLGTKLRDEGIELKLWGNSDTDHPRRYSALVFMDQKGIIENADISQ
FT                   EQTLQQDSAHPFGVKSDISSYEETLEQSIQQGYEIQAYEFGDLERLTYYGDYMSQERKQ
FT                   ELRLKYYNQINKALKSANEHLETHQIVLLNPAPTRENYFEGKRLTYMLIHPVSQQGTNL
FT                   LTSDTTQRDGIIANMDFAPSILRKTGLETSSQFLGAPMEIIPENVSTNYLEDKYQSMLS
FT                   TYQKRPALVQGFIFIKIFLMVLGIIAIFFSKNTIPKMDIWLLAIIISPLLFLILGGLSP
FT                   IDLFPAALILILGSVGIVYLMRTKLGIIETMGLASLLVSGAVILDTFLGNSLLHASVLG
FT                   HDPISGARYYGLGNEYMGILIGSTVLAIFSLGSAPKRTFSVFVLALILMLFIFSHPQLG
FT                   ANLGGVITTLGVLITISFIHYNEINLDKNKVNKLIIVVLGLLIIFGAIFVVINLRGDTV
FT                   SHIGRTIDLVRGQGIGELYMVIVRKISMNISLIRYSVWSKVLLSFVGVLIFILLYKPGR
FT                   QFDKLQHKNLQVIRALQGNVMGSIVAFVVNDSGVVAAATLLIFAVPPLLLINLPLPQGE
FT                   VD"
FT   sig_peptide     423454..423573
FT                   /locus_tag="Nther_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.883 at
FT                   residue 40"
FT   gene            complement(425787..427691)
FT                   /locus_tag="Nther_0407"
FT   CDS_pept        complement(425787..427691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcl:ABC0872 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84003"
FT                   /db_xref="GOA:B2A5Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q5"
FT                   /protein_id="ACB84003.1"
FT                   /translation="MSLLRGENLTKDFGIHRVFENITFQINPGDKIGLIGKNGAGKTTL
FT                   VKLITGELIPDSGEKLAQKGTNIGYLSQEPDFESDSSLYDEMEKVYYELVTISKELQRL
FT                   ETLMGETSQEELPQVMNRYSQLREKFEQSGGYQKDRDIRSVLKGLGFREDEFHKPIINF
FT                   SGGQKTRAILAQKLLEKPDLLILDEPTNYLDLNGISWLENFLQSYSGSFIVITHDRYFL
FT                   NKTVNKIWELEANSLTSYSGNYNDFITKKRALKEKQWKDYKHQQRKIQKTQEFIRRNIE
FT                   GQKTKQAQSRRKQLEKMDIIEKPQEENNDMKLDLETSVTSGKEVVTLSKITKNIADQKI
FT                   IPELSCKVFRGEKVGIIGPNGSGKSTLLKLLAGHYTPTSGTINFGTNVITGYIDQEQDE
FT                   LSRELSLINELRKELPLTKEEEIRRILGRFLFPPEQMDELVESLSGGERVRLALAKLYV
FT                   RKANLLLLDEPTNHLDIDGKENLERALNNFPGTLIMVSHDRYLLDKVATKLISFSTYPP
FT                   HFFEGNFTEYQNKMLKSNNEQDSSTQERSKTKKKKGKSDTKNNQKDSKTSKNNNEQLAT
FT                   QLFAEIETLEIEQEELEEQLADPELYRDNEKAREINLKYRELKTTLEKKYKELDELDF"
FT   gene            427824..428180
FT                   /locus_tag="Nther_0408"
FT   CDS_pept        427824..428180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84004"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q6"
FT                   /protein_id="ACB84004.1"
FT                   /translation="MFLVLIFLLMALVSGLHASKQTVQVSSQDLIKDLDPETAFEQGVA
FT                   VDYFGNVLKGESGGIIYWNHPQKYFCEEGYLREKETNQPVITASGNKITDEQLLLTPEL
FT                   HSVEVIIHNLVESQ"
FT   sig_peptide     427824..427880
FT                   /locus_tag="Nther_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.814 at
FT                   residue 19"
FT   gene            complement(428242..429126)
FT                   /locus_tag="Nther_0409"
FT   CDS_pept        complement(428242..429126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0409"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   gme:Gmet_1043 UBA/ThiF-type NAD/FAD binding fold:MoeZ/MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84005"
FT                   /db_xref="GOA:B2A5Q7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q7"
FT                   /protein_id="ACB84005.1"
FT                   /translation="MPNNTNNNLIEDLHNVKTQASAGSANLNVITVENELQIAEDNQVT
FT                   TKKVQQISLKEQILPTRYLRNYGTMGFEGQSALLKSSVGIIGAGGLGGTIAELLARMGV
FT                   GHLVLIDNDQFEDNNLNRQVLSQESNLGETKVSAAYTRITNINSAVSVSPYTLKLNSNN
FT                   APELLADCDILIDALDNMSTRFILQKTARELEIPMVHGAIGGFSGQVTTILPNDRGLET
FT                   LYSSLLETDSEQYQYPDKLAEVELGNPSATPAIVASWQTQEAIKFLTNKGDLLRHRLLY
FT                   LDSYTGNAEIIKY"
FT   gene            complement(429289..430407)
FT                   /locus_tag="Nther_0410"
FT   CDS_pept        complement(429289..430407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0410"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   amt:Amet_0029 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84006"
FT                   /db_xref="GOA:B2A5Q8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q8"
FT                   /protein_id="ACB84006.1"
FT                   /translation="MKANIFEILEVDNLFELGINLVTIVVVIILAYLAYQVGLKLIKKV
FT                   MKIEESKYVSADAGKIIYLGLKTLLKYGLTFLVILISLEIFEFEVIGPEEVRTIGTTIL
FT                   KIIGIIILAKITINLGRQLIDHVFDPERDEERKLINERRKKTLNGLLKSLLLYVVYFLA
FT                   GMMILENLGIRTSSILAGVGVLGLAVSFGAQSLIKDVITGFFIMFEDQYSVGEYVVAAD
FT                   VFGEVQELGLRTTRIREWTGQIHIIPNGEIGKVTNYSRGEMMALITVGIAYEEDINKAI
FT                   EVLAKEGKQAAQELTSIVTEPVVQGVTELADSSVNIRVICETIPGEQWAIERELRRRFK
FT                   MALDREGIEIPYPRRVIIDNSKTTTSDNTSEE"
FT   gene            complement(430494..431348)
FT                   /locus_tag="Nther_0411"
FT   CDS_pept        complement(430494..431348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0411"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; KEGG: mbu:Mbur_0889
FT                   2-oxoglutarate ferredoxin oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84007"
FT                   /db_xref="GOA:B2A5Q9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Q9"
FT                   /protein_id="ACB84007.1"
FT                   /translation="MTGTLDFELERKTSWCPGCGNFPIRKALVQALEELNLAPDKVLVV
FT                   SGIGQAAKMPHYLNVNGFNGLHGRALPSAVAAKVANPDLQVILVSGDGDSYGEGGNHFL
FT                   HNLRRNPNIAHFVHNNQIYGLTKGQASPTSELGMVTGIQTSGVINEPLKPLSMAISHDA
FT                   GFVARGFSGKQDHLKELMKQAIKYPGYGLVDILQPCVSFNKLNTFAWYNNRVSQLEDHD
FT                   PMDKTSAIQKAEEWGDEIPIGVFYKSQRPPFEEQLPGLKKGNLVKNRIVNPEDMAYLQE
FT                   EFK"
FT   gene            complement(431348..433129)
FT                   /locus_tag="Nther_0412"
FT   CDS_pept        complement(431348..433129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0412"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: amt:Amet_1213 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84008"
FT                   /db_xref="GOA:B2A5R0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R0"
FT                   /protein_id="ACB84008.1"
FT                   /translation="MTITSKNILLGGAAGQGLDTSANLLGKHLNRLGYQILLTKDYMSR
FT                   IRGGHNFYQIKIDNQAVKAPQKTTDMLFCFNQETNELHFDKVNKGGIIAGEISDSKEIE
FT                   IHQSDQESISLHLPWNQWATKIVENPRTLSTVALASMAYFLGLSENKLIELINQSFKES
FT                   LVDINEKAVKTGYQRTKEAIKEHNLLTKIKESWLEPIENQDENEQILISGNEATGMSAI
FT                   ASGCKFFSTYPMTPSTGIMNYLAKKQKEANLVVEQSEDEIAGINKALGASSMGVRAMTA
FT                   TSGGGFSLMVESLGMSGVAEIPLVVANVQRPGPATGLPTRTEQADLQFVLTAAQGEFPR
FT                   AVISLTSIEDAFYRVNKAFEIAEKYQIPVIVLSDQYLADSTASLSPFQFQKLNCHDYTI
FT                   NDQELARQKQQYGKYVRYEFNSESGISPRAYPGQYTGETVLIDSHEHDIYGNITEDSEI
FT                   RTAMVDKRMRKLEKLKSEMSSPNYYGAENPKTILLSWGSTEGIIQEAVDNLRASGYSVG
FT                   SLHFSDLFPFPDTTLPELVDKCKFISVENNATGQLAQLIARETGIQVSQKILRYDGRQI
FT                   TWEEICSQLKSLIKEDQ"
FT   gene            complement(433277..434113)
FT                   /locus_tag="Nther_0413"
FT   CDS_pept        complement(433277..434113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0413"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2460 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R6"
FT                   /protein_id="ACB84009.1"
FT                   /translation="MSKIYALYGKSGTGKSHRAISIAFNYNIPLIIDDGLLIYKGKKIP
FT                   GSISGKQEQNRIRAVKRAIFDDNDYAQKMSARLQALNPSKILIIGTSQHMINKIIQNLK
FT                   LDQPDHWIDISEITSTRERKKAKYHRDRGRHVVPLSPVEVRKTFKVPLLDRLKLLIPNR
FT                   GKTEYLGEQSVVKPNFHSLGGIYIKEKALEDMAYFALHHDLTDHDVKQIKTIKITNSAQ
FT                   STSIEIHLKLGYDNPLHLTAKSLQADLQDKIKKLSGLDSLTIKIIISEIDVPDRFK"
FT   gene            complement(434135..435076)
FT                   /locus_tag="Nther_0414"
FT   CDS_pept        complement(434135..435076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0414"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: aae:aq_1333
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84010"
FT                   /db_xref="GOA:B2A5R7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R7"
FT                   /protein_id="ACB84010.1"
FT                   /translation="MKCFKCDSQAILRIKRHKATLCETHLVEHLQNQMIKAIKKFKMLP
FT                   PNEKVIVAISGGKDSLALWDMLLDRGYKADAFYIDLGIDEYSKTSMEKAQSFAEKVSGN
FT                   LYTISLPKLYNTGIKEISRNNPRSACSACGLIKRYIMNIFAKYGNYHAVATGHNLDDEA
FT                   SSLLGNTLRWQTGYLSRQSPSMPSNNGLAKKIKPLCRLAEKETAAYCITKNIDYILEEC
FT                   PMAQGASSFDYKEVLNNLELKSPGTKDQFYLDFLRTAQPYFKSNKQDITLVKCPTCGEP
FT                   TSQDRDCSFCRQMKSNQLDPLKVKEEISGFFK"
FT   gene            complement(435094..435288)
FT                   /locus_tag="Nther_0415"
FT   CDS_pept        complement(435094..435288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0415"
FT                   /product="thiamineS protein"
FT                   /note="KEGG: csc:Csac_0103 thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84011"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R8"
FT                   /protein_id="ACB84011.1"
FT                   /translation="MKVTLKGTNQVTELSGNKKVSNILSELELNPETVIVVKEGQILTH
FT                   DKIVKDHENIEIISVVSGG"
FT   gene            435424..435600
FT                   /locus_tag="Nther_0416"
FT   CDS_pept        435424..435600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84012"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R9"
FT                   /protein_id="ACB84012.1"
FT                   /translation="MNESKGTILFLALLVLVLIMAGMVVFSGFFEDEPEEREHIKVDPH
FT                   RIAVTVKTYKLFG"
FT   sig_peptide     435424..435507
FT                   /locus_tag="Nther_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.873 at
FT                   residue 28"
FT   gene            435706..435903
FT                   /locus_tag="Nther_0417"
FT   CDS_pept        435706..435903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0417"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sfu:Sfum_3308 conserved hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84013"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S0"
FT                   /protein_id="ACB84013.1"
FT                   /translation="MDCDKQKQNLEKCNCTYPGCPRKGNCCECLHHHLKMEQLPACCFP
FT                   EDVEKTYDRSFKKFAQIVMK"
FT   gene            complement(435909..436865)
FT                   /locus_tag="Nther_0418"
FT   CDS_pept        complement(435909..436865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0418"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   amt:Amet_4787 diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84014"
FT                   /db_xref="GOA:B2A5S1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S1"
FT                   /protein_id="ACB84014.1"
FT                   /translation="MVKITSEGYNNNMCEKEIGVIINPTAGKGKAKQVWNQILPFLKTK
FT                   KINLRYRLTSSPKEAGKLASELIQEGCSKIAIIGGDGTLHEAINGQNIINDRVAFGIIP
FT                   AGTGNDLVRTLNIPNDPLQACQVILDGYYQKIDLGLINGETYFVNTAGVGFDVEIAKLM
FT                   NSNKRLFFNGKGSYFISILRTLITYSNLNLILETDDKSTEISNCFLLSIGNAKYIGGGI
FT                   KLIPSAKPNDGYFHLLIAKDIKRTTVVRKFASIYKGNHVDNYQVMEIKTKTIKIEPGTK
FT                   NTGLSINYHSDGEIYGSIPAHIQLIPQKLPIITPKNN"
FT   gene            436953..437996
FT                   /locus_tag="Nther_0419"
FT   CDS_pept        436953..437996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0419"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: tte:TTE1590 translation initiation factor
FT                   eIF-2B alpha subunit; TIGRFAM: translation initiation
FT                   factor, aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84015"
FT                   /db_xref="GOA:B2A5S2"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5S2"
FT                   /protein_id="ACB84015.1"
FT                   /translation="MVSVKPLKFEDDELLLLDQRKLPGKEEYFTCKTYQDVHFAIKEMV
FT                   CRGAPLIGAVGAYGVALACREFINESQEKFQQETKRAISELSSARPTAVNLFWALNKMN
FT                   KLLGQVMEENTAPEDIYPIILNEAHKISDQELQRNYRIAEFGDQVISNGDKILTHCNTG
FT                   ALATTGYGTALGVIRQAHYNHKDIFVYVDETRPRLQGAKLTAWELKQEQLPFALIPDSS
FT                   AAVLIKNGDIDVIFVGADRIASNGDTANKIGTFMLSILAKKYKVPFYVVAPVSTIDFQA
FT                   KNGDDITIEERSSKEVTEIDGVRVAPTDIQVYNPAFDITPAENITGIITEKGIIGPNNR
FT                   EIMTIQE"
FT   gene            438247..439389
FT                   /locus_tag="Nther_0420"
FT   CDS_pept        438247..439389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0420"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: oih:OB3388
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84016"
FT                   /db_xref="GOA:B2A5S3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S3"
FT                   /protein_id="ACB84016.1"
FT                   /translation="MLSKKFLAILMAGMLVFVFAACGTDEDPAEDPENGENGEAAEEEE
FT                   DVPTVGIVFSTGGLGDQSFNDSAYRGMEMAEEEFDFEWDYIEPENPADFDPALTTFAED
FT                   EVDLLIGVGFQMEAEVKEIAENYPDMNVAIVDHSYEEETPENLEELVFDEPGGSFLAGA
FT                   LAAKVTETDVVGFVGGVNGPLIHRFEGGFVQGVQYVDEDIEILGSYADSFGDPARGTDI
FT                   TEGFVDQGADVIYHAAGGTGDGVFTIASDYDNVYAIGVDDNQNHIQPGHIIASMLKRVD
FT                   VAVYETVQRVVEDEFEGGITREFSLEDDGVGLSSLDELDVQEKEAVELDAITEEELELI
FT                   KEMKEEITAEHADQIEQIKQDIIDDEIEVEDWMETGRQDY"
FT   sig_peptide     438247..438318
FT                   /locus_tag="Nther_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.842 at
FT                   residue 24"
FT   gene            439593..441125
FT                   /locus_tag="Nther_0421"
FT   CDS_pept        439593..441125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0421"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU31550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84017"
FT                   /db_xref="GOA:B2A5S4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S4"
FT                   /protein_id="ACB84017.1"
FT                   /translation="MAENILEMRNITKVFPGVKANDNVNLQVRKGEIHALVGENGAGKS
FT                   TLMNILYGLYAPDEGDILYNGEKVDLNDPMKAIELGIGMVHQHFKLVDPLTVVENIILG
FT                   SEPRKNTLFIDKKSATKEVQEISDKYGLRVDPNSRIENVSVGMQQRVEIVKILYRGAEL
FT                   LIFDEPTAVLTPQEIEELFEIFRSLKEQGKTIIFITHKLGEVKEISDRLTVLRNGQSVG
FT                   TVETSTVSKEEVAKMMVGREVLLRVDKDVAKPKDVVLKVDGLSAKDSRGVPIVKDISLD
FT                   VRGGEILGIAGVEGNGQTELIEVLTGLRQATNGNIFFSGQDITGLTPRQIKEHKIGHIP
FT                   EDRQKRGLVLDFDLAENMILGYHYQKPFASNYRMNYNHIIDYTKELISEYDVRTPGYHV
FT                   QARSLSGGNQQKVIIAREFSQEPELLIASQPTRGVDIGAIEFIHQNLIEQRDQGKAILV
FT                   VSADLNEIMSLSDRIAVIYDGSIVDVVNSEEVDEYQLGALMTGSNLEKEASK"
FT   gene            441122..442297
FT                   /locus_tag="Nther_0422"
FT   CDS_pept        441122..442297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0422"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpt:Tpet_0820 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84018"
FT                   /db_xref="GOA:B2A5S5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S5"
FT                   /protein_id="ACB84018.1"
FT                   /translation="MTQPKNKINESVNNAMEKVRGAVMSSQNVRSTASELIMSLASILV
FT                   ALLVGVIFILIAEQSPIDAYYALFDGAFGSFTNFMGTLHRSTPLILTGLAVAFSFRTGL
FT                   FNIGAEGQLLMGGFIAGLVGFYFEGLPTIIHLPLTVLAGMLAGGIWAGIPGILKAKLGV
FT                   HEVINTIMLNHIAIHITIYYGINRFREGGRQATPYVQETAELFQFNQMPEHPILQHLPF
FT                   VNFFDHTSINLHSGFLIALIVAVIVWYILWKTTLGYEIRAVGLNSPAAEYGGINVSQKI
FT                   VVAMLISGGIAGLAGISETLGTHQSFVEGMDAGHGFTGIAVALLGRNHPVGVILGGLLF
FT                   GALSQGGLQMQFAGVPREIVIIIQALVIFFVASFQMFKIFIARRKAKGEAK"
FT   gene            442297..443199
FT                   /locus_tag="Nther_0423"
FT   CDS_pept        442297..443199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0423"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sth:STH1233
FT                   sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84019"
FT                   /db_xref="GOA:B2A5S6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S6"
FT                   /protein_id="ACB84019.1"
FT                   /translation="MELLGEIFNIPILIASFRLATPLLLAALGGIFSERSGVINIALEG
FT                   MMLFGAFAAVYGTALTGSPWIGMIYGIIAGMLLAALHALVSVQFKADQIISATGINIFA
FT                   TGITLFLLQVIFEVSGTSPGVPRFPAWVLFDVIRFPPTTYFALILVPITWILFFKTPWG
FT                   LRIRAIGEHPEAADTLGVNVNMWRFICVVISGALAGLAGAHLSLGVTGSFVREMTAGRG
FT                   FIALAAMIFGKWNPFGALGAALLFGFADAIAIRVDIPYIPSELIGAIPYVVTIIVLAGL
FT                   IGRATPPRAVGKPYYKGGK"
FT   gene            443333..444490
FT                   /locus_tag="Nther_0424"
FT   CDS_pept        443333..444490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0424"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   amt:Amet_4723 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84020"
FT                   /db_xref="GOA:B2A5S7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S7"
FT                   /protein_id="ACB84020.1"
FT                   /translation="MTKNFILLLVVALLVFINFFSFVVVIPLYVIDLNGSEFHVGFQNA
FT                   LFYISAILFRGYFGPLADVKGRRLPLFIGILAFSGASALFLISNNLWHIYGIRIFQSIG
FT                   LAAFFSTGGSLVGDMAPPGKSGVYMGGYRLINTLALLLGPWIAISTINSFNYQAWFTLG
FT                   AIIGLLALVIACFIEIPTISSQGSEGNVDTTFIDRFKNAFQMENARVIFLGTGIIACSL
FT                   GILQTFASVYTEKVTEIANPGLYFTIFGIAGIIANVLSGYLTDNWGRSKVPWPFLTLMG
FT                   LGLFIFALLPYNEIFFLLSSLIAGFGFGGGITALFTWTIEVSGEQLRATALSIQESAID
FT                   ISIAMGSFIFGILVAMIDYSISFVFVGFVTVVLGVILMRKYSFSN"
FT   sig_peptide     443333..443404
FT                   /locus_tag="Nther_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.900 at
FT                   residue 24"
FT   gene            444567..445316
FT                   /locus_tag="Nther_0425"
FT   CDS_pept        444567..445316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0425"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   amt:Amet_1088 protein of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84021"
FT                   /db_xref="GOA:B2A5S8"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S8"
FT                   /protein_id="ACB84021.1"
FT                   /translation="MICMKTEKISGCQNIIKDPAFKKLLKKMPMLFLGFVLFAIGILLT
FT                   LYADLGMGPWDVFHKGVSHHIPLTLGQVMQVTGVMLLVISYFLGEKPGLGSIFNMYFIG
FT                   LFVDIIDGFGIFFTPENLLLQFIMLILGIQAIGWATYCYLRVQLGAGPRDGLMVGIVKH
FT                   TNKPVWLIRGIIETTVLIIGYFLGGPVGIGTVIIALTIGFSVQLAFKIGGYNAKKVRHQ
FT                   NLVELLNELRRRKSSSSSSSEKTSYGG"
FT   gene            445320..446939
FT                   /locus_tag="Nther_0426"
FT   CDS_pept        445320..446939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0426"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: amt:Amet_3071
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84022"
FT                   /db_xref="GOA:B2A5S9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5S9"
FT                   /protein_id="ACB84022.1"
FT                   /translation="MSEILLKNCRVYTMDESVPYAEQILLKNGKIAQLGTRDDNLASNN
FT                   SVQEMDLGGQTVLPGLNDSHLHLLSYGMALSTVDLSDVSSFRELIAKVQNYIDNNNIPK
FT                   HEWVIGQGFDEENLQEKDFPTREILDQISQCHPVIVKRKCTHVSGVNSYALDLAGITAE
FT                   DNEKIEGGKVYLDQDGKPNGVLAENAQNLLSHILPSYSEKDLEKYIKLAGEAFIDKGLT
FT                   SVQSDDLKAIPGGEDMIMNAYLSLAEKGELPVKVNLQLQLSSEEEITTFIQKYSPYFQS
FT                   SVTDYLNFGPLKVLLDGSLGGKTAALRQPYLGDQENFGIVTYTPESLDSLLDCAARHHL
FT                   QIACHGIGDYAIELFLDSIDKIQAKFGGDYRHRIIHCQLTDLDLINRIARQNISVDAQP
FT                   DFVGSDYGLLEERLGFARSINTYAWKTMLDKGINVSGSSDCPVEPFDPRLGIKAAVTRQ
FT                   DANNNPCGGWHPWEKVSVFEALKMYTVNSAYATFEEQVKGKLAPGYCADMVVLEEDPYS
FT                   TPPQELDSLSVNKVFINGKIVK"
FT   gene            complement(446941..448311)
FT                   /locus_tag="Nther_0427"
FT   CDS_pept        complement(446941..448311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0427"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: cbh:CLC_0236
FT                   pyridine nucleotide-disulphide oxidoreductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84023"
FT                   /db_xref="GOA:B2A5T0"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T0"
FT                   /protein_id="ACB84023.1"
FT                   /translation="MAKKVIIIGGNAAGLSAASQIKRQNPHWDTIVFERTDEVSYASCG
FT                   IPYYIQEQVTDSSNLYALSANKLKQDRGIDLRLHTEIMKINPEDNKVIYNSKDCQNNLL
FT                   EESYDYLLIATGTSPDSKGITINSDKVFSVKYVGDGVRIKNYLKQQTPKKVAVIGGGYI
FT                   ALEMAESLKNLGLDTYFIHRRDQLNRAFMPDISQEALQVLEQNNVNLLLNTEVTKIEDK
FT                   SNNKVAVTTESGNSLEFDMIITAIGVRPNTSFLKESGIELGVNDTIKTSRYMQTNYSNI
FT                   YAAGDVAETVNLVTQKSVFSPLALKANKEGSIAGSNIAAEAHVEKFPGVLKTSILKLFN
FT                   TGIARTGLTENEANQEGFNAETIVIDSPNKPGYYPGSRKLKTVIVFESKTGKLLGAQLI
FT                   GPIEDAKKIDTFAVLTQTGATVDDIYHLDLSYAPPFSPVYDPVVLAGRVARKQSQKS"
FT   gene            448480..449118
FT                   /locus_tag="Nther_0428"
FT   CDS_pept        448480..449118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0428"
FT                   /product="Formiminotransferase-cyclodeaminase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   amt:Amet_4589 formiminotransferase-cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84024"
FT                   /db_xref="GOA:B2A5T1"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T1"
FT                   /protein_id="ACB84024.1"
FT                   /translation="MSLTEKTVEEFLEVLSSKEPAPGGGSVSALAGSLGSCLTTMVGNL
FT                   TIGKKRYRNLDEAEQRELDEKFEQVQKIKTNLDNLIDRDKEAFDEVMAAVKMPKETEEE
FT                   KAKRREALQKATQTALEVPLETARECLKVLQLQEAFARNGNPNAITDVGVGALMAYAGI
FT                   EGAIYNVKINLSDLKDENYKKQVEQEVEKLLTEGQQLKEKIQSMVDEKM"
FT   gene            complement(449175..449420)
FT                   /locus_tag="Nther_0429"
FT   CDS_pept        complement(449175..449420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4974 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84025"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T2"
FT                   /protein_id="ACB84025.1"
FT                   /translation="MEFLIIGLIVIGIIIYFIRQKSSVTSKENQLRKKCKALLNLPPEE
FT                   ADDTLDRLIERQKEKHPGKSEEWYLDKILYDLEKDK"
FT   gene            449511..450407
FT                   /locus_tag="Nther_0430"
FT   CDS_pept        449511..450407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0430"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   cpr:CPR_1328 diacylglycerol kinase catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84026"
FT                   /db_xref="GOA:B2A5T3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T3"
FT                   /protein_id="ACB84026.1"
FT                   /translation="MFLIVYNPKAGHVQSQNLSDLTRKIKERNFQVKSIALTETDFYEQ
FT                   LMDNLTKTRWLISFGGDGTLNTLISYLSPLADEKLPVLIPYPSGTANDFSYQLYGGTPE
FT                   IEQILTAVEREEYCYLDVGKVNDNYFINVLGAGIFVDVAYKTDSALKQRIGMWAYWFEA
FT                   IKQIPNFKPITFFIDDGVNCQEIEGYLLLVLNGKGAGGFKSLAPESSLRDGKLDLVVIK
FT                   ESRTLLSLASLFPKILRGDHLDDHRVTYIQKNTFKIKLDNKTDSDVVCVVDGEKGPDFP
FT                   LEVQVLNQKLPFLHCQY"
FT   gene            complement(450413..451663)
FT                   /locus_tag="Nther_0431"
FT   CDS_pept        complement(450413..451663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0431"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: cpy:Cphy_0398 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84027"
FT                   /db_xref="GOA:B2A5T4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T4"
FT                   /protein_id="ACB84027.1"
FT                   /translation="MSYSIALIGAGHRGKDIYGKFIKNHCPQLKITAVAEPNLYKRKLV
FT                   AREHQVPSQNQFHSYDKLLSQNKLADALLITTMDHDHYKPVMKGIDSGYKILVEKPIAP
FT                   NFHEFTDIVNKAFATKADILVAHVLRYTPFYQKLKQLLTDGTIGKIKSIQHIENVGYFH
FT                   FAHSYVRGNWRNEQVSAPLFLAKSSHDFDLFSWLLDRKSLTVYAQGEQQYFTRENSPEK
FT                   AGKRCFKCQAESNCPYSARHIYLDKHLPWPQEIIDSMPPRYQRYLGVRFTNLGKCVYQC
FT                   DNTMPEILTASLNYEDNIQVSFTLTGLSKEMNRTTTIFGTKGELRADFAHSQIRLMPFR
FT                   GQEKTFEVTKKAGAHGGGDLGLMEHFDGFIKGGNLSKDASTLEESIESHITAFAAEQSR
FT                   ITGKTVEINNLRRQLKY"
FT   gene            451891..453156
FT                   /locus_tag="Nther_0432"
FT   CDS_pept        451891..453156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0432"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bcy:Bcer98_0479 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84028"
FT                   /db_xref="GOA:B2A5T5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T5"
FT                   /protein_id="ACB84028.1"
FT                   /translation="MTKILACGKVFTGETNKVFSRGAVAVQDNEIIDIDVDSQNPGEEL
FT                   KKKYPEAEYYDLSGHTVLPGLIDSHIHLDLHGMADTFDENFVEDKLRSIRASRAMEDTL
FT                   FSGFTTVRNCGSVNWIDISVKEAVRRGIINGPRILTSGKILSITSPGSEYFYGLYREAD
FT                   GYDGFKLAAREQLKMGADLLKLMATGAIMNPGGVPGATQPDEKEIKAIVREAKKLNKKV
FT                   AAHAHGAEGIKNAVRAGVDTIEHGTFADNESHELMVEYGVYLVPTLAPDYFMSKHGKEG
FT                   GVASFIVDKLKKKREARLEALDRAIETGVKIACGSDAGTPYNYHENNAQELKVLVSEGL
FT                   LSPGEAIRSATQYSAEACGLLDELGTISQEKKADIIAVDGDPTENIDVLTDKDNIRFVM
FT                   KDGEIVKDQRSGKHSSISSQSA"
FT   gene            453268..454548
FT                   /locus_tag="Nther_0433"
FT   CDS_pept        453268..454548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csa:Csal_1112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84029"
FT                   /db_xref="GOA:B2A5T6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T6"
FT                   /protein_id="ACB84029.1"
FT                   /translation="MSKKFNVLILCGEKEVPIIQENIKYLENYNVETETSDKILQMGTQ
FT                   KYLEEMIELLNQEPERYHGIIGTRDMTSVFANVIAEKTGKMCTSVESMINCQNKYISRK
FT                   LQQKYVPEATPRFWLDSYFLKEFPIKPPYFVKPVRANMSYSSKKLNSYDDLRELIKDRT
FT                   QELTSYNKYYLDAIHVASHLKNQENLDTCNKFICEELIPGEQVTVNGYIFQGKVKIYGL
FT                   VKAAFWDEKISFSHHEYPYELPEELDTKVKNVVEQAVKGLGLDNTFFNVELRIDQDKKQ
FT                   VYIIEVNSRMAFQFAKMIESVEGVNLVKSLCDLAVGKQPDEEQTNIERRYKYCFNFELR
FT                   EFADRNIVRIPMERNLKEINELYPEVTVKNLVDANSKLSDYKQNLESFRYAIIDVPGNS
FT                   RDEIMEKYRDIKSRLGYEFDSELKEAN"
FT   gene            complement(454634..455782)
FT                   /locus_tag="Nther_0434"
FT   CDS_pept        complement(454634..455782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0434"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   amt:Amet_1614 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84030"
FT                   /db_xref="GOA:B2A5T7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T7"
FT                   /protein_id="ACB84030.1"
FT                   /translation="MTKKTFQTKSFSNLLTVIFCLSMITVLAIPLIGCQDEETKSPKES
FT                   QEETTEKDEKSESEDNKEKDESQTDENEENPEETIDFQEVQPNELGDVMILMYHQIGDE
FT                   EDTWQRTRENFREDLERLYEKDYRLVNLMDVVNGNIDLPPGKTPVVLTFDDASKGQFGY
FT                   IEEDGEKTIDPDTAVGIILEMKEKYDDFTIGGTFYVNYIPVPFRDKELYEEKIAHLDEL
FT                   GFEIGNHGYNHLNLKDLDAQEIQEELGRPHKITENIIPEYQLESLALAFGAWPGQDDLK
FT                   EFVYSGEYEDIEYEHNAVLNVGAEPANSPFHKDFDPLDLPRVRADQKRMDQWLSYYENN
FT                   PEKRYVSDGNPDTITIPQELKEELNTDFKDHKELEIQTYTVD"
FT   sig_peptide     complement(455696..455782)
FT                   /locus_tag="Nther_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.778 at
FT                   residue 29"
FT   misc_feature    455953..456150
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   64.50; T-box leader sequence"
FT   gene            456275..457726
FT                   /locus_tag="Nther_0435"
FT   CDS_pept        456275..457726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0435"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Prolyl-tRNA synthetase, class II-like; KEGG:
FT                   aoe:Clos_0465 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84031"
FT                   /db_xref="GOA:B2A5T8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5T8"
FT                   /protein_id="ACB84031.1"
FT                   /translation="MSKNNEEFVKEITPQSEDYSQWYLDVIKKTKLVDYAPVKGCMVIR
FT                   PYGYAIWEKMKEGLDRRIKETGHENAYFPLFIPESLLQKEADHVEGFAPEVAWITKGGD
FT                   EELSESLAVRPTSEAMFGEMYSDWIQSWRDLPVLINQWANVVRWEKSTKPFLRTSEFLW
FT                   QEGHTAHRTEEDAEEEALQMLDVYKDFVENDMAIPVLNGLKSEKEKFAGALRTFCIEAL
FT                   MSDGRALQAGTSHNLGQHFAKVFDITFLDQDDERKYVWQTSWGVSTRLIGALIMVHGDN
FT                   RGLKIPPKVAPHQLVMVPITPKKQREQVLEESDKLYQELKDKFRVKLDNREEHTPGWKF
FT                   NEWEMKGVPIRLEIGPKDIEKDQVVLVRRDTDEKMFVKRDELIDKLEELIEDIQNKMLQ
FT                   TAKNFLEENTHTASSLDELGQILEQKRGMIKAYWCGNQACEEKVKDDTKATIRVIPFEA
FT                   ETGGSCIACGYHNDDNKEVFFARAY"
FT   gene            457876..458481
FT                   /locus_tag="Nther_0436"
FT   CDS_pept        457876..458481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0436"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   cno:NT01CX_1657 5-formyltetrahydrofolate cyclo-ligase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84032"
FT                   /db_xref="GOA:B2A5T9"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5T9"
FT                   /protein_id="ACB84032.1"
FT                   /translation="MGKEVKAKLRKQMTSKRKSITEKFRRSASDKIINTLITKFLTDDI
FT                   AMIMTYIATKGEVDTYPLIKYGLDKGVGICVPRTFKQTNEMEPVRINDLDRDLQPGSYG
FT                   IPEPVTELTKSVSISDIDIVIVPGVAFDESGYRLGFGGGYYDKFINSLAPSTKNIALAY
FT                   EFQIFEKLPRDSWDKPVHAIITEKQTRFINKSFPGQRE"
FT   gene            458601..459848
FT                   /locus_tag="Nther_0437"
FT   CDS_pept        458601..459848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0437"
FT                   /product="protein of unknown function DUF401"
FT                   /note="PFAM: Citrate transporter; protein of unknown
FT                   function DUF401; KEGG: gsu:GSU1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84033"
FT                   /db_xref="GOA:B2A5U0"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U0"
FT                   /protein_id="ACB84033.1"
FT                   /translation="MEVAGVLLGLVVIMSLTYRRVPIGASMLIASAVIAIMAKMPLSTV
FT                   RGTLLAAIKDDMTIKLVLIVFLIGILGSLLKETGSLDIMLNKLGGLIKDIRILIVLLPS
FT                   LIGLLTVPGGAVLSAPMVEKAGDKINISREKLCAANIVFRHLWYFVFPLYPTLILVTEM
FT                   GDIEMHQFLLFNLPIVIIVFLVSFYYLFYGVTDYKQKSDSSSSSRIRDFTSFIRSISPI
FT                   LVAVFMAMFFDIYLPIALLLGTILAFINYLETKEGQQYIMEQIRNRFKYVKAGMNFNMV
FT                   LAIIGIMVFKDFVEASGAINLIANWMVSLGVSLEILILAATFVTGFLTANHIAGVGIIY
FT                   PVLSPLFPAAEYVPLMGLLFAGGVTGYLISPMHLCLILTREYFEVAFFRMYLHVVPLIL
FT                   MMLLGAGLTAFFWQLF"
FT   gene            459924..460874
FT                   /locus_tag="Nther_0438"
FT   CDS_pept        459924..460874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0438"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: tte:TTE2215 MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84034"
FT                   /db_xref="GOA:B2A5U1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U1"
FT                   /protein_id="ACB84034.1"
FT                   /translation="MDSSDKLENLIDSLSQAILGKREIIRQLVIGISSNGHILFEDVPG
FT                   VGKTTLVKGLAKAIGFRFRRVQCTPDLLPADITGVTVYNNKTGEWDFQAGPIFTQILLA
FT                   DEINRTSPKTQSALLEAMEEQQVTVDGTTRYLTEPFFVLATQNPQEYEGTFPLPESQLD
FT                   RFAMKLTLGYPPKHEEKSLLNKFTYYEPLNYVENIMNPEELLKIQREIEQVYVDDSILE
FT                   YATELSRESREHQQIELGISPRGTLHLIKSAKATACLAGRNFVLPDDIQEMIYPVYSHR
FT                   LVINQAALLERLENEEVIQDIINKVRVPGNTGRFR"
FT   gene            460880..462157
FT                   /locus_tag="Nther_0439"
FT   CDS_pept        460880..462157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0439"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   tte:TTE2214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84035"
FT                   /db_xref="GOA:B2A5U2"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U2"
FT                   /protein_id="ACB84035.1"
FT                   /translation="MEEFKVRFIKKQVFFIPVPVLILAFISGVSVYWILFWFIVLWLGG
FT                   SLAWLLYTAWNLELDIELKDQVMIRKESTSIKIRLFNESFLPFPYGELLTNNWSYRDMS
FT                   GANQKLFDQDQKQDDNHTRIFQFFFNDRQVDSWVEVTDINPLGGWQRVFDVKCYTRGKF
FT                   YIGPMKIRIFSPFSVFLVEKKFDEKELVTVQPRLLSFIGQFDASGSDPQGITRKKNTFF
FT                   QPMDYMEVHDLRPFVSGDPLKLINWKVSARQGELYVKRIENTGDERLLLCVEFSKKYYY
FT                   SREQQDLLLEKALSVVKYFSDNNIQLGILTIDDNLRYLPPSSGRNQWQLARKLFTDLKR
FT                   NTSENLPSYFQRTSQTMKGNKILWLTPYLDRHYKQGLKTLASGGTQITLLIDQKGKNID
FT                   IKDLTIPAYQLNYYRGQVAIKEVFTS"
FT   gene            462154..464400
FT                   /locus_tag="Nther_0440"
FT   CDS_pept        462154..464400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0440"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   aoe:Clos_2651 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84036"
FT                   /db_xref="GOA:B2A5U3"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U3"
FT                   /protein_id="ACB84036.1"
FT                   /translation="MTKSGEGGGYLEFILLLITNCFLVSSFVDFFGYSPQWTWLVVAGA
FT                   IALMVFYFPKVSGISILVAISFICIMVYFSDPIRELFIQVGGDFLTETAVWINHGIAGT
FT                   SVATGISVLVLFGLMLIQLIFINRGKTNFHLVIVGSLAYIGLWFQHYPRAEQELILFLL
FT                   LAVPTSALFHLRTKSYSYAKLSYKIGILILGLITSLVVAAFPKDMGPVTFETGYRFVET
FT                   YFPFLQELRSAETNGEITVGEGEEEEQLEDEKNVEKTEDTEVEREVGYQPGGDLGGALT
FT                   TSTDIVAEIILESGSFPIALYLRGQGNDYYDGSSWDAVQSEDSEDLEEAFRYVDVYQEE
FT                   LEVTVSYKQGEQDIFGLFPTNNVELGKEQEYYNLEIDSYGNMTYSEGKFKGDYKLKGKI
FT                   ISDVNLDNIEPQEELEKSIVNLFPYIQLPEHLPERVKQLSNEITEEAENNLEKARLVEN
FT                   YLSTEYSYETDMPEHPPKEDFVDKFLFEHEKGYCTYFASAMAVLLRVQDVPTRYVEGYR
FT                   VPLYPEDEDLIDAEIADTIETDRMLAQSNHAHAWVEVFLDGYGWVVFESTQPYEITTGL
FT                   IDQEEHLEDTESEKDEDEIVQPREKQPVFVEPLWFSLFIIPVAILGGGTLVVITNLSQV
FT                   KDPIDLYEKMILLRKLYYKEPKPDETPAKIISQYQVEIPELAKDMDDLKRYYEISYYSS
FT                   NSDIVISKRFKETELNKLPLKTAKVYLSRVGLLRFSIGIIRLGIKLLLSKLTGV"
FT   gene            464405..465184
FT                   /locus_tag="Nther_0441"
FT   CDS_pept        464405..465184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0441"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cth:Cthe_3155 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84037"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U4"
FT                   /protein_id="ACB84037.1"
FT                   /translation="MKMTKAFMLRVLGRYAPFPAKNSNCSGYLLTAGEDNFLFDCGNGV
FT                   LSNLQNYLDLSQLSALFITHHHSDHVADLIALRHAYEDLQSRGEVTSKLPVYTPPYPQD
FT                   TVAELEEYPGFDIKFLAEGEDIIIEDKKISWSVTNHFLYCAAYRVEYKEKAFVYTGDNA
FT                   YDNETIEDNSTADIINLSKGADLLLTEASLEEEWKKEPEKRHMSARDAASLAKEAQVKH
FT                   MVISHFHPRADLRKLLRESKQIHPNTSLAVEGTSYLV"
FT   gene            465218..466003
FT                   /locus_tag="Nther_0442"
FT   CDS_pept        465218..466003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0442"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: chy:CHY_1343
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84038"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U5"
FT                   /protein_id="ACB84038.1"
FT                   /translation="MEIIDFKQSNLNRVYKYNEELKKTQSNFKQLKSRLLKKQLLKIIT
FT                   FNKSKKRQIQENICYDKTELDKLEQQIFRLTEKITALEKGVAGEKLVREHLKEQLSDSY
FT                   YLINNFYFFNNSPCEIDHIIVGPAGFVIVETKHLGGKLFVHPCHYKWLRAPLNNPDAIK
FT                   KPMKNPLKQLERNVAEFKSLLSEAEMGELPVQGVLVFPRNSCLLSNRGCGEEFPVLYHD
FT                   ELIEYIDSLEKLDHLSDISRLNCLVDNLIDLANQKNKRT"
FT   gene            466470..467291
FT                   /locus_tag="Nther_0443"
FT   CDS_pept        466470..467291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0443"
FT                   /product="molybdate-binding protein"
FT                   /note="KEGG: csa:Csal_2084 molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84039"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U6"
FT                   /protein_id="ACB84039.1"
FT                   /translation="MTRIELAMFLLITLVFMSVLTACQQNEDKDLIMATTTSVYDSNLI
FT                   ETLMDEYYEQEGVKVQITARGTGASLDLGKRGDVDLVLVHDPKQEIEMLEQGYFIERHE
FT                   LMENDFIIVGPANDPAGISEVKEVDEALQAIIESEQEFISRGDDSGTHRRERQLFEDLG
FT                   EFPEEDKYLSVGQGMGETLRTAEEKQAYTLSDNATYTSLQASNENFELEVLYEGNGKLE
FT                   NIYSILIPQIDDLPETRTEKIENLVEFLLSEEGEKIISQYQKNNNVLFRPK"
FT   sig_peptide     466470..466538
FT                   /locus_tag="Nther_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.950 at
FT                   residue 23"
FT   gene            467489..468937
FT                   /locus_tag="Nther_0444"
FT   CDS_pept        467489..468937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0444"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: glutamine amidotransferase class-II;
FT                   asparagine synthase; KEGG: tex:Teth514_2106 asparagine
FT                   synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84040"
FT                   /db_xref="GOA:B2A5U7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U7"
FT                   /protein_id="ACB84040.1"
FT                   /translation="MSGIVALQGDLKDSEKLETMLSKLEHRGPDARETYTMADSFLGQV
FT                   KSQGEPSFTKKRAATLVLDGQPSYLGKQISREELLNLYLEKGTKFIKQLGDAFTFILSD
FT                   GDELVAARDTFGARPLYYVNCENGLMFASEIKALEELNPDAEIKIFPPGTYYSSTEGFS
FT                   TFKKIPGFQANIHASPGSQRYNQKAEELNRLLIEAVRKNVTDQENIGVFLSGGVDSSII
FT                   AAALDKITDKPIKTFAVGVAGSDDVMKARKVAEFLNSEHKEYTYDYDDMMKVLPEVIYY
FT                   LESFDVELVNSSIANFLVAYLAKESGMEVVLSGEGADELFGGYHHLKDCSTDSELNREL
FT                   EHLLKGLHNGGLQRVDRMTKAHALDCRMPFFDKDVIDFARVIPCNWKITDEGMEKLILR
FT                   QAFDGMLPEEVLWRKKVQFGIGSGNEGVMEEKIKNQITDKEYRNAQKNTSFTFKSKIEY
FT                   YYYKIFKEKHPLKGIESTVNRWLA"
FT   gene            469190..469372
FT                   /locus_tag="Nther_0445"
FT   CDS_pept        469190..469372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_2880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84041"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U8"
FT                   /protein_id="ACB84041.1"
FT                   /translation="MGEKKRSELENMLKSEAVDGRISCAKCTEIAEKTNCALSEVGEVA
FT                   DELKLKIVKCQLGCF"
FT   gene            469414..470655
FT                   /locus_tag="Nther_0446"
FT   CDS_pept        469414..470655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0446"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: pth:PTH_2617 molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84042"
FT                   /db_xref="GOA:B2A5U9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5U9"
FT                   /protein_id="ACB84042.1"
FT                   /translation="MFQVISVEEAISKVTANIDKYFEGLESEQIKSENALGRVLAQDIK
FT                   APSDLPPFSRSTVDGYVVKAKDTFGVSESLPAVLFNKGKIEMGEEPHKTLNQDETMEIS
FT                   TGGMLPSGGDAVVMLEDVETFDDNSIIVNKSVARGENVIEKGEDTQEGVTVLRKGHRLR
FT                   SQDIGALAALGILEISVYHQPVIGIISTGDELIPPEKPLSGGKIRDINSWALSAAVTKL
FT                   GGKPIQYGIIQDEPQYFRESFDKAVTQCDMVILSGGSSVGTRDLTAKTIDLGEPGIIFH
FT                   GVSVKPGKPTIFGIVDNVPVFGLSGNPVSAMVTFDLFVKPAIYGISGVANFGRDWFENI
FT                   TKARLARNISSKGGREDFVRVSLKGEPGEFPEAFPVLGESGLIFTLVEADGLVRIPQNT
FT                   EGYSQGEIIEVIKC"
FT   gene            470671..472599
FT                   /locus_tag="Nther_0447"
FT   CDS_pept        470671..472599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0447"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: drm:Dred_2878 molybdenum cofactor synthesis domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84043"
FT                   /db_xref="GOA:B2A5V0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V0"
FT                   /protein_id="ACB84043.1"
FT                   /translation="MKKNKKRKVYLDNTPLDEALETFFNALSEVEADTLAGETILTENA
FT                   HGRITKEPVFAKVSSPHYHASAMDGIAVDSKKTQGASLRNPKILTTPQDAELVDTGSPI
FT                   PHDKNAVIMIEDVDWAGRNEVEIVESVAPWQHVRTIGEDLVATELIVPAGQKLRPVDIG
FT                   AILAGGVTEVTVEPKPRVAVVPTGTELVEPGERLKPGDVVEFNSRVLSGLVSQWGGKPS
FT                   KEDKLPDDYDLIVETIKSLLPQNDLIIVNAGSSAGAQDYTYQAIKDMGEVISHGVAIKP
FT                   GKPVILGIIDKTPVIGIPGYPVSAVLAMELFVKPLLYKWQNKSVPKQEEITAKISRRVV
FT                   SSFNAQEYLRVKVGKVGDKFVATPLGRGASMIMSLVKSDGMIVIPQMREGLEKGEEIDV
FT                   KLHRSKENIESTIVGIGSHDISLDILSNELSKRYPPYTLSSAHVGSMGGLMALKRGEAH
FT                   MAGVHLLDPETGEYNIPHIKKYLSDQDIILVNLAYREQGLLVAKDNPKNIYGLEDLKRE
FT                   DVKMVNRQKGAGTRILLDYKLEELGISSEQLTGYDREEVNHLSVAAAVNGGTADCGLGI
FT                   RAAAEALDLDFIPVSKERYDIAIPRDFWDWEGIQHILKVIRSEEFKHSIDELSGYDLSA
FT                   SGEILHC"
FT   gene            472614..473126
FT                   /locus_tag="Nther_0448"
FT   CDS_pept        472614..473126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0448"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   hmo:HM1_0061 molybdenum cofactor biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84044"
FT                   /db_xref="GOA:B2A5V1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V1"
FT                   /protein_id="ACB84044.1"
FT                   /translation="MTLYKAGIITASDSGAQGKRVDESGKLLKQYLENSDIGINVEEYQ
FT                   IVPDDRKKLGSLMEDWVRQGIDLILTTGGTGLSPRDFTPEATEDVIDKQVPGFQEEMRR
FT                   MSIEKTPHGMLSRGVAGIRNQTLIINFPGSPKAVTECFNTVKPALSHALETLTGQAKNC
FT                   AQKNNAN"
FT   gene            473384..473671
FT                   /locus_tag="Nther_0449"
FT   CDS_pept        473384..473671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0449"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: gtn:GTNG_0222 GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84045"
FT                   /db_xref="GOA:B2A5V2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5V2"
FT                   /protein_id="ACB84045.1"
FT                   /translation="MNLKPLGDRIVIKILEAEEKTESGIVLPEKAKEKPQEGEVVAVGS
FT                   GKTLDDGSKVEPEVKAGDKVVYSKFAGNEVEVDGEEYLIMRQDDILAVIE"
FT   gene            473698..475344
FT                   /locus_tag="Nther_0450"
FT   CDS_pept        473698..475344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0450"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bha:BH0562 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84046"
FT                   /db_xref="GOA:B2A5V3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5V3"
FT                   /protein_id="ACB84046.1"
FT                   /translation="MAKDIKFREDARARLEQGVNKLADTLKVTLGPKGRNVVLDKKFGS
FT                   PQITNDGVTIARDIDLEDNYENMGAQLVKEVATQTNDVAGDGTTTATILAQAMVNEGIK
FT                   NVTAGANPMIIRKGIQKAVDRAVEELQKNAVSVEDKESISQVASISANDEEVGKLIAEA
FT                   MEKVGKDGVITVEESKSFKTDLNVVEGMQFDRGYVSPYMVTDNEKMEAHLEEPYILITD
FT                   KKIGNIQEILPVLEKIVEQGKEVLLIAEDIEGEALATLVVNKLRGTFTCVGVKAPGFGD
FT                   RRKAMLEDIAVLTGGQVISEDVGLELKNADISMLGRARQVTITKDDTTIVDGYGNEEDI
FT                   QKRITQLRTQIEETTSDFDREKLEERLAKLAGGVAVVEVGAATETEMKEKKLRIEDALN
FT                   STRAAVEEGIVAGGGTALIDVLPSLEEVQADGDESTGVSIVRRALEEPVRQLAHNSGAE
FT                   GSIVAEQVKQKGTNIGFNALENDYTNMLDAGVVDPKKVTRSALENAGSIAAMFLTTEAV
FT                   VADLPDEDDNDDGDMGGGAPGMGGMGGMPGM"
FT   gene            475495..476250
FT                   /locus_tag="Nther_0451"
FT   CDS_pept        475495..476250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0451"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dsy:DSY5018
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84047"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V4"
FT                   /protein_id="ACB84047.1"
FT                   /translation="MSFFMKPKKKALKNIAFVAAGLFIASVVLGAGAGALGFLDGGQQA
FT                   DLSAMEEQVDHLRAEVEADPENVTALRNLGNAKMQVAIQMEQEGEEGAIEYYEKALENF
FT                   ESAVELDEDNPELLVDKATAAYTTQNTEKAEESIEKALELDPENVNALHISAFMMLNEG
FT                   EYDEAIDKWDKILDKDQLAEQEREQFETLIAQAEQLKEIEEMDPKEDLDKEEWEEEFEE
FT                   EYLDEKDNEKEVKKEDEDVDENNDEKEDN"
FT   sig_peptide     475495..475587
FT                   /locus_tag="Nther_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.721 at
FT                   residue 31"
FT   gene            476296..477828
FT                   /locus_tag="Nther_0452"
FT   CDS_pept        476296..477828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0452"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; ExsB family protein; KEGG:
FT                   drm:Dred_2375 GMP synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84048"
FT                   /db_xref="GOA:B2A5V5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5V5"
FT                   /protein_id="ACB84048.1"
FT                   /translation="MSRELVIVLDFGGQYSRLIARRIREHNVYCEIYPYNISINKLKQL
FT                   SPAAIVLSGGPSSVYQEGSPDLDTEIFEIGIPVLGICYGMQLMAKKLGGTVTGSTKREY
FT                   GKALLEIENPNLLTEGVSSDLLVWMSHGDSVEQVPPGFKVMGKTENTPIAGLFNPDKNL
FT                   YGVQFHLEVMHTPKGREMLKNFLFNIADLSADWTMGSYIEETVEQIKTEAQGRKAVCGL
FT                   SGGIDSTVAALLVQKAIGDDLTCIFVNHGLLRKNEQDQVRELFEQEFDINLVYVDASDR
FT                   FLNKLQGVTDPEQKRKIIGEEFIRVFEEEARKIGDVDFLVQGTLYTDVVESGTETASVI
FT                   KSHHNVGGLPEKMDLSLIEPLNSLFKDEVRQVARELGLHREIVERHPFPGPGLAIRVLG
FT                   EITKEKLDILREADAVVSDELKKIGLYHDIWQLFTVLPDIKTVGVKGDERSYDYPIILR
FT                   AVNSEDGMTADWYRFSNDVLERLSNRVVNEVDGVNRFIYDITSKPPATIEWE"
FT   misc_binding    477868..477970
FT                   /bound_moiety="guanine"
FT                   /note="Purine riboswitch as predicted by Rfam (RF00167),
FT                   score 73.44"
FT   gene            478122..479285
FT                   /locus_tag="Nther_0453"
FT   CDS_pept        478122..479285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0453"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: aoe:Clos_0536 phosphoribosylaminoimidazole
FT                   carboxylase, ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84049"
FT                   /db_xref="GOA:B2A5V6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V6"
FT                   /protein_id="ACB84049.1"
FT                   /translation="MYSLYSPELTLGIVGGGQLGRMMTFEAKKLGLKVVVLDPTEQSPA
FT                   AQVADEQIVSSFDDLDGYRTLAKLSDIITYEFEHIHVSGLQEIEAAGVPVRPGSATLAS
FT                   IQHKGKQKELLRTHGIAVPSFQYAKGYQQAASELNKFKFPVMAKLCHGGYDGKGNILLE
FT                   NESDLRKLETMAGENRELMLEKYLRFDKELSVMAAKSANGDTAVFPVVENVHKDEILHL
FT                   TKAPADISSYARDQLISTAEKILEIFSEPGIYGIEFFLLEDDSIMVNEIAPRVHNSGHY
FT                   TIEACNLCQFAVHLRSILGLPLIHPKLEKNAVMINLLGSEQGELPITNYDSLLTHEGVY
FT                   LHLYGKQETRPGRKMGHITITGQNEQDLVSKVNNLEIIDKRGILDEL"
FT   gene            479275..479799
FT                   /locus_tag="Nther_0454"
FT   CDS_pept        479275..479799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0454"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: tpt:Tpet_0474 phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84050"
FT                   /db_xref="GOA:B2A5V7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V7"
FT                   /protein_id="ACB84050.1"
FT                   /translation="MNYKVGVIMGSDSDLPVLQDACDVLEEFQIPYEVDIVSAHRTPEK
FT                   MYQYAQEAKNRGIKVIIAGAGGAAHLPGMVASLTELPVIGVPIKTRSLSGMDSLYSIVQ
FT                   MPAGVPVATVAINGAKNAALLAARMIGSYEERVSQALNDYQEQNRQKVLEKGQELQKIG
FT                   HEQYLKRKEES"
FT   gene            479799..481091
FT                   /locus_tag="Nther_0455"
FT   CDS_pept        479799..481091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0455"
FT                   /product="Adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: bha:BH0625 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84051"
FT                   /db_xref="GOA:B2A5V8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V8"
FT                   /protein_id="ACB84051.1"
FT                   /translation="MIERYQRPEMKQLWSLENKFKKWLQVEIYSCEAFSELGEVPGEAV
FT                   DKIKSNAYFDTQRVLELEKETRHDVIAFTRAVSETLGPEKKYVHYGLTSSDVVDTALSS
FT                   LIRDALTLIEQELDRVLQILRDQARKYKDYPIIGRTHGVHAEPTTLGLKFALFYDELSR
FT                   SRKRLDRAKENISVGKISGAVGTYANVSPYVEEYVCHKLGLQPALTSTQILQRDRHAEL
FT                   MSTLAILAGTMDKIATEIRNLQKTEVREVEEPFYKGQKGSSAMPHKRNPVNCEKISGLS
FT                   RVIRSNAQAAFENQPLWHERDISHSSVERLIIPDSTTLSHYLLNLLAKVLENLHVYPDN
FT                   MEQNLKTTNGLIYSQRVLLNLIDKGLSREKAYDLIQELAMKSWEGDENFQELLKQDSRV
FT                   LEILDKEEIDNCFDPTYYTRNVDYIFERLGI"
FT   gene            481126..482208
FT                   /locus_tag="Nther_0456"
FT   CDS_pept        481126..482208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0456"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: sat:SYN_00889 phosphoribosylaminoimidazole
FT                   synthetase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84052"
FT                   /db_xref="GOA:B2A5V9"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5V9"
FT                   /protein_id="ACB84052.1"
FT                   /translation="MTGNSYRKAGVDVDKGNKIAENIKELTSSEASGHVISGVGGFGAL
FT                   FQPKGEYNDPVYIAATDGVGTKLKLARLANKFDTIGIDLVAMCVNDVLAQGGQPLIFLD
FT                   YLAMDSLEEDLIQDIIQGIVAGCHQSDCSLVGGETAEMPGFYQNGLFDLAGFCVGVVEK
FT                   DNIVDGSSIKETDQVIGISSSGVHSNGLSLVRKTLIKEEGGQYELDETPSNLETNLGEE
FT                   LLKPTKIYVKPVLSLMEKFSVAGMAHITGGGLPDNLSRIVPDNLSFSLDLQKLQKMVLP
FT                   VFSLIQTTGDIPDHDMWRTFNMGIGFTVVLPAEEAQQACEFLREQGEKAEIIGTVEQLS
FT                   QQQGDGVQSGERVMFVNGDK"
FT   gene            482195..482818
FT                   /locus_tag="Nther_0457"
FT   CDS_pept        482195..482818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0457"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: chy:CHY_1077 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84053"
FT                   /db_xref="GOA:B2A5W0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W0"
FT                   /protein_id="ACB84053.1"
FT                   /translation="MEINKDPRYAVLASGSGTIFQSIIDAQKRGDIPGELALFLTDKQD
FT                   CQAKTRAEKAGIETRVFQPKNYTSKQAMEEEMLAVLTAQEIDYVVLAGYLRILSPEFIR
FT                   NFRHRIINTHPSLLPAFKGLDAVKQAYDHGVKVTGCTVHLVTEELDSGPILLQEEVKVQ
FT                   RHDSLDELREKIKNKERRLIITAIRALLKGEVIVDNHKRWVVEN"
FT   gene            482815..484344
FT                   /locus_tag="Nther_0458"
FT   CDS_pept        482815..484344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0458"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: oih:OB0749 IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84054"
FT                   /db_xref="GOA:B2A5W1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5W1"
FT                   /protein_id="ACB84054.1"
FT                   /translation="MTIQKINRVLLSVYDKTGLITLAQELKDMGVELVSTGGTLRHLQT
FT                   HGIPVYSVEEVTGFPEILSGRVKTLHPKIHGGILAKNRENEELSSLDIKTFDLVIVNLY
FT                   PFEQVMQKAEATEEEVMENIDIGGPTMIRAAAKNWYRVGVCVDPTDYEVLTQQLKQYHG
FT                   LTDEFRKTLARKAFKHTAQYDKAIFNYFESVDTNKDDETELKFPEFNLLESRELPYGEN
FT                   PHQKASLLMESQKFIQHQGKGLSYNNFQDIDAAIKLVHEFQKPAVVAVKHTNPCGVGVS
FT                   NTIEEAYDKAYQGDPVSIFGGIVACNRPVTEELASKLTEIFLDVIIAPEFEPRALEKLK
FT                   SKSGTKVVEMDLEKMVGNKVEIKSTTFGYLCQEADYHHPHPQNWDRVAGEQAKPEEIDD
FT                   LIIAEKIVKHVKSNAIVVVKEGQSLGIGAGQMNRVGASRIALENAGKESQNSVLASDAF
FT                   FPFNDVVKLCSQYGVSAIVQPGGSKRDQDSIDLAQETGITMYFTGIRHFKH"
FT   gene            484373..485662
FT                   /locus_tag="Nther_0459"
FT   CDS_pept        484373..485662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0459"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: tex:Teth514_0526 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84055"
FT                   /db_xref="GOA:B2A5W2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W2"
FT                   /protein_id="ACB84055.1"
FT                   /translation="MKVLVIGSGGREHALVKKIAESSRVTDLYVAPGNHGIAKDAECID
FT                   IKETDINKLADLAIQKDIDLTIVGPEQPLSQGIVDHFQSKGLNIFGPSQKAAKIETSKW
FT                   FAKQLMQTYGIPTGKAEYIEGDAGLDNLEKGLSALEDMSPPFVVKADGLYAGKGVIVTE
FT                   EISEAEQAVENFLSEHTSILIEEYLEGEELSLLAFSDGHKVLPLIPSQDYKRAYDNDQG
FT                   PNTGGMGSYAPVPSISQEQLEWIVDNIMQPTITALKKQGVTYQGILYAGLILTDSGPKV
FT                   LEFNARFGDPETQAILPLLKTDILEPIMGVVAGNLETELKEPLKDALSWKAEKAVCVVL
FT                   ASGGYPKEYQKGFPIKIPQELLTWNNVNLYYAGVASENGTPVTAGGRVLNVTGIGESWK
FT                   EARENAYEGVSTVEFDGKHFRNDIALQTLK"
FT   gene            485659..486027
FT                   /locus_tag="Nther_0460"
FT   CDS_pept        485659..486027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0460"
FT                   /product="TrpR like protein, YerC/YecD"
FT                   /note="TIGRFAM: TrpR like protein, YerC/YecD; PFAM: Trp
FT                   repressor; KEGG: chy:CHY_1082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84056"
FT                   /db_xref="GOA:B2A5W3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W3"
FT                   /protein_id="ACB84056.1"
FT                   /translation="MIKYQWDNQVIFIREEFPIFFGGDVIRNVQDDYMDQFYKAILSLE
FT                   TLEDCYSFFEDVATVTEIKALAQRFQVAKMLKEGYTYQDIEEKTGASTATISRVKRFLH
FT                   YGAGGYEVALKKLNQKEQ"
FT   gene            486103..488283
FT                   /locus_tag="Nther_0461"
FT   CDS_pept        486103..488283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0461"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bpu:BPUM_0625
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84057"
FT                   /db_xref="GOA:B2A5W4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W4"
FT                   /protein_id="ACB84057.1"
FT                   /translation="MVVSSQLAELNQEQTAAVTAGDGPVLVLAGAGSGKTKVLTYRIAY
FT                   LLETKGIHPEQILALTFTNKAAGEMKERVQTIVEGDAPSWVSTFHAACVRILRREIDLL
FT                   GYGKDFLIYDTRDKTKIVKDLLADFNLDKKKYPHQAVAKKISGVKNNLQDPRELFYPYD
FT                   EVFEAYQKRLKKENALDFDDLLLLTLRLFEQYPDRLQYYQNKFQYILVDEFQDTNPAQN
FT                   RLISLLSPPQDNVFVVGDDDQSIYLFRGADVKNILEFEKTYPNAQVYKLEKNYRSSKTI
FT                   LEAANQVVTNNPSRKSKELWTDNDEGYPLQYYEADDERDEAYFIAEEIRANRYQLPLIA
FT                   VLYRTNAQSRVLEDIFRKMGISYEVVGGTGFYDRKEVKDIMAYLMVVQCPQSDSQLERI
FT                   INEPKRGIGKTSVDKLKDYANRNNITLFDALLEVDYTDISKRGKNSVKKFTDMIGNFRK
FT                   MREYLTVRELIEEVAEKSGYLEALRSQNTKEAETRMENVREIYSMAKEFEAEGGETLQE
FT                   FLTHSTLMGDIDTWEDEEQAQVVMMTLHSAKGLEFPGVFLTGLEEGVFPHIRTYDSEAS
FT                   MEEERRLCYVGITRAEQVLYLTWARERTLNGMTRMLQPSRFVSEIGEDLKDTQHQTLSG
FT                   QGQVTSTQNSHEPPQTQISSFSDKTSPSGKRNVNLAEESYQEGDLISHKKWGEGKVLQA
FT                   QQAGSDWVLTVSFDGAGIKKLAASVAPIKKLK"
FT   gene            488294..490285
FT                   /locus_tag="Nther_0462"
FT   CDS_pept        488294..490285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0462"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: tte:TTE0605 NAD-dependent DNA ligase (contains
FT                   BRCT domain type II); TIGRFAM: DNA ligase, NAD-dependent;
FT                   PFAM: helix-hairpin-helix motif; BRCT domain protein;
FT                   zinc-finger NAD-dependent DNA ligase C4-type; NAD-dependent
FT                   DNA ligase OB-fold; NAD-dependent DNA ligase adenylation;
FT                   SMART: Helix-hairpin-helix DNA-binding class 1;
FT                   NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84058"
FT                   /db_xref="GOA:B2A5W5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5W5"
FT                   /protein_id="ACB84058.1"
FT                   /translation="MSKDIQKKVEALREKIEYHNHRYYVLDAPEISDQEFDALMNELIE
FT                   LEQTYPEYQSPDSPSQRVGGEPLDKFPRVSHEIPMLSLENAESQKGLLDFHQRVSKNTQ
FT                   KTDPVYVAELKIDGLALSLRYEQGILVRGATRGDGTTGEDITPNVKTVRSIPLKLSKPL
FT                   DIEIRGEAFMSKASFERLNQEKAERGEDPFANPRNAAAGSLRQLDPKIPAKRDLDFFPY
FT                   SVPYIRGENLDSHYSAVKELKDLGFKINPYIRKFETMEEVISYCEEWQEKRTKLPYEID
FT                   GVVIKLNDYNLQQQLGATSKNPRWAIAYKFPAEQAESQVNNIFINVGRTGALTPVVELE
FT                   PVRIAGSTVKRASLHNEDILRQKDVRIGDRVIIQKAGDIIPEVVKVKEEARTGHEQPFV
FT                   YPESCPVCKSEAKRINDEAILRCINPGCPAQAKERIIHFSSRDAMDIEGLGEKVVEKLY
FT                   SHGLIKDVADIYYLAKNELSNLEGFGDKSAENLLQAIEESKKNPFNKLLYGLGIRLVGK
FT                   RAAQLLAFEFEHLDNLMKAQIEDLTKINDIGPRMATSIVSFFQLEHTHNLIRKLKKAGV
FT                   NMKEPTEQNKSSDPSLTGKLVVITGTFDNYTRRELTDLIEAKGAKVTSNVSSNTDFVLV
FT                   GANPGSKRDKAQDLGLTIIEESDLEDFL"
FT   gene            490370..490657
FT                   /locus_tag="Nther_0463"
FT   CDS_pept        490370..490657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0463"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: chy:CHY_1101 glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84059"
FT                   /db_xref="GOA:B2A5W6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5W6"
FT                   /protein_id="ACB84059.1"
FT                   /translation="MKVSKEEVLHVAKLGQLDLDQEEVEMFQDKLSQILEWQEKLDELD
FT                   LEGLEPTAHALERRNVTREDQVHNSLTNDKALENAPETEGNYFKVPRIIE"
FT   gene            490675..492150
FT                   /locus_tag="Nther_0464"
FT   CDS_pept        490675..492150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0464"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: chy:CHY_1102 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84060"
FT                   /db_xref="GOA:B2A5W7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A5W7"
FT                   /protein_id="ACB84060.1"
FT                   /translation="MKLHELTLMEVKRGLEQGDFSSEELVTSVYDRIEETEDHIKAYIT
FT                   LTKEQALAQSKEIDSQRAKGEELGPLAGIPVAIKDNICTKDVTTSCASKILEDFVPPYN
FT                   ATVISKLAEAGAIIVGKTNMDEFAMGSSTENSAFFVTSNPWDTERVPGGSSGGSAASVA
FT                   SAQVPLALGSDTGGSIRQPASFCGVVGMKPTYGRVSRYGLVAFASSLDQIGPLSKNVED
FT                   TALALDIISGHDHMDSTSVDLEVPNHTDFLNQDIDELTIGIPKEYYELVDNDVKSLVES
FT                   SLQSIEPEAGNYRQVSLPTTEHALSAYYLIAPAEASSNLARFDGVRYGQRFATDDLKTM
FT                   YNQTRKEGFGNEVKQRVMLGTYALSAGYYDALYLKALKVRSLIKQEFEQVFSECDVLIA
FT                   PTTPTVPFREGENVDDPLTMYKNDICTAPVNLAGLPSISIPCGFSNGLPVGLQVIGKAF
FT                   DEGKVIQVAHKIEQMLQVFKNAPQQGLDNQGGK"
FT   gene            492153..493586
FT                   /locus_tag="Nther_0465"
FT   CDS_pept        492153..493586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0465"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: tex:Teth514_0541
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84061"
FT                   /db_xref="GOA:B2A5W8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W8"
FT                   /protein_id="ACB84061.1"
FT                   /translation="MANYETVIGLEVHSELLTSTKIFCGCSTSFGDEPNSNVCPICLGM
FT                   PGTLPVLNNRALELAAKAGLSLNCEIADFSKFDRKNYFYPDLPKAYQISQFDLPIAKNG
FT                   YLDVTVNGEKKRIRINRIHMEEDAGKLVHSERGGGSLVDFNRTGVPLIEIVTEPDIGSP
FT                   EEAKAFLEGLKAILQYTDVSDCKMEEGSLRCDANVSLRPVGSTEFGTKTEVKNMNSFRA
FT                   VERALNYEVERQAEALEDGEEIIQETRRWDEDRGITISMRSKEEAHDYRYFPDPDLVPV
FT                   VMKEEQIEKVRQEIPELPNDKKERFIKDFNLSEYDASVITADKSLAEFFDECVKTYDEP
FT                   KKIANWIMGEISRVLNEDQIGIEDTNISPERLTELLKLEDEGTISNKIAKEVFEDMYQN
FT                   DKSPKQIVEEKGLVQISDTSELEGIIDQVISENPSAVEDYRGGKKKAMGFLVGQVMKKT
FT                   KGKANPQKVNELLQEKLEN"
FT   gene            complement(493668..494945)
FT                   /locus_tag="Nther_0466"
FT   CDS_pept        complement(493668..494945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0466"
FT                   /product="protein of unknown function DUF401"
FT                   /note="PFAM: Citrate transporter; protein of unknown
FT                   function DUF401; KEGG: gsu:GSU1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84062"
FT                   /db_xref="GOA:B2A5W9"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5W9"
FT                   /protein_id="ACB84062.1"
FT                   /translation="MEILGVFIAIITIIYLVRKNKHLGGAMTLGALIVAIFSGMTLPEK
FT                   ADTLFYSVTHPTTVNIMLIVLMINIFSTMLKKTNSLDIMLNSLTKLLPDRRILLVTIPS
FT                   LIGMLTVPGGAVLSAPMIQNAGDQINLSKAKLAAANMFYRHVWHLIFPLIPSIILISEL
FT                   SQVPLRFFILFNLPIFLVTFIIGFKWLFRNHRHSFYSHEESSQSYQTTQNYDSDEENNN
FT                   LIAFLKSIYPLILAVGLGIFSPLDIPVSLLIGVLLASLNYLDWNEKPVIQIRNRIIYSI
FT                   KQSKYGMVLTILGIMIFKDFVEASGAVETMTESLLASGIPSIFLVLLVPLITAAITGVN
FT                   SAALGISYPIMAPLMNPHDGNLALLGIFYAASVFGYFLSPFHLCLILTKEYFQTTFNSL
FT                   YRELILPASFMLIGGIIVGVFWGVLS"
FT   gene            495086..496450
FT                   /locus_tag="Nther_0467"
FT   CDS_pept        495086..496450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0467"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; KEGG: bha:BH0687 RNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84063"
FT                   /db_xref="GOA:B2A5X0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X0"
FT                   /protein_id="ACB84063.1"
FT                   /translation="MPDIRPVKKEEKLTLTIHDLNHQGEGVGKYRNFAIFVPFALPGEK
FT                   VRITITEVKKNYARGQVLQHQDRSSQRVKPPCPFFQECGGCQLQHLSYKGQLQYKENLV
FT                   ANQMKKVAGLKNPRVLPAIGMESPWYYRNKFQIPVKPIGGKPRLGLFQKRSQNLVEIDH
FT                   CMIQKHGNNEVLEKMRNLVDSYEKEFYNCELKHIISRVGDKTDQVQLTFVTGSEKIDNK
FT                   QMILEPLKNGMANLVGIVQNINKKPRGNVLGDRFKTLWGREYLMDNLLDKKFRVSAGAF
FT                   YQVNPSQTEVLYQKVFELCKLKGVENVMDIYCGIGTISLLAAENASKVVGIEIAEEAVK
FT                   DANINKNINGQENAWFYQARAEDEKTESIIQDYSPEIVIMDPPRKGCDENLLTSLDWIR
FT                   PEKIAYVSCNPATLARDVGKLIEFGYYPELFQPVDMFPQTTHIEVICILTKIDYL"
FT   gene            complement(496431..497039)
FT                   /locus_tag="Nther_0468"
FT   CDS_pept        complement(496431..497039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0468"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aoe:Clos_1340 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84064"
FT                   /db_xref="GOA:B2A5X1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X1"
FT                   /protein_id="ACB84064.1"
FT                   /translation="MNRPDIISKFNNRSSSIMGIKVKNSVLLPLVSINQEWQLIFQVRS
FT                   QQIKSQPGEISFPGGKIEPGESSRNAAIRETSEELGIQTNSISIWGQLDLLVTPFNMMI
FT                   VPYIGEIHTLPKDFNINLQEVSEVFTVPLDFFVKENPYKYRMQVGITPPHDFPFNLVPG
FT                   GKNYPFKQGEYPSYFYIYGDYVIWGFTARIIKNFIDNLS"
FT   gene            497222..498343
FT                   /locus_tag="Nther_0469"
FT   CDS_pept        497222..498343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0469"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; KEGG:
FT                   csc:Csac_1323 protein of unknown function DUF362"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84065"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X2"
FT                   /protein_id="ACB84065.1"
FT                   /translation="MNKINSQAIYISYGDDPKSMVKELFDKYPPFPELNYNAKIGLKPN
FT                   LVLPNSSESGATTSPELVSGIVEHFLSRGFKKLIIMESSWVGASTEASFEKCGYTAISN
FT                   RYNLPLVDLKTVPTKAITFKDHTIKIATPPLQVDRLVNVPVLKAHCQTDVTCALKNLKG
FT                   CLPDSEKRNFHIQGLDHYIATLNQILFPDLTIVDAILGDLTFEEGGNPVNMGRILMGTD
FT                   PVLIDSYGAHLLGYSSDKLPSHIELAGQSGVGSVYHPEKHEIVELNRNRRQMDFFRTRG
FT                   PFLNELKSYLEEDMACSPCTGSVYQALMRLKDEGSLKKLKVKIALGQGVNKWTRDYIEG
FT                   HLGVGECTRHCSDYVSGCPPRADKILSMLKNYL"
FT   gene            498680..499909
FT                   /locus_tag="Nther_0470"
FT   CDS_pept        498680..499909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0470"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; FAD dependent
FT                   oxidoreductase; Thioredoxin domain; KEGG: ppr:PBPRB1551
FT                   hypothetical thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84066"
FT                   /db_xref="GOA:B2A5X3"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X3"
FT                   /protein_id="ACB84066.1"
FT                   /translation="MSDVFDVLIIGGGPAGLTAGIYASRSKLKTAILEKKRKPGGQMST
FT                   TWELENYPGFKEATGPDIAKSLSEHAEKFGCEFLKGEVKEIDLHSNPKVVTSKKGEEYH
FT                   AKSVIMATGAEPRTLGLPGEHEFRGLGVGYCATCDADFYTDQEVIVIGSGDAAVEEAIY
FT                   LTRFAKKVTIVVVHEEGKMDATKVIQERAFENPKIDYIWNSVVEEIKGDELVDRVVVKN
FT                   IKTGETSEVKTDGVFIFVGTIPKTEFIEGQVELTEQGYVKVNDQMETSVPGVYSAGDVN
FT                   DKFLRQVVTACADGAIAATACERFLEERQDIEEKIEEPSQEKSVIVVFWSPTVKESMEA
FT                   ISQLEEVVGNDNQVKIVNIDTYKSTGIADNYQINEIPSIIAVRNKKVVASLTGKEVNKE
FT                   KLADFYQDLV"
FT   gene            499986..500303
FT                   /locus_tag="Nther_0471"
FT   CDS_pept        499986..500303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0471"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: cbf:CLI_1345
FT                   thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84067"
FT                   /db_xref="GOA:B2A5X4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X4"
FT                   /protein_id="ACB84067.1"
FT                   /translation="MQEVDKNNFEEEVLQAEGVVMVDFFSPNCEPCNELKPEIEDMAEK
FT                   YKDKMKFCALDISKNRRLAINQKVLNLPTIVFYKDGEKISTLTGEDLEAEEIEDEVKKH
FT                   I"
FT   gene            500352..501638
FT                   /locus_tag="Nther_0472"
FT   CDS_pept        500352..501638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0472"
FT                   /product="Sarcosine reductase"
FT                   /EC_number="1.21.4.3"
FT                   /note="PFAM: Glycine/sarcosine/betaine reductase complex
FT                   protein B alpha and beta subunits; KEGG: chy:CHY_2391
FT                   glycine reductase proprotein GrdE"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84068"
FT                   /db_xref="GOA:B2A5X5"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR016585"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X5"
FT                   /protein_id="ACB84068.1"
FT                   /translation="MSLRLEKVNVKDVKLGSETSYKNGVVTVNKDELIEELKQDDRIGS
FT                   IEIEVVKPGESVRIIPVKDVIEPRIKVEGEGELFPGLLGKVSTVGSGTTKTFNGMSVVT
FT                   TGKLVGFQEGIIDMDGPGADYSPFSKTLNLVVNCEPVKGLKSHEHEEALRLAGLKAARY
FT                   IAEACQDAQADEQEDYEALPVEEMKSKYPNLPKVGYVYMLQSQGLLHDTWVYGIDAKEI
FT                   IPTCIYPTEVLDGAIVSGNCVSACDKNTTYHHLNNPIIKDLYARHGKDINFCGVILTNE
FT                   NVTLAAKERSSGYTAKLAEMLGLDGVIVSQEGFGNPDTDLIMNCVKIEDKGIKTVLVTD
FT                   EYAGRDGASQSLADADPKADAVVTAGNANETIVLPPMDKVVGILETADSIAGGFEGSLR
FT                   HDKSIEVELQTITGATNQLGFNKLGAIEA"
FT   gene            501696..502163
FT                   /locus_tag="Nther_0473"
FT   CDS_pept        501696..502163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:501819..501821,aa:Sec)
FT                   /locus_tag="Nther_0473"
FT                   /product="Betaine reductase"
FT                   /EC_number="1.21.4.4"
FT                   /note="PFAM: glycine reductase complex selenoprotein A;
FT                   KEGG: cbf:CLI_1346 glycine reductase complex component A,
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84069"
FT                   /db_xref="GOA:B2A5X6"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X6"
FT                   /protein_id="ACB84069.1"
FT                   /translation="MFEGKKVVILGDRDGIPGPAIEECIKTTGAEVVYSTTECFVUTSA
FT                   GAMDLENQKRVKELTDKHGPENLIVIIGGADAEGSGLATETVTNGDPTFAGPLAGVQLG
FT                   LKCYHIVEPEVKEAVDSSVYEEQVEMMEMVLEVDEIIQEVKEYREKYCKFL"
FT   gene            502191..503498
FT                   /locus_tag="Nther_0474"
FT   CDS_pept        502191..503498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:503235..503237,aa:Sec)
FT                   /locus_tag="Nther_0474"
FT                   /product="selenoprotein B,
FT                   glycine/betaine/sarcosine/D-proline reductase family"
FT                   /EC_number="1.21.4.3"
FT                   /note="KEGG: chy:CHY_2393 glycine reductase, selenoprotein
FT                   B; TIGRFAM: glycine reductase, selenoprotein B;
FT                   selenoprotein B, glycine/betaine/sarcosine/D-proline
FT                   reductase family; PFAM: Selenoprotein B
FT                   glycine/betaine/sarcosine/D-proline reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84070"
FT                   /db_xref="GOA:B2A5X7"
FT                   /db_xref="InterPro:IPR010186"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X7"
FT                   /protein_id="ACB84070.1"
FT                   /translation="MSKKIVHYINQFFGQIGGEEKADTAPFVKEEPVGPGTALNGQLGD
FT                   EGEIVATIICGDDYFSSNTEEAKEEIRKVLRDYDPDLVITGPAFNAGRYGTAAGGVAEL
FT                   AATEFELPVVSGMYPENPGVDMYKKYAYIIETSDSAAGMRKAAPAIAELSKKILRGEEL
FT                   GTPKEEGYIPRGIRKNVFFEERGSKRGVDMLVKKLNQEKFDTEYPMPDFDRVDPQPAIK
FT                   DMANAKIALVTSGGIVPKGNPDGIESSSASKYGKYELKGMDTLTAESHETAHGGYDPTY
FT                   ANENPNRVLPLDAARKLEQEGRIAELHEYFYSTVGNGTSVGNAQQYAAEIAEDLKNHGV
FT                   DAVIQTSTUGTCTRCGATMVKEYERAGLPAVHVASIVPISKTVGANRIVPAVAIPHPLG
FT                   NPKLDEEEEFKVRKDLVDKALKALETELETQTVFED"
FT   gene            503618..505171
FT                   /locus_tag="Nther_0475"
FT   CDS_pept        503618..505171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0475"
FT                   /product="Betaine reductase"
FT                   /EC_number="1.21.4.4"
FT                   /note="KEGG: cbh:CLC_1301 glycine reductase complex
FT                   component C, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84071"
FT                   /db_xref="GOA:B2A5X8"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X8"
FT                   /protein_id="ACB84071.1"
FT                   /translation="MAASVVGGNSYILVHAPNTMKYHGSTQQSDRHKNPESDYLKNLPN
FT                   YMRSFEDAVKYPPNQTYIGNISPDELAQIEKPWYQNLDQGDRYSDWGEIMPEDEFFGLV
FT                   QISDSFDLVKLEENFVNEIKPKLEKNPVITKDHVAKLSGTNKDEIKEIVDNGNGEPLYI
FT                   DDNLVGCVKSAHETDQNLNAHVMLENLMAKASGSLALLHLGNQQGVDLSQTDYVMEVSE
FT                   EACGDVNQRGGGNFAKAIAEIAGCENATGSDVRTFCSAPAHAMINAAALVEAGVYEQVA
FT                   IVAGGAVAKLGMNGKDHVKQEMPVLEDCLGGLALLISKNDGQNPIIRTDAIGKHNVGTG
FT                   SAPQAVISSLTTTPLEKLGLTVTDIDKYSVEMQNPELTQPAGAGDVPASNYKMIGALGV
FT                   KKGQLEKKDMMNFVQERGMPGFAPTQGHIPSGVPFVGHARRMLDKGEISKAMIIGKGSL
FT                   FLGRLTNLFDGISFVMEPNQGDVDEEGTVSKEEIKQIVAGSLRDLADSLSENADNESDS
FT                   "
FT   gene            505183..506343
FT                   /locus_tag="Nther_0476"
FT   CDS_pept        505183..506343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0476"
FT                   /product="Glycine reductase"
FT                   /EC_number="1.21.4.2"
FT                   /note="PFAM: fatty acid synthesis plsX protein; KEGG:
FT                   aoe:Clos_0960 glycine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84072"
FT                   /db_xref="GOA:B2A5X9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012116"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5X9"
FT                   /protein_id="ACB84072.1"
FT                   /translation="MSQKVKNQLSEVFHELAEALESGQYGKKSKICVTTLGSEHGPEEV
FT                   VKGAELAKQQNPGIDITLVGPKVDTKLTYAKETDCEETVHKTMEDLLSKGEADASVTMH
FT                   YNFPVGTATVGKVITPGLGKEMLIATTTGTAGMNRIEAMIKNAIYGVITAKALGNPDPK
FT                   IGILNVDGAKQVEKALIDLKENGYSIEFAESARQDGGFVMRGNDLLAGSADVMVTDTLT
FT                   GNLLMKIFSAYTTGGSYESLGYGYGPGVGKDQKQVVNIISRASGAPVIAGAIKFAAEAS
FT                   AGGIVKLTNEEFKKAEQAGLNEILEGSKSSQDAGETEEVTPPPKKPVSEEISGMDIMIL
FT                   EDARKVLWKEDVYAETGMGCAGPVVMVAPEDKEEAEKILREHGYLS"
FT   gene            507157..508878
FT                   /locus_tag="Nther_0477"
FT   CDS_pept        507157..508878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0477"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: amt:Amet_2915 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84073"
FT                   /db_xref="GOA:B2A5Y0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5Y0"
FT                   /protein_id="ACB84073.1"
FT                   /translation="MSSRKLFVLFLALMFATAVAIGGCAPPEEAKEEDPEAEEEEEAPA
FT                   EVDNPAVERPNEIVIGGPDLEGIFNPVLYSGVYDSWVLGMIFDSLLTVDENGQLTTDQR
FT                   SVAKDYEISEDGTVYTFHLREGWEFHDGEEITAEDVAFSLEVTAHPDYDGPRSSFSDDI
FT                   VGVDEFREGETDELEGITVEDDYTLVVEAQEPSADNIFDFAVMIMPKHYYDFENYEDFQ
FT                   DLTDDPMGSGPFELVEYSPDQHAILESFEDYYHGAPNVDRIIYEETETEQQIPMVETGE
FT                   ADIVQVSSTPENMEMLEDIDHQEALTFFDNAYTYIGLNHEDEHLQHQEVRQALAYALDI
FT                   EAFLDGMFGDELAQPIYTPFSPVSWAYPDEDDMNDYAYDPDKANELLDEAGYEWDDNEE
FT                   YRVNEDGERLSFTWETIADNEWSEHLTTLALEQWPQIGVELEIENYDFNTLTDRIDQDR
FT                   GDVDMWNMGWSLSAEPDPSNIFSVEYADAGLNYGMYHNEEAEELMQEGLETFDQDERAE
FT                   VYNELGVLFNEDLPYIFVYSNKEIWSTNDRVENYEPTAFQHLTWNIHEWEVTDYEE"
FT   sig_peptide     507157..507249
FT                   /locus_tag="Nther_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.483 at
FT                   residue 31"
FT   gene            508990..509955
FT                   /locus_tag="Nther_0478"
FT   CDS_pept        508990..509955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0478"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: amt:Amet_2914
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84074"
FT                   /db_xref="GOA:B2A5R1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R1"
FT                   /protein_id="ACB84074.1"
FT                   /translation="MGTYIVRRVLIMIPVLLGITVFLFSLFQLAPGNPLASLHQDPDMT
FT                   PEARERIEEQYGLNQPVHIQYLDYMGNLFQGDMGMSFQYRRDVSFLIAHRIGPTFILSF
FT                   GAFLLALVVAIPAGIISATRQYTSVDNAFTVFALIGVSIPNFFFGLVMMRVFAVALGWF
FT                   PTGGMQTSGADFPFPWNILDVANHLVLPAIVLGLSSAAHFMRYTRSSMLEVIRQDYIRT
FT                   ARAKGLKERIVIYKHALRNALIPIITLMGFQLPMLFSGSLVVEIVFGWPGMGRLAYNAV
FT                   MQRDYPLMMGVNLFLAIFILLGNLLADIAYAFVDPRIRYD"
FT   gene            510018..510932
FT                   /locus_tag="Nther_0479"
FT   CDS_pept        510018..510932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0479"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: amt:Amet_2913
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84075"
FT                   /db_xref="GOA:B2A5R2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R2"
FT                   /protein_id="ACB84075.1"
FT                   /translation="MAKNELNESTSQEVQSHGLSEEVESPIKLIWRRFKRNRLALIGLI
FT                   VLLILVFGAVFAPFLTPHDRDTIDYANADAEPDSEHILGTDDRGRDMFTRLLYAGRVSL
FT                   SVGIFATLLRILIGVTLGGIAGYYGGAVDNVIMRIADVFMSFPFLPIALTFVAILGPSI
FT                   YNIMLVIAIIGWPGICRIVRAEILSLREQEFIEAAKALGLSDRTQIIKHLIPNTMAPII
FT                   VSATLGIAGAILTESFLSYLGLGVSPPTPTWGNLLSAAQESYIIRNRWWQWVPPGIMIF
FT                   LAVMSLNLLGDGLRDALDPKLKE"
FT   gene            510945..511928
FT                   /locus_tag="Nther_0480"
FT   CDS_pept        510945..511928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0480"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: aoe:Clos_1344 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84076"
FT                   /db_xref="GOA:B2A5R3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R3"
FT                   /protein_id="ACB84076.1"
FT                   /translation="MSDTLLEVKGLQTYFYTEDGTVKAVDGVDFHVNRGEILGIVGESG
FT                   CGKSVSNMSILRLIQDPPGKIVGGEINFEGTNLLELPENKMRNIRGNDIAMIFQEPMTS
FT                   LNPVFTVGDQIMEALLLHRNMSMEEARNHAVEMLKTVGIPRANEAIDEYPHQFSGGMRQ
FT                   RAMIAMALSCNPSLLLADEPTTALDVTIQKQILELIKDMKEQYDTGITLITHDLGVIAD
FT                   MADRVVVMYAGKVVEQADIFEIFDKPLHPYTSGLHESIPTMDTEAERLKVIRGVVPNPL
FT                   TMPEGCPFHPRCDHEMTKCREKMPPLMDLNGRQVRCWLYSEDKEVG"
FT   gene            511932..512933
FT                   /locus_tag="Nther_0481"
FT   CDS_pept        511932..512933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0481"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: aoe:Clos_1345 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84077"
FT                   /db_xref="GOA:B2A5R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R4"
FT                   /protein_id="ACB84077.1"
FT                   /translation="MQEAVNRMPEAGENILEVNNLKKHFPVRGGLLKKVVGHVKAVDGV
FT                   SFNIKRGQTLGLVGESGCGKSTTGRTILRLLEKTQGEVFYQGQDVYNLNKHEMKNLRQK
FT                   MQIIFQDPYSSLNPRLNVSEIVGESLKEHGIARGKELRDRVKDAIEKSGLQGHHVRRYP
FT                   HEFSGGQRQRIGIARALALNPEFIVADEPVSALDVSIQSQILNLMMDLQEEMGLTYLFI
FT                   AHDLGVVKHISDRIGVMYLGNLVELADKKALFDNPHHPYTRALLSAIPPSHPRNRGARE
FT                   QIVLKGTIPSPANPPSGCKFHPRCPEAEERCSQEVPEFKEVAPDHYVECHLY"
FT   gene            512951..513166
FT                   /locus_tag="Nther_0482"
FT   CDS_pept        512951..513166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84078"
FT                   /db_xref="GOA:B2A5R5"
FT                   /db_xref="UniProtKB/TrEMBL:B2A5R5"
FT                   /protein_id="ACB84078.1"
FT                   /translation="MFFEDRARVKKDKNEDLDSETQQIVQDNVDDMDWKDAVALTVAAA
FT                   SVLAPRFLIILFSYLFLIMLFFLIFV"
FT   gene            513312..513899
FT                   /locus_tag="Nther_0483"
FT   CDS_pept        513312..513899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0483"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   chy:CHY_0179 uracil-DNA glycosylase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84079"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B2A668"
FT                   /protein_id="ACB84079.1"
FT                   /translation="MQSYTHLTDLESLKKEALICKNCHLRETCNGVVFGEGDEQADIML
FT                   IGEGPGAKEDELQRPFVGPAGELLTKMLAAINFSRDDVYITNIVKCRPPNNRTPNQEEM
FT                   DTCLPILRQQIRLIQSKIIVILGGAALKGLIDKNMKITKARGSWLERKGIHILPTYHPA
FT                   YLLRNPAKKKESWEDLQNLKAKYMELTNNDID"
FT   gene            complement(513992..514717)
FT                   /locus_tag="Nther_0484"
FT   CDS_pept        complement(513992..514717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0484"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: Peptidoglycan-binding LysM; cell wall
FT                   hydrolase SleB; KEGG: mta:Moth_0054 cell wall hydrolase,
FT                   SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84080"
FT                   /db_xref="GOA:B2A669"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B2A669"
FT                   /protein_id="ACB84080.1"
FT                   /translation="MLTKGGIRLLRVSKVLVVCLLVSGLLFTSLGGGQVQAASETHTVS
FT                   SGETLWRISQWYDVSLEDLRSVNNIWHNYIYPGQTLTIPSGQETETKESSNEIQETETE
FT                   GSNSESQDTESESSWRRLDISSYERDLIARIVYSEARGEPYEGQVAVASVVINRVLDNR
FT                   WPNNVEGVIFEPLAFTPVHNGQFWLTPNQTAYDAVEDALKGWDPSDGATFFYNPITATS
FT                   SWIFTRTTIKQIGSHVFAY"
FT   sig_peptide     complement(514604..514717)
FT                   /locus_tag="Nther_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            complement(514926..515120)
FT                   /locus_tag="Nther_0485"
FT   CDS_pept        complement(514926..515120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0485"
FT                   /product="protein of unknown function DUF378"
FT                   /note="PFAM: protein of unknown function DUF378; KEGG:
FT                   amt:Amet_2334 protein of unknown function DUF378"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84081"
FT                   /db_xref="GOA:B2A670"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:B2A670"
FT                   /protein_id="ACB84081.1"
FT                   /translation="MDRVALILMIIGAINWGLIGFFGFDLVANLFGGQLAPLSRIIYGL
FT                   VGLAGLYSISLLVRDREQV"
FT   gene            515309..515905
FT                   /locus_tag="Nther_0486"
FT   CDS_pept        515309..515905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swo:Swol_1172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84082"
FT                   /db_xref="GOA:B2A671"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:B2A671"
FT                   /protein_id="ACB84082.1"
FT                   /translation="MRSNTNQPGIQSVEGHSSNQEQLMRNNYFFYPKKSFGWLSLLLLT
FT                   LLFAFLSWVAFLSYRITGGLGALVSIGIFIILAICGILLLIWFFNMKYELSGDKLVLHF
FT                   GPFAYQIDLYLVNEVEIKSLVPSLGIGVIVPGFAQWVNSYRGEGKIFMCSTRAMKDIVL
FT                   IRTKSGIIGISPQNEAEFIEEINKRVQFIRLLEPE"
FT   gene            complement(515880..516590)
FT                   /locus_tag="Nther_0487"
FT   CDS_pept        complement(515880..516590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0487"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="KEGG: aoe:Clos_2452 asparagine synthase
FT                   (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84083"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:B2A672"
FT                   /protein_id="ACB84083.1"
FT                   /translation="MTADNPNKTMAGKPLTVTVNNQKFMRKAIKTHFITTQDSYLDIIH
FT                   KYVGPIHRENDILAVSEKVISVTQNRLVYKSHIRVGTLAKILSKFVHVTPAGKGVGNPY
FT                   KMQVAIESAGVLRILIGALLAAITRPLGIKGIFYKVVGNEVWAIDGFNDLAFDYYDDKG
FT                   VLTPENPTEICNVIQNELGIKTIIVDANDINVEILGKSQGVYLSDDTIKQILQDNPAGQ
FT                   SNEQTPFILVREVE"
FT   gene            516842..517390
FT                   /locus_tag="Nther_0488"
FT   CDS_pept        516842..517390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0488"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   csc:Csac_0988 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84084"
FT                   /db_xref="GOA:B2A673"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2A673"
FT                   /protein_id="ACB84084.1"
FT                   /translation="MAVSCQSLGKVYLRPPKMADLVYYQKWWQEPLSNYLDLGRQNSKP
FT                   SSKAVADFKKQVKTRYVPGWFTIVMWDDFFKEIPVGYIRYRQVEWKKRRTEIAIRLGRD
FT                   HWGKEIGQVAIGELLAYLFFEKGLEEAWLKVASFNQRAIRLYEKCGFIETGKMMDSEYP
FT                   ELTWKIMSIHKTKFARLSP"
FT   gene            complement(517473..519212)
FT                   /locus_tag="Nther_0489"
FT   CDS_pept        complement(517473..519212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0489"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18; copper amine
FT                   oxidase domain protein; SH3 type 3 domain protein; SMART:
FT                   chitinase II; KEGG: cth:Cthe_2895 glycoside hydrolase,
FT                   family 18"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84085"
FT                   /db_xref="GOA:B2A674"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B2A674"
FT                   /protein_id="ACB84085.1"
FT                   /translation="MEVQKKTVLKFNIPTLILGLIIFILILASLLTYLYLTPSRQKVEP
FT                   YPDSEQTRLIYEDQDLGTENTALVEDEVYLSKSFIEKSLDPYIYYDDQGDYITITTKNK
FT                   FFQMQTDNLTAAVNDEERELQFSPKLIQGEPFLPSDILEELYPITVQHNQDDNLVLIDN
FT                   LEKQVLKGYAKENETRVREEPSIRTGIIESLDKQSKITIYHQSGDWFFIRTEKGYLGYV
FT                   QSSDITLDELSIREKHIEDDDVDPPSRPFGEPINLTWEHVISENPNPNDLPDLPGVNVI
FT                   SPTWFHLQDPEGNIVNQADKSYVNWAHDNDMQVWGLFSNNFDPDLTSEFLEDPEARRNA
FT                   IEQILLYSDIYNLDGINLDFENIHIDDRDAYTQFVREISPFLREQGLVVSIDVTFISQS
FT                   ENWSLSYDRHAFSKTVDYIMVMAYDEHWGDSPVAGSVSSLPWVEENLEEILSVVPNDQL
FT                   ILGIPFYTRLWEEEKNDDGSISVSSSAYGMEQIKNILENNDADITFDDDTKQYYAEYED
FT                   NDTRYRTWLETEESIKKRLNLVHEYNLAGVASWRRGFEKEEIWEVIKNKMGIPKDPGSK
FT                   ITD"
FT   gene            519334..519522
FT                   /locus_tag="Nther_0490"
FT   CDS_pept        519334..519522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0490"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: chy:CHY_1120 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84086"
FT                   /db_xref="GOA:B2A675"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A675"
FT                   /protein_id="ACB84086.1"
FT                   /translation="MRVEVDQDLCISCGLCVDECPEVFEWNDDGKAEEKAKEVPENSQT
FT                   EAKQAVEGCPTDAIKEL"
FT   gene            519632..520696
FT                   /locus_tag="Nther_0491"
FT   CDS_pept        519632..520696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0491"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   amt:Amet_3137 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84087"
FT                   /db_xref="GOA:B2A676"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B2A676"
FT                   /protein_id="ACB84087.1"
FT                   /translation="MLLYHSYSSIITGEYPGKIEDFSCKIASKMFKLLVRSLRGDFMGS
FT                   NKINSSSTQKVSLVTITVNGALAIFKAIFGIFFNSAALLADAFHSISDILSSGIVFLGI
FT                   KFANKPADNSHHYGHGKLESVASKVVALVLIVTALLLGHNAINMFFQPATLPGTGALIG
FT                   AFVSIIVKELLYRYNITMGERYQSSALKADAWHNRSDAITSVAALIGVAGARLGFPALD
FT                   PLGALIVSVLILKVGIEIYLTSIKELIDTAPTTQVISEIERIVNETEGIENVHDIKARY
FT                   HGTDVFVDIKVCVDRNKTVAQGHHYAGTAKHKIIHEIPQIRDVLIHVNPCKDDVPQCSD
FT                   CHEAICSEAKERTS"
FT   gene            520731..521387
FT                   /locus_tag="Nther_0492"
FT   CDS_pept        520731..521387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0492"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase,
FT                   endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: tte:TTE1769 predicted EndoIII-related
FT                   endonuclease; TIGRFAM: endonuclease III; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; SMART:
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84088"
FT                   /db_xref="GOA:B2A677"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B2A677"
FT                   /protein_id="ACB84088.1"
FT                   /translation="MEKKEAEQILSKLKANYPSARTALKFNSPFELLIATILSAQCTDI
FT                   RVNEITKELFELANTPQDILKLGRPRLIQIIKGAGLYKNKSKNILETCEILVDEYEGEV
FT                   PAKREELEKLPGVGRKTANVVLANAFNIPAFAVDTHVLRVSKRLGLTDKEDPRGVEQDL
FT                   MSVFDRDDWNVGHHLLIYHGRAVCKARKPQCENCSIIEHCKYYHDNYQYPNSTGR"
FT   gene            521389..522603
FT                   /locus_tag="Nther_0493"
FT   CDS_pept        521389..522603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0493"
FT                   /product="protein of unknown function DUF1730"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; domain of unknown function DUF1730; KEGG:
FT                   bat:BAS0514 iron-sulfur cluster-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84089"
FT                   /db_xref="GOA:B2A678"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A678"
FT                   /protein_id="ACB84089.1"
FT                   /translation="MNSLSKLRQMALNNGFVSTGVISPDEYKEGKSRQEQAQARGHLMP
FT                   FINKSQNLATRVNPSKYANWVKTVILVLYPYGGSNGNHPPKPDDGVLRGRFSKISWGRD
FT                   YHLVVKKALQDLASDLVNEDIISETYETFIDTSPFAERELAFRAGLGYPGRHGCLINPT
FT                   YGSFVVIGGILTDTMLPTNEQPVDEIFSTCKSCDECITVCPGKALEDSNHESKIQLENC
FT                   AAYLTVVKGIIPRKKRPIIKDYLYGCDECQNVCPENSSNNFGSTNNDCVKTFSLPKWDE
FT                   QHLTIEDLYPQITKILNLSNQTFRKKYKDNAVFWRGKQVLKRNAVIALGNLKDPKGLPL
FT                   ILETLANPSPIIRAHVPWSLEQISTQLPIHKKSWIYHKLEQQYLKESDPLVIDELKSSL
FT                   LNLSK"
FT   gene            522705..524027
FT                   /locus_tag="Nther_0494"
FT   CDS_pept        522705..524027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0494"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; KEGG: tpd:Teth39_2124 electron
FT                   transport complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84090"
FT                   /db_xref="GOA:B2A679"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B2A679"
FT                   /protein_id="ACB84090.1"
FT                   /translation="MANQTFPGGISPGHFKDTKDKPIESLELPKKVYIPMEQHIGAPCT
FT                   PTVEVGDYVKTGQKIGESDKFVSAPVHASISGEVVDIVQYNHPLGNTSQTVVIESDGQD
FT                   EPDYQDEEQTVNLDSFSAEEIKNVVKEAGIVGLGGATFPTHVKISPPEDKPIDTVLING
FT                   AECEPFLTSDHRLMVEQAEKIIFGLRAIMKAVNCDRGIIAIEDNKPDAVEAMNSLVTDD
FT                   DSLEVMTFETKYPQGAEKQLIKAALDREVPSGGLPMDVGCVVNNTGTALAVADALRTNK
FT                   PILERVVTISGPGIEQSGNFMVRLGTLASDLIEQLGGMGDQTRKIIMGGPMMGISQPNA
FT                   DFPVIKGTSGVLLLTDQEVQIFEERPCINCGRCVDSCPISLLPNLLGTFMEHERPDKAE
FT                   DFNALDCIECGCCTYICPARRPLVHYIRVAKGEIMAKRQNK"
FT   gene            524062..524988
FT                   /locus_tag="Nther_0495"
FT   CDS_pept        524062..524988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0495"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   tpt:Tpet_0679 electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84091"
FT                   /db_xref="GOA:B2A680"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:B2A680"
FT                   /protein_id="ACB84091.1"
FT                   /translation="MANKLVVSSSPHLRTPESVDSIMRDVLIALIPPLIVSAWLFSLYS
FT                   IWMVVVATVVCMVSEAVMVHKSVSLSKIKGDWSAAVTGVIYGLSLPPGTPWWVVAIGAF
FT                   IAISVGKHVFGGLGYNIFNPALVGRAFVVLAWPSYLTHWTEPFQAVDFDSATAATPLVV
FT                   DSDAVSLSDLFVGTTGGSIGETSILAILLGAVFLLVKGHIDIRIPAAYMGAVAVMALVT
FT                   GQDIMYHLFSGSAFFAAVYMATCMVTSPYTKTGKLIFGFGCGLFTALFRMFGSAPEGVT
FT                   YAILLMNALVPFINKYTRPKIYGEVSN"
FT   gene            524989..525522
FT                   /locus_tag="Nther_0496"
FT   CDS_pept        524989..525522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0496"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   amt:Amet_2282 electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84092"
FT                   /db_xref="GOA:B2A681"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:B2A681"
FT                   /protein_id="ACB84092.1"
FT                   /translation="MKLNDLLKLGGVLMVVAALSATLLGFSNSYTDPIIQERRMEQLEN
FT                   SMFEFFPEAEEFIIDEIDEQEYYVVKTEGEVSGVATVVDPGGYGGRIEMMVAADAEGTV
FT                   SGVDILSHAETPGLGSEIEEPEWLQQFIGLSASQDIMGEEKVDIISGATVSSEAVIEGV
FT                   ELALDNIVEDYLGN"
FT   sig_peptide     524989..525084
FT                   /locus_tag="Nther_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.474 at
FT                   residue 32"
FT   gene            525561..526181
FT                   /locus_tag="Nther_0497"
FT   CDS_pept        525561..526181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0497"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   tpd:Teth39_2121 electron transport complex, RnfABCDGE type,
FT                   E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84093"
FT                   /db_xref="GOA:B2A682"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:B2A682"
FT                   /protein_id="ACB84093.1"
FT                   /translation="MKFSEAFTQGLLKENGLYRQLLGLCPALAVTQTAMNSLGLGAATM
FT                   AVLLAANIVISLVKNLIPKKIRIPSYIVIIATFVTIVDMFLEAFTPDLHAALGIFIPLI
FT                   VTNCLILGRAEAFASKEKVTSAIGDALGMGIGFTLGLLSLGVVRELFGKGSLFGWPVLH
FT                   ELFGAFGLEFQPALIFIQPAGAFFALGILLALMNIVYKRLQYD"
FT   gene            526291..526866
FT                   /locus_tag="Nther_0498"
FT   CDS_pept        526291..526866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0498"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   cdf:CD1141 electron transport complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84094"
FT                   /db_xref="GOA:B2A683"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:B2A683"
FT                   /protein_id="ACB84094.1"
FT                   /translation="MEELLAIFIGAIFVNNIVLIQFLGICPFLGVSKKVETAVGMGLAV
FT                   TFIMTLASIITWLIHEMILVPFEAEYLEYVAYILVIASLVQFIEMLLEKVSPNLYKALG
FT                   IYLPLITTNCAILGLALQNILEGYNLLESTIHGVGAGIGFTVALVVMAGIREQLEFAKM
FT                   PNLFQGASVAFIIAGILSIAFTGFLGVI"
FT   gene            526905..527711
FT                   /locus_tag="Nther_0499"
FT   CDS_pept        526905..527711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0499"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Fe-S cluster domain protein; KEGG:
FT                   amt:Amet_2285 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84095"
FT                   /db_xref="GOA:B2A684"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A684"
FT                   /protein_id="ACB84095.1"
FT                   /translation="MYAAVLSLGGLGLFFGLVLAYASQKFAVEVDPKVEAIDESLPGAN
FT                   CGACGYPGCGAFAEAVANGEAPIDGCTPGGENTAQTIADILGVSHEESEERYVAEVACL
FT                   GGSEHCKEQFDYDGVQDCRAAMMYANGFKACDYGCLGLGTCEHICPFDAIEMQDNGIPH
FT                   IDPEKCTGCNKCANTCPKDVIKMINANTKHHVRCNSCDKGKTVRQVCEVGCIGCGVCAK
FT                   VCPVDAITIENNLAYIDSHECVNCGKCKEKCPRDCITSDLEYTTKA"
FT   sig_peptide     526905..526967
FT                   /locus_tag="Nther_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.764 at
FT                   residue 21"
FT   gene            527786..528265
FT                   /locus_tag="Nther_0500"
FT   CDS_pept        527786..528265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0500"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: aoe:Clos_1812 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84096"
FT                   /db_xref="GOA:B2A685"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A685"
FT                   /protein_id="ACB84096.1"
FT                   /translation="MVDEFTHLDNQGKARMVEINQKPDTSRRAVARGSIYMKANTLQKV
FT                   KTNEMEKGDVLGVARVAAIMGTKRTGDLIPMCHPLMLTGIEVNFNFDEENCKIDIEVIV
FT                   KTTGKTGVEMEALTGVSLAALTIYDMCKSIDKTMKIEHIRLAKKSGGQSGEIENE"
FT   gene            528343..528849
FT                   /locus_tag="Nther_0501"
FT   CDS_pept        528343..528849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0501"
FT                   /product="cation antiporter"
FT                   /note="PFAM: cation antiporter; KEGG: amt:Amet_4159 cation
FT                   antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84097"
FT                   /db_xref="GOA:B2A686"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:B2A686"
FT                   /protein_id="ACB84097.1"
FT                   /translation="MKGRDYTYLGTACLLLVFWLIMVSELSSFGIVVGSIASIGIVYLF
FT                   SEHLLTVEYRFPLIFRNIGRLIIYIGSLIYEIIIANIQVAKIVLSINMDLSPTFVRFKG
FT                   KLNTDTSKAILGNSITLTPGTLTVEIEEDEFIIHGLTKSHVQGLLDWYMIDYLVKMEEE
FT                   GKHGR"
FT   gene            528839..529102
FT                   /locus_tag="Nther_0502"
FT   CDS_pept        528839..529102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0502"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: amt:Amet_4158 multiple resistance and pH
FT                   regulation protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84098"
FT                   /db_xref="GOA:B2A687"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:B2A687"
FT                   /protein_id="ACB84098.1"
FT                   /translation="MVGNFFMYTAIALAILIMVSLYRAYVGPACFDRVVAINIISTKVV
FT                   TIIALVSYIYQQEFFLDVALVYALISYVTVVGIAKYVEHGSC"
FT   sig_peptide     528839..528913
FT                   /locus_tag="Nther_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.673) with cleavage site probability 0.670 at
FT                   residue 25"
FT   gene            529116..529448
FT                   /locus_tag="Nther_0503"
FT   CDS_pept        529116..529448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0503"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; PFAM: Na+/H+ antiporter subunit; KEGG:
FT                   amt:Amet_4157 monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84099"
FT                   /db_xref="GOA:B2A688"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:B2A688"
FT                   /protein_id="ACB84099.1"
FT                   /translation="MLDILIILLLISGTFFFFIGVVGLIRLPDVYTRMHATTKCDTLGA
FT                   GLLLLALILAQPLTIATLKTVFIIVFIWITHPTAAHIIARASYHTRMPQYPDTQYIDMT
FT                   EEEGNS"
FT   gene            529445..529690
FT                   /locus_tag="Nther_0504"
FT   CDS_pept        529445..529690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0504"
FT                   /product="putative multicomponent Na+:H+ antiporter subunit
FT                   B"
FT                   /note="KEGG: amt:Amet_4156 putative multicomponent Na+:H+
FT                   antiporter subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84100"
FT                   /db_xref="GOA:B2A689"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:B2A689"
FT                   /protein_id="ACB84100.1"
FT                   /translation="MIHHVLNILLLSFLVVCALAVERTKDLLSAVIIFSAYSLVMAVTW
FT                   EQLHAPDVAITEAAIGAGVTSLVFVVTISRTRRYED"
FT   sig_peptide     529445..529507
FT                   /locus_tag="Nther_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.956 at
FT                   residue 21"
FT   gene            529687..529968
FT                   /locus_tag="Nther_0505"
FT   CDS_pept        529687..529968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_4155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84101"
FT                   /db_xref="UniProtKB/TrEMBL:B2A690"
FT                   /protein_id="ACB84101.1"
FT                   /translation="MIKQLFTIGLLLMIGYSMLLVVAELPEFGVEDNPAFNEVSERYLE
FT                   QGPEETENSNIVSAVLVEYRAFDTFGEITVLYTAITGVLLVMEGNKKE"
FT   sig_peptide     529687..529758
FT                   /locus_tag="Nther_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.810 at
FT                   residue 24"
FT   gene            529973..530425
FT                   /locus_tag="Nther_0506"
FT   CDS_pept        529973..530425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0506"
FT                   /product="Na+/H+ antiporter MnhB subunit-related protein"
FT                   /note="PFAM: Na+/H+ antiporter MnhB subunit-related
FT                   protein; KEGG: ctc:CTC01341 sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84102"
FT                   /db_xref="GOA:B2A691"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:B2A691"
FT                   /protein_id="ACB84102.1"
FT                   /translation="MRDLILRVVARALIPFVIMYGLYVIVFGHVSPGGGFSGGATLGAG
FT                   LILYRLTYKGAEVDPGITINSKMKVFSDMLEHKGMMMQAITGLYTFLIGIIFLIIIFPV
FT                   PISLHGNWFNVANGFKVALSLVKLFYLLSTLESEDGKIGSITKHSR"
FT   gene            530397..530756
FT                   /locus_tag="Nther_0507"
FT   CDS_pept        530397..530756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0507"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   amt:Amet_4153 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84103"
FT                   /db_xref="GOA:B2A692"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B2A692"
FT                   /protein_id="ACB84103.1"
FT                   /translation="MGLLQSIAANYYFLFAILLFLIGIYTMLTHPNLLKKVIGLNIMET
FT                   SVFLLFVSGGYVAGGRAPIVTGNEEVYVNPLPHALILTGIVIAISITSLLLSLIVKIYK
FT                   YYGTLNADKISKMRG"
FT   gene            530763..532262
FT                   /locus_tag="Nther_0508"
FT   CDS_pept        530763..532262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0508"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: amt:Amet_4152 NADH dehydrogenase (quinone);
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84104"
FT                   /db_xref="GOA:B2A693"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B2A693"
FT                   /protein_id="ACB84104.1"
FT                   /translation="MEGHFHLPIIIVLIGIFVSFILPGLHFIKKNLNEYVSLSAMILML
FT                   VIAIYLVIEVSSNGPFTYVVGEWAPPWGIEFNVDYLGVYMTLIITGIGFLALLYASRDL
FT                   HHELQENALSLYYPLYMLLMASMIGMVLTNDIFNLFVLLEITLLTSVAIICVKENKDTI
FT                   EASLKYLMLNALGSATVLMGIALLYIITGHLNMTYIAQELAVNFEQYPTVIMAIVALFF
FT                   VGFGVKSALFPMHVWLPDAHGSAPSPSSAVLSGLVIKVYVVSLIRFYFIVLPEEILELM
FT                   PVGEILLWFAAAGMILGSMFAIAQEDIKKMLAYSSVAQISYVFLGIGLLSLTSFQGGLL
FT                   HILNHAIIKSMLFLIAGAIIYTSGIRKISHMHGVGLRYPLIMICFTLGAFAMIGIPGTN
FT                   GFISKWYLALGALDAGRPFFVLVILVSSLLNGVYYLPIVVNSFFGDMQDADINFIKCNK
FT                   LPWQMFFPIVLCGFLIIFIGLYPALPLSLVEPAVEFLMPEL"
FT   gene            532282..534528
FT                   /locus_tag="Nther_0509"
FT   CDS_pept        532282..534528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0509"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: amt:Amet_4151 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84105"
FT                   /db_xref="GOA:B2A694"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B2A694"
FT                   /protein_id="ACB84105.1"
FT                   /translation="MTDLVTEQAEFTSILPILIIFVPLLGSFGVILISSVSEKLRDIYT
FT                   VIISAVPLVLLAVMYPLVQQGIVQYNIEWFLEIGLIFRLDSLGFLFTALISLIWFLATL
FT                   YATEYISHEHNRNRFYFFWLFTFGATLGVFVTGDLFGLFVFFEMMSLTSYVLVIHEEDK
FT                   DAMRAGNLFLFLGIGGGLAILFGLFIMYFNLETLEIAPMLGDMVAAGVNIPVLLLLFII
FT                   GFGIKAGIVPLHIWLPKAHPVAPTPASAILSGLLIKTGVYGLWRVFLMVMGPASSQEVE
FT                   LYQQYITNWGMGLFWIGIITMVLGALMALLQTSAKKMLAYSSVSQVGFIIMGLGAAVYL
FT                   GTDGPIGFAGGIMHVINHALFKACLFLIVGAIFIRTHLLDIDRVRGMFKQMPFMGIAFI
FT                   IAALGIAGVPLFNGYASKTILHHALSEVSYLTPGTAMFIADKIFVFTSALTVSYFIKLF
FT                   RGLFLGKLPQEWQNTNFSVAPIIKVVVSVFVVLIIAIGVFPNFVLEQFVMPTMAGFPYE
FT                   SEVVTSQLQGMDLFTSKDLSKVVVVFLIAGTITLADQKFHWSRITPPYWLSIEALVYRN
FT                   AITKLMSGIEKLGTTFDVSVQDFYETTGRTSVKVCRKLSELDKTLTDAYDKSGEGAMKL
FT                   SEKTGQLDRQLDRFYDSTGEKASSMTVLWPVSKDGDKTLAQKEFEAELEKASSKQGKVS
FT                   KYVTRDRKARTGFLGKINFDPSKLTVKNLNFDSFVIAFMLGISLLILIFYHRIF"
FT   gene            534614..535675
FT                   /locus_tag="Nther_0510"
FT   CDS_pept        534614..535675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0510"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: tte:TTE2482
FT                   membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84106"
FT                   /db_xref="GOA:B2A695"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B2A695"
FT                   /protein_id="ACB84106.1"
FT                   /translation="MNTNKSQSRAKLIKLLTIFTILLVMMTSLMACDYEVEEYRDTGIY
FT                   MDTRVDIIVEARNESIADEAIDAAKDEINRLENKMSRHVAGSEIDEVNRNAGEQPIQVS
FT                   QETWEVVAESIELGEQMDGYFDVTIAPLLTLWGFGEDEHHLPSDEEISELLPLVNHNEI
FT                   EMDEEKHTIYLPDSDMRLDLGGAAKGYIVDRATEVLAEHDIESGLVDAGGDINTVGPKH
FT                   DDEPWRIGVTHPRDRQNYFAVLELNGEAVDTSGDYERYFEEDGVKYHHILDPYTGYPTE
FT                   GMISATVMADNAIRADILSTGAFGLGLEGSLELFEELDDVEAIIVDDNGEYHMTSGLDG
FT                   IEIPDQYKDQQLK"
FT   sig_peptide     534614..534709
FT                   /locus_tag="Nther_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            535706..536239
FT                   /locus_tag="Nther_0511"
FT   CDS_pept        535706..536239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0511"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: swo:Swol_1955 heptaprenyl diphosphate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84107"
FT                   /db_xref="GOA:B2A696"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:B2A696"
FT                   /protein_id="ACB84107.1"
FT                   /translation="MNKNLSKLIYLGLLVTFGLVLHLVEQAIPNPFPLPGAKLGLANII
FT                   TLVALVLYGAKDAMFVAVLRVFLGSLLGGTILGFPFYLSLTGAVLSMAVMAITIPLKNK
FT                   GILSLVGISLLGAVTHNVAQLFVASLLMEQLGILFLYLPYLLIFAIPTGLFTGLVSTLI
FT                   IDVIYTNLQHVTRV"
FT   sig_peptide     535706..535777
FT                   /locus_tag="Nther_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.414 at
FT                   residue 24"
FT   gene            536270..536533
FT                   /locus_tag="Nther_0512"
FT   CDS_pept        536270..536533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84108"
FT                   /db_xref="GOA:B2A697"
FT                   /db_xref="InterPro:IPR025470"
FT                   /db_xref="UniProtKB/TrEMBL:B2A697"
FT                   /protein_id="ACB84108.1"
FT                   /translation="MAMHKGSSGTNFLLLLLIFAVGGILGNLIGEFFGQYFPLLQISRE
FT                   VGFTSPVELDLNFIYLQFSLLIKLNLAGVIGLLLAIWLFRRL"
FT   gene            536553..537131
FT                   /locus_tag="Nther_0513"
FT   CDS_pept        536553..537131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0513"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: cpr:CPR_2112 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84109"
FT                   /db_xref="GOA:B2A698"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B2A698"
FT                   /protein_id="ACB84109.1"
FT                   /translation="MTNLCLASASPRRKELLQQLNLDFTVCPSNINEDKFYQLPIEKRA
FT                   VELAKAKANDVANKQSEGLVIGADTMVVFGNRILEKPRSETDAKEMLSTLSGNKHKVIT
FT                   GVALVNASDKIILTDRGITDVWFRNVKAFEIENYIATGEPMDKAGAYGIQGYGSLFVDK
FT                   IYGCYYNVVGLPLSVLAKMLEAFGVQVLK"
FT   gene            537139..537864
FT                   /locus_tag="Nther_0514"
FT   CDS_pept        537139..537864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0514"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: tte:TTE0897 DNA
FT                   repair proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84110"
FT                   /db_xref="GOA:B2A699"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B2A699"
FT                   /protein_id="ACB84110.1"
FT                   /translation="MEVDYNFRGEGVKKTPYRTIKSLPEADRPRERFLKLGPEAISDSE
FT                   LIAIILGTGTKQSSALDLANSILSNYVSIFNLLQATISELCEIPGIGYAKSIKLKAAFE
FT                   LANRCMAREQLTMDKITSPEDIFRLMNFRLKTETREHFLAVMLNTKSYLLKIDLISIGS
FT                   LNATIVHPREVFNRAIRASACGVILVHNHPSGDPEPSQDDIKLTNRLVAAGDLLGIPIM
FT                   DHVIIGHQKFYSFSRENHL"
FT   gene            537978..539009
FT                   /locus_tag="Nther_0515"
FT   CDS_pept        537978..539009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0515"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: amt:Amet_2290 cell
FT                   shape determining protein, MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84111"
FT                   /db_xref="GOA:B2A6A0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A0"
FT                   /protein_id="ACB84111.1"
FT                   /translation="MKFIANYFSKDIGIDLGTANTLVYVKGKDVVLREPSVVAIRKNSG
FT                   EILAVGSEAKNMIGRTPGNIVAIRPMKDGVIADFDVTQTMLRHFINKAYKRMTVFRPRV
FT                   MVCVPSGVTEVEKRAVLDATNQAGAREAHLIEEPMAAAIGAGLPVEEPTGSMVVDIGGG
FT                   TTEVAIISLGGIVTSKSIRLGGDELDEALIQYVKKKYNLMIGDRTAEEIKMTIGSAYLE
FT                   ENTHMEIRGRDLVSGLPHNQTITAEEIASALKEPVNNILEIIKLTLEQTPPELSSDVMD
FT                   KGIVLTGGGSLLHGLDKLVAQETGMPVVIAEDPLDCVALGTGKALNQLDLLKRVTITSK
FT                   KIS"
FT   gene            539024..539977
FT                   /locus_tag="Nther_0516"
FT   CDS_pept        539024..539977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0516"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: mta:Moth_0538 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84112"
FT                   /db_xref="GOA:B2A6A1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A1"
FT                   /protein_id="ACB84112.1"
FT                   /translation="MFAPFRKFQRAIGLVVIVIFLLTIIGWTKQEREQLTFVEEAVIEI
FT                   TAPFQGIVSGIGGRIQAAYTFIAELQELSEENRELRDKLSEYERLEVEVEELRQENQRL
FT                   RDMLGFEEREAYELKPAKVIGRSADNWNRTIVLNKGRQDGVELNMPVVTDNGLVGQIIS
FT                   VSRSSSKVLLLIDPDSAVSGLIQDTREMGIVEGKDEVSGDLQMINIPKDAELSDGDKII
FT                   SSGLGPVFPKGLVIGEVVELKEEMSGFTNKAIIKPSVNFSRLEEVFLIQDGGKYIDEED
FT                   YQDLQELEESEDESLQQDDGYQDGEQEYNEEDGMEE"
FT   gene            539974..540465
FT                   /locus_tag="Nther_0517"
FT   CDS_pept        539974..540465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_1763 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84113"
FT                   /db_xref="GOA:B2A6A2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A2"
FT                   /protein_id="ACB84113.1"
FT                   /translation="MKHLYFLLAIVMVNIVRIGLGPYIELPELGLLLVLIYSVMMGRVA
FT                   GGTMGLAVGLIQDIMIGRAIGFFAISYLLAAYLIGYLSLYKAIYGNLLNLFLAIFFSNI
FT                   IFELTYWALMELFYETGITFANIAKLEFWAIILLQSLIGIILYSYIKPLFKKGGYLFKY
FT                   "
FT   gene            540479..542356
FT                   /locus_tag="Nther_0518"
FT   CDS_pept        540479..542356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0518"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: csc:Csac_1869 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84114"
FT                   /db_xref="GOA:B2A6A3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A3"
FT                   /protein_id="ACB84114.1"
FT                   /translation="MLMSEEKDKVIFKRIQAFFVITIFLCFILVARLAYLQVLEGDYYE
FT                   QVSEENRMRRITIDPPRGEIYGRDGELLAKNTPGYTVSLMDVGGADEEKVVYFLSDYLE
FT                   IEEQEIKDKIDSQRFRQFEPIRIKSGLSYEQVAHLAEKRTELPGVILEIQPDRIYTQDK
FT                   LLGHVLGYTGEITRTQLDRGMGEEGYRPGDIVGQSGLEKTYQEELRGEPGFRQVEVNRF
FT                   GRVINNMGEEEPIPGNNLHLTIDVELQEFVSESLDHAIETIREEEGEEYEDHLGGASAV
FT                   VMNPDNGEILSMVSLPKYDPNTLYENYADLIEDSTRPLRNRAISETYPPGSTYKMVTAL
FT                   AALEENELAAEETILDEGRYWNPPRPRNFQNRALGRIDVVDALKYSSNVFFSEMGHRLG
FT                   INLLSEWSRNFGFGATTGLEDLDGEHTGIVAGVEYKERHFQEAEQQVWYPGETIIAAMG
FT                   QGYHTYTPLQLANYAAMLANEGIHYRPHLVSEVTDSQGEIVEKTGTETLNELDISQGNW
FT                   DLVKEGMRQVAQPGGTAGWMFDDLEFDVGLKTGTAEVAGRPSHGWIVGFAPYEDPEIAF
FT                   SIFIEHGGGSSRVTPVARALIDYYFDLMEEDEEEPEELDMDTDSGYVDE"
FT   gene            542498..543184
FT                   /locus_tag="Nther_0519"
FT   CDS_pept        542498..543184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0519"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: sfu:Sfum_1280 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84115"
FT                   /db_xref="GOA:B2A6A4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A4"
FT                   /protein_id="ACB84115.1"
FT                   /translation="MINKEHQPVEFKGTKKGLLILLDGEYPFDELLEIMYTKLQQSENF
FT                   FQEGQVKVQVKNKQLNSNELNLITRLFSEKTRLELGEIISDSGEVLVSFPSTFRKELGK
FT                   QESQDYRINNSLVIRRTIRSGQKVEFPGTIIIIGNVNPGAELIANGDIIVFGELKGICH
FT                   AGVDGDSEASVMALRLMASQLRIADIVSRAPDDAQPVPQYPERAFINGNQIVVEDIDQK
FT                   TLTDKL"
FT   gene            543199..543996
FT                   /locus_tag="Nther_0520"
FT   CDS_pept        543199..543996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0520"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: pth:PTH_0822
FT                   septum formation inhibitor-activating ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84116"
FT                   /db_xref="GOA:B2A6A5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A5"
FT                   /protein_id="ACB84116.1"
FT                   /translation="MGEVIVVTSGKGGVGKTTTVANVGTGLALKNKSVALLDADIGLRN
FT                   LDVILGLENRIVYDMVDVTQGQAKLNQALIKDKRFPDLYLLPAPQTKDKTAINPDEMRN
FT                   LCGELKSKFDYVIVDSPAGIEQGFQNAIAGADRAIVVTTPEVTAARDADRIIGLLEAEE
FT                   INDHKLIINRIRPDMVHRNDMLDIDDIIGLLSIELLGVVPDDEQVIVSTNKGEPLASQT
FT                   GKKASRAYQNITRRIMGEKVPLMTLDHDSGIMNKLKKFIGLAN"
FT   gene            544010..544249
FT                   /locus_tag="Nther_0521"
FT   CDS_pept        544010..544249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0521"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: sth:STH377 septum site-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84117"
FT                   /db_xref="GOA:B2A6A6"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A6"
FT                   /protein_id="ACB84117.1"
FT                   /translation="MLRKNMSKDIAKDRLRLLLVHDRANMSPELLQEVKQEIIDVINKY
FT                   MEIDEESSEVNLTRGRNSAQLEANMMVKSIKRQK"
FT   gene            544326..545444
FT                   /locus_tag="Nther_0522"
FT   CDS_pept        544326..545444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0522"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: tpd:Teth39_1445 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84118"
FT                   /db_xref="GOA:B2A6A7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A7"
FT                   /protein_id="ACB84118.1"
FT                   /translation="MFDKKLLRNFDYTLLIVVLLISVIGVIIITSATQLNPTGDSYYYT
FT                   RRQIAYIAAGLLVLLTMLSIDYHSILRIAKPLYIINLLLLTAVFVPGLGRAAGGGAQRW
FT                   LSLGIIDIQPAEFAKIIIIITLAKFLVDQKNGIEDIYDLILPIGHVLVPMGLIFLQPDL
FT                   GTAMVFIAILFGGLFFYRVKLKLLGYLIGAGILVGVPSFWLLLHEYQRQRLIVFLNPSN
FT                   IDPLGDGFHLWQSMVAIGSGGITGKGLFEGTQNKLEFLPEAHTDFVFSVIGEEFGLIGA
FT                   SIVLLLFLILIYRILKIAYLSKDFYGTVICGGVATMLLFQMVVNVAMTVSMMPVTGLPL
FT                   PFISYGGSGYLMNMMAIGLVLNVGMRRHKIMF"
FT   sig_peptide     544326..544433
FT                   /locus_tag="Nther_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.194 at
FT                   residue 36"
FT   gene            545562..545963
FT                   /locus_tag="Nther_0523"
FT   CDS_pept        545562..545963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84119"
FT                   /db_xref="GOA:B2A6A8"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A8"
FT                   /protein_id="ACB84119.1"
FT                   /translation="MKMFSGTTSKKRPALRSRLKRHQVRRTSGVSRKSRSYDKEDSFIK
FT                   KVFWEIHRDLPRKIVLSIIIFLMIYFTYQINQGWSRQVIEFVHRVTTQQPDYSRIVNQI
FT                   VEDDGVLDEIEILPVIDDDSEEEVFDIDN"
FT   gene            545987..546844
FT                   /locus_tag="Nther_0524"
FT   CDS_pept        545987..546844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0524"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pth:PTH_0826 Zn-dependent
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84120"
FT                   /db_xref="GOA:B2A6A9"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6A9"
FT                   /protein_id="ACB84120.1"
FT                   /translation="MIALNFRVHWTLILFGIVYLFTGFLQEIGIFFVLVILHELSHTIV
FT                   AISHGFKVEETVLYPFGGRAKIDGLIEEDPYRELHIALAGPLTNILLAILFLSLDQYSI
FT                   FSEEIILFAVRANIILALFNLFPGLPLDGGRVLRASLSKRMSFREATHYACQGGKLVGI
FT                   LLVIFGIVVGIVWQYINITFFLAGLFVFIVALREEKEATYLYYRHLTRKKQLLTQEGVL
FT                   PCEILIAFEATSLKEVTSLFRPKKYHILHVIDANWEKKAIIEEKDIIDAMFTRGPHIKI
FT                   SQIL"
FT   gene            546934..548907
FT                   /locus_tag="Nther_0525"
FT   CDS_pept        546934..548907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0525"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tte:TTE0909 Fe-S oxidoreductase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84121"
FT                   /db_xref="GOA:B2A6B0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B0"
FT                   /protein_id="ACB84121.1"
FT                   /translation="MNIHPWNEAKVLDNVMKLGYNIPSQDQAMRLQKGEIIMPRKQLSF
FT                   EDIERILPHIEKPGRYIGNEYNSVVKDWEDKLSLALIFPDVYEVGMSNLGLKILYHHVN
FT                   KLDWAVAERAFSPWIDMERELRDNEIPLYSLETFTPLSQFDVVGFSLQYELSYSNVLTA
FT                   LDLGDIPVTSIDRGEEDPIVMAGGPNAFSPEPLAEFIDLFVVGEGEIVLIDVLEQIKEL
FT                   QQKGYSREDLLFKMTEIKGVYVPRFYEEQYENGEYMGVKPVKSDIPEVIHKRLIRDLDE
FT                   IEYPTEMIVPNIDIVHNRAFVELFRGCTQGCRFCQAGMIYRPVRDRSPANLVDLSQQIV
FT                   SKTGYEELSLTSLSTADYPQIDSLLDSLNDCFQNDIALSLPSLRADSFSVDLAKKVQQG
FT                   KKTGLTFAPEAGTPRLRNVINKKVHEEDMMKAAEAAFKSGWDKIKLYFMIGLPTEREED
FT                   LEGIVELSNKVIKLYKQITGKNRLKLNVSTSTFVPKPHTPFQWMGQLSREEINRRQKYL
FT                   KQNLNHPAINYSWTDPNPSFLEACIAKGDRKIGKVLYQAYLNGVRFDGWSDQFDFKLWE
FT                   QAFSELGVNPEDYANKDLDLGQTLSWDHISPMIKKSFLKREYKRAIEEKTTSDCDHNLD
FT                   NCSFCNICMETELLPSKEGRRN"
FT   gene            548907..549623
FT                   /locus_tag="Nther_0526"
FT   CDS_pept        548907..549623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_2537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84122"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B1"
FT                   /protein_id="ACB84122.1"
FT                   /translation="MKLWFSFEKIDKMKYISYLDLLNVFARAIKRAGIEPAMSKGFNPQ
FT                   PKVSFAQPLPLGVNSLRDYGELEIVSKPNSWDMADMISGINKELPKGFNIFELKEPEHS
FT                   KPPKLMSLVVAADYRFNCSSLAKENELVELCGRLKKGEDLYIDKWHKKRKEYVKKNITP
FT                   MIYQIKTEGQDIYGTFQAGSSGNLRPDDFISALLNDQKAFTKISCDRLELFCENNKSQK
FT                   NLIPLWEWDRLNVNVL"
FT   gene            complement(549692..551056)
FT                   /locus_tag="Nther_0527"
FT   CDS_pept        complement(549692..551056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0527"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: pth:PTH_2713
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84123"
FT                   /db_xref="GOA:B2A183"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A183"
FT                   /protein_id="ACB84123.1"
FT                   /translation="MFCENVTMTKKVTYQMTQEEIKKLNIINQTIDGYLTIRDAARALN
FT                   LSDRQIKRLKKGVQLEGPSFVIHKSRGKKPDHSVPESTEKHIISLKLEKYPNANFTHFT
FT                   ELLNEREKISISRPVVHRILSKAGISSPKKHKKSKSHHRRKRKDRMGLLVQIDASPYDW
FT                   FDTGFDCDLHAAIDDATGALLGLFFVENECLEGYFQIMHQLISNYGIPASLYSDKHTIF
FT                   RSPKSDKLSIDEQLAGKQVKPTQFGAAMEELGVTIIPANSPQAKGRVERLFDTLQSRLP
FT                   TLFKLHNITTMEKANEFLQKDFLPDFNKRFALKPENELSAFTCLNQDINLDHILCSKFK
FT                   RTVDNSATFSFEGSYYQILDKNSQLVPKSKVTVLSNPKFGVKVKYKDMVFETQIVDKPS
FT                   TTKMTKKVKTTQSPKNRIVPDENHPWRKQSERTNLNYDLTDQELLDTILNTRDRV"
FT   misc_feature    551161..551229
FT                   /note="Ribosomal protein L21 leader as predicted by Rfam
FT                   (RF00559), score 30.65; ribosomal protein L21 leader"
FT   gene            551240..551557
FT                   /locus_tag="Nther_0528"
FT   CDS_pept        551240..551557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0528"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: ribosomal protein L21; KEGG: cth:Cthe_0160 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84124"
FT                   /db_xref="GOA:B2A6B3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A6B3"
FT                   /protein_id="ACB84124.1"
FT                   /translation="MYAVIETGGKQYKVSEGDVLEIEKLSQETEEQVTFDKVLLVKDDE
FT                   NVKVGTPVLEEAQVEGTVLEHGKGEKVTVFKYKPKKNYRRKQGHRQPFSKVKIDKIKLN
FT                   G"
FT   gene            551567..551914
FT                   /locus_tag="Nther_0529"
FT   CDS_pept        551567..551914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0529"
FT                   /product="protein of unknown function DUF464"
FT                   /note="PFAM: protein of unknown function DUF464; KEGG:
FT                   tte:TTE0914 predicted ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84125"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR036764"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B4"
FT                   /protein_id="ACB84125.1"
FT                   /translation="MIQVEVYRKKGKICGFKVEGHADYAREGEDIVCAAISALSLTGVF
FT                   ASEKLCNLSKQITQPEEGLLSLEMPTGLDEQQQQTYEIILETVIIGIYETAKNYPDYIN
FT                   IEDEGGEYSWN"
FT   gene            551905..552201
FT                   /locus_tag="Nther_0530"
FT   CDS_pept        551905..552201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0530"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: ribosomal protein L27; KEGG: cbe:Cbei_0510
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84126"
FT                   /db_xref="GOA:B2A6B5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A6B5"
FT                   /protein_id="ACB84126.1"
FT                   /translation="MELKMNLQLFAQKKGTGSSKNGRDSISKRLGVKRHGGQQVNAGNI
FT                   IVRQRGTKFHPGENVGIGKDDTLFAKADGVVTFEQVGKKKKRVCVYPEPAMAE"
FT   gene            552395..553174
FT                   /locus_tag="Nther_0531"
FT   CDS_pept        552395..553174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppe:PEPE_0083 predicted signal transduction
FT                   protein with a C-terminal ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84127"
FT                   /db_xref="GOA:B2A6B6"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B6"
FT                   /protein_id="ACB84127.1"
FT                   /translation="MDQKGFQQGICGVIIGIVVTFLIPLMADLITPYLLFLTPVVIIYW
FT                   LIVYKYLKKQYHQELNKRVSEIKERNYQQLTNDIRRIRHDIVNHFQIVYSLAQLSGEQR
FT                   LIKHLKKIKFLDVLYGEILKLPQYDLTAFYLNQFVKTLDSGGQFYFRNTANINEFDLGK
FT                   TTAELLQNICDEINLFKNTDTSLKINWELREDEDCYIIVLDVYDSQRTWKTIDENFFIA
FT                   LQDKFDELKFNFEYFTFKTQIWIKLCIYKNTDKSSLQ"
FT   gene            553215..554573
FT                   /locus_tag="Nther_0532"
FT   CDS_pept        553215..554573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0532"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; GTP1/OBG domain protein; KEGG:
FT                   gka:GK2606 GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84128"
FT                   /db_xref="GOA:B2A6B7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A6B7"
FT                   /protein_id="ACB84128.1"
FT                   /translation="MFIDRAKIYVKGGDGGNGIVAFRREKYVPDGGPSGGDGGKGGNVI
FT                   LEVDPGLKSLMDYKYNIHIKGKRGEHGQGSNQHGKSGQDKVIKVPPGTVVKEATSGKVL
FT                   ADLVHEHDSYIAAEGGRGGRGNTRFANPKNKAPRFSEDGKPGEEKWIVLELKVMAEVGL
FT                   IGYPNVGKSTLLSQVTKASPKIDSYHFTTLNPNLGVVELEEGSRFVMADIPGLIEGAHQ
FT                   GRGLGDQFLRHIERTKMLIHVIDIASIEGRDPVLDIETINEELKGYNSRVMDKPQVIAA
FT                   NKMDLGDQAEENLQRLLDKVNSDEILIPEQYKKIFPISAATGEGLRELLDFVAEKVAQL
FT                   PDTHDTFDIDLELPESEENTDTEQEALFTMSQDDKIEEKPKSDFGIRKEGDIFIVKHEK
FT                   LEKILNEIDVHTEKGRHYFQAKVDEFGLEEALVDKGIKPGDTVKIGNVEFEYQ"
FT   gene            554622..555254
FT                   /locus_tag="Nther_0533"
FT   CDS_pept        554622..555254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0533"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="KEGG: mta:Moth_0564 nicotinic acid mononucleotide
FT                   adenyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain protein; nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84129"
FT                   /db_xref="GOA:B2A6B8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B8"
FT                   /protein_id="ACB84129.1"
FT                   /translation="MENNTFNASRIAIMGGTFDPIHLGHLMVAEEARQKFSLDKVIFVP
FT                   VGIPPHKSAENITPSYHRYMMTLLATNNHPHFFVSNFEIDRNQPSYSIETLRYFRDLYD
FT                   SETSLYFITGTDTILDILTWKDYHELPQLCDFICATRPNFSVEELETRVYRYFPELKPH
FT                   VHYLQIPLIEISSTEIRNKRFNEQDITFMVPETVENYILKENLFKGD"
FT   gene            555274..555873
FT                   /locus_tag="Nther_0534"
FT   CDS_pept        555274..555873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0534"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: swo:Swol_1602 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84130"
FT                   /db_xref="GOA:B2A6B9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6B9"
FT                   /protein_id="ACB84130.1"
FT                   /translation="MDYNSIYNYYNDQLQKILTPARYTHSMRVVQTSLKLAPKFDADYQ
FT                   KTALAALVHDRGKEIGVNQLIKIAEQAGLILDEAETSHPGLLHGPVGAYLLKQEGKIND
FT                   EDILQAVRFHTTGRPGMSSIEKAVFLADLIEPGRDYPNVDILRKLSFNEPYLGLVKALD
FT                   WTLEYLMRMGWVIHPLTVKTRNYYLQKRGTTRSLKI"
FT   gene            555935..557143
FT                   /locus_tag="Nther_0535"
FT   CDS_pept        555935..557143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0920 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84131"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C0"
FT                   /protein_id="ACB84131.1"
FT                   /translation="MENLDKYRKSNNRRKKRRKRTKIKKNRLVAVLVLVILFFFAGFVS
FT                   RYLLIGSTLKTEANWVTALASQDTQEYDNTMISVINRENNLLEYVVIINQQQAESDFQE
FT                   PKDLNLLFVPGETYLDTPGNDIETYMESYHDGVGKLLQTTKEYFGISIHNFIQVDQRTF
FT                   EHLNHQLELEQQIELEELGYKFLDSGLERDEFQTKFNDTMESLVSFYLQVRNELGLFNR
FT                   PAIRSYVGDKVETNLTWEELTEYIELYNNAFENEAFNLYTIPGERDQVNDHEYLVLDND
FT                   DLGIMVEQYFSGEVGSIPQEDITVEILNGCGIDGAATDLKSELEDQGFQVVRIGNADHF
FT                   EYQSSQVIARTDLIEAAKEVALEISGADLLHDQQDDPEAQVTVIIGENYVQNNSEEKEN
FT                   NFE"
FT   sig_peptide     555935..556069
FT                   /locus_tag="Nther_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.540 at
FT                   residue 45"
FT   gene            557155..557499
FT                   /locus_tag="Nther_0536"
FT   CDS_pept        557155..557499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0536"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: cth:Cthe_1238 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84132"
FT                   /db_xref="GOA:B2A6C1"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C1"
FT                   /protein_id="ACB84132.1"
FT                   /translation="MQDSLQLAKNIAKKLDDKKGKDIVLLKVKDITLIADYFVIVTGTS
FT                   TTHIQSLAENLISSLKEEDDFSPLHKEGLAEGNWILLDYDSVLVHIFLEDTREFYNLER
FT                   LWGEAEEITL"
FT   misc_feature    557560..557774
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   104.13; T-box leader sequence"
FT   gene            557856..560336
FT                   /locus_tag="Nther_0537"
FT   CDS_pept        557856..560336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0537"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: chy:CHY_0393
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84133"
FT                   /db_xref="GOA:B2A6C2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A6C2"
FT                   /protein_id="ACB84133.1"
FT                   /translation="MKEYQPQKIESKWQKRWQDEISYETEVDHNKDKYYVLEMFPYPSG
FT                   KLHMGHMRVYSIGDVLARFQRMRGYNVLHPMGWDAFGLPAENAAIENQDLPSRWTYANI
FT                   DNMKDQLQALGTSYDWKREVSTCSPDYYKWTQWMFLQLYKNGLAYKKKAPVNWCPECET
FT                   VLANEQVENGACWRCDSMVEQKQLSQWFFKITEYADRLDQDLELLEEWPDRVKTMQKNW
FT                   IGKSQGTEIDFPVKGSREKIRAFTTRPDTIFGATYMVLAPEHPMTEQLVQGTDQEKEVM
FT                   DFIKGVHEMGKEAREAEDLEKEGVFTGRWAINPLNGEEIPILVGNYVLMEYGTGAIMAV
FT                   PAHDQRDFQFAHKYNLPIKEVVTPPEGEGKTESETHDELKKAYTDHGILINSPGYNGMT
FT                   SEQAIEQITRDIENKGIGAGVTTYRLRDWLVSRQRYWGAPIPVLYCDQCGILPVPEDEL
FT                   PVQLPEDVDFSQGSRNVLAARQDFVETSCPQCGGSAQRETDTMDTFVCSSWYFLRYTTP
FT                   WDNEVPFRQEDVNYWMPVDQYIGGIEHAVLHLLYARFFTKVMYDQGYTNFKEPFSRLLA
FT                   QGMVNKDGAKMSKSKGNVVSPDEILRTYGADTGRLFILFAAPPEKDLDWNDEGVEGCYR
FT                   FLQRLYRLVNDNQNLVDLQLDDTKFTKEDKEYHRLIHKTIKKVTDDISERHNFNTAISA
FT                   IMELTNASSKYKEQKEVNESLLRTGLETIVMLLAPFTPHIAEELWETLGYQDSVHKLNW
FT                   PSYDEKAMVAEEAEMVVQVNGKVRDHLTVPADSSEETIKEKALEREKVQKYISGAEIKK
FT                   VIVIPQKLVNIVCK"
FT   gene            560632..561486
FT                   /locus_tag="Nther_0538"
FT   CDS_pept        560632..561486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0538"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sth:STH3100 formate dehydrogenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84134"
FT                   /db_xref="GOA:B2A6C3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C3"
FT                   /protein_id="ACB84134.1"
FT                   /translation="MKENKGFKLKRRQFIQSMAGTGLLAGLSLSAPRIAEAGENNGSEY
FT                   AMMVDKTECVGCNACTRVCSEAYELSEGILRTEIHRFKDDEDEEYFKKNACLHCNEASC
FT                   VMACPADAIYKDDLGLTQIDNSICVNCGYCVSACPYNAIKYDRKKGVNEKCTLCTELIN
FT                   AGSEPLCKQECPVDAIYFGTREEMLELGREKVSDLKDQGYDKAMLYGDDEFDGLAVLGV
FT                   LHDEPQEYELPKDPQIPMQLRVWNQIPFAPAFLVVGGAAMVFNFLHSRKTKAELEQPEE
FT                   DEE"
FT   sig_peptide     560632..560745
FT                   /locus_tag="Nther_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.749 at
FT                   residue 38"
FT   gene            561520..562836
FT                   /locus_tag="Nther_0539"
FT   CDS_pept        561520..562836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0539"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Respiratory-chain NADH dehydrogenase domain
FT                   51 kDa subunit; KEGG: amt:Amet_2280 electron transport
FT                   complex, RnfABCDGE type, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84135"
FT                   /db_xref="GOA:B2A6C4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C4"
FT                   /protein_id="ACB84135.1"
FT                   /translation="MEAKTFPGGAYIPHYKFTDDKPIEDMSIPEEIVIPLAQHIGSPCE
FT                   PLVKVGDRVEVGQKIGDSEEYITAPVHASVSGEVVAIEERPFFEGDEVESIVIKPDSEQ
FT                   QEFSYDEKNIEDMSLDDMKDRIREAGVVGMGGAAFPTYVNINQSKPIDSLLINGAECEP
FT                   FLTCDHRQMVERSEELVIGAEILMNIIGAKKCYFGIEENKPDAIDAVSKQIEGKDGMEV
FT                   VPLKTKYPQGYKVNVIHACTGRDVPRGVRSADLGCIVRNVGTTIATYEAVKYGKPLMER
FT                   VVTVSGYNIPEAGNYNIKIGTPVEHVLRECGVDNFENQKVILGGPMTGTAVKDIRSSVV
FT                   KNSTGLLLFPEDMTWDYTDYNECVRCGKCVERCPVHLYPNKIGMYAEHKQYSKAEEWDI
FT                   MDCGECGTCVYFCPANRPILMWIQQVKPTVKRRQRQRSK"
FT   gene            562905..563882
FT                   /locus_tag="Nther_0540"
FT   CDS_pept        562905..563882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0540"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   pdi:BDI_0514 electron transport complex protein RnfD"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84136"
FT                   /db_xref="GOA:B2A6C5"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C5"
FT                   /protein_id="ACB84136.1"
FT                   /translation="MESNKTIVSPSPHLKADLSVSKSMRDVIIALIPIILVTLYFNGMQ
FT                   ALSLIAVSVVTAAVTEVVFRKIMGKQPSLADLSAVLTGLFVALVLPVATSPIRAIIATV
FT                   IAVGIAKELMGSLGWNRYNPALFGYVTTLLMGAWLPFMETGFQSLPALDSVSGATPLAM
FT                   LTQGMEMPGYGSMLLGHGEAGSLAEASALAVIIGGLYLLYKKHINWRTPVGMIATVFII
FT                   SLIFGVDPIYAVLGGGVLFGAFFMATDWVTCPINNKGKLVFGICVGLLICIFRYALPAT
FT                   GGVAFSILIMNGFTPMIEKFTQHPSFMEPRKTSEPASGGKTASS"
FT   gene            564060..564518
FT                   /locus_tag="Nther_0541"
FT   CDS_pept        564060..564518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0541"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   swo:Swol_2107 rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84137"
FT                   /db_xref="GOA:B2A6C6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C6"
FT                   /protein_id="ACB84137.1"
FT                   /translation="MHVVLVEPEIPPNTGNISRTCAVSNTTLHLVEPLGFSISDRELKR
FT                   AGLDYWDKLSYQVHENFTSVENLLQTHPIYIATTRGKNYYYDIEYPRDSVLVFGKETEG
FT                   LPDWIINKYYENSIRIPMAPDFRSLNLSNSVAVVLFEALRQQSFPGLN"
FT   gene            564544..565272
FT                   /locus_tag="Nther_0542"
FT   CDS_pept        564544..565272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0542"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: drm:Dred_0754 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84138"
FT                   /db_xref="GOA:B2A6C7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C7"
FT                   /protein_id="ACB84138.1"
FT                   /translation="MGKFTAILFDLDGTLLPVDTKVFIYKYFELMKKSVSNLYDPEVFV
FT                   KHVWEGSKKMINSNDSKTTNQQVFFQYFNQAIDLPLEQIESFFDDFYNNKFPELRNCVG
FT                   ETEINRYELISSLKKAGYQVIIATNPIFPKEAIEHRLDWIGLSRSDFDLVTTYENMHFA
FT                   KPNIRYYQEICSQLQLSSQECIMVGNDTGEDLIAKKLDMQTYLVTDYLIDERNLLEQMT
FT                   PDYQGTLQEMSDYFNEQLVN"
FT   gene            565411..565830
FT                   /locus_tag="Nther_0543"
FT   CDS_pept        565411..565830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0543"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: chy:CHY_1135
FT                   transcriptional regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84139"
FT                   /db_xref="GOA:B2A6C8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C8"
FT                   /protein_id="ACB84139.1"
FT                   /translation="MSDVKKGKKKRMTKQRKIILNVLKNTKSHPTADWVYDQVREVLPN
FT                   ISLGTVYRNLKVLKEMGEIMELDFGSTYSRFDGNPHNHYHFVCNDCERVYDIDMPTDES
FT                   LLAKADEVSEHQVQEHRLEFYGTCQECYQQSTAQG"
FT   gene            565922..566947
FT                   /locus_tag="Nther_0544"
FT   CDS_pept        565922..566947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0544"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aminotransferase class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; aminotransferase
FT                   class I and II; KEGG: tte:TTE0267 threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84140"
FT                   /db_xref="GOA:B2A6C9"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6C9"
FT                   /protein_id="ACB84140.1"
FT                   /translation="MSFIDLRSDTVTQPTEKMRTAMSEAAVGDDVYEEDPTILELEEKS
FT                   ARIFNKEKGLFFPTGTMANQAAILAHTNPGEEIIIEKDMHIYLYEVGGLAFLSGVQSRQ
FT                   LPGNLGQLDPQEVEAAIRPSNIHFPRTSLICLENTHNVHGGTVISKRDIDKIAEVAHQY
FT                   KLPLHLDGARIFNAATYLQTTVAELTSSCDTLMFCLSKGLSAPAGSMLVGDENFINRAR
FT                   KCRKLLGGGMRQAGILAAAGIVALEEMTNRLQEDHENALLLAKNLAEIPWIEIDVDRVE
FT                   TNIIRFNLDTSHFSAVEFENKLREANIKVNVSGDGGVRMVTHKDVTRDQVEHVVSVLKS
FT                   L"
FT   gene            complement(566954..567436)
FT                   /locus_tag="Nther_0545"
FT   CDS_pept        complement(566954..567436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_137950 viral A-type inclusion
FT                   protein, putative Pfam: HOOK GBP_C FliD_C SBP_bac_9
FT                   Prefoldin Filament Alpha-2-MRAP_C Myosin_tail_1 Rab5-bind
FT                   Tropomyosin Pox_A_type_inc SURF6 Apolipoprotein PspA_IM30
FT                   HrpB7 Dor1 Baculo_PEP_C MTHFR DUF1110 MIF4G DUF745
FT                   Bacillus_HBL"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84141"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D0"
FT                   /protein_id="ACB84141.1"
FT                   /translation="MKIQFSQFNNKNSRASNNNIKTMKLEKEWAKVLYVEGVKPDQNLP
FT                   AEIQIKRISYKTLSPEKLAINADLTVKTLKTKQNTSSNKINVAWKKTLDTIPEQHTQVK
FT                   IRLINTRPKYLPPVKKINKVTPTINRINAKTIRNRIALRGKLVFQVDYQADKSSKN"
FT   gene            567968..569272
FT                   /locus_tag="Nther_0546"
FT   CDS_pept        567968..569272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0546"
FT                   /product="putative signal-transduction protein with CBS and
FT                   DRTGG domains"
FT                   /note="PFAM: CBS domain containing protein; DRTGG domain
FT                   protein; KEGG: gtn:GTNG_2674 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84142"
FT                   /db_xref="GOA:B2A6D1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D1"
FT                   /protein_id="ACB84142.1"
FT                   /translation="MTKHRELIKYISELPIGTRISVRKIAGELSVSDGTAYRAIKDAEN
FT                   KGLVTTIPKTGTIRIKNEDKNYNNQVTFAELIKIVNGTVLGGREGLYKPLNKFLIGAMK
FT                   LKDISSYISDGCVLIVGNREEAHELALKKGAAVLISGGFETTEANKKLADKYALPIIKS
FT                   PYDTYKIATLINQTLYNKMVESEILHVKDIINNHPHYLNEKDTYQDWEQLLDKTEHSRF
FT                   PVTNDENKVVGVVTSKDVTGRDYNASIAKLMTSNPITVSPETLVASVAYVMVWQGIEMI
FT                   PVVDEQDKLIGIVSRHDVMEAMQFGKGHDKNTATAARKMIQNNFTKEIFNEGITLSGFV
FT                   NPAMTDQVGSMDPSILTALLIQASLSALGHDNVFNIVLENCSFNYVAPIQLEQKINVTA
FT                   RVLENSRKYGKVDLEIKGDEKVLLKGFISCQILKK"
FT   gene            complement(569277..569801)
FT                   /locus_tag="Nther_0547"
FT   CDS_pept        complement(569277..569801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84143"
FT                   /db_xref="GOA:B2A6D2"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D2"
FT                   /protein_id="ACB84143.1"
FT                   /translation="MIFKLTNIENQSPTKETRNKLRKIFLGWFLLGILIGATSTSYFLN
FT                   YQIENLYWEKTELEQELSQTENRMEKLEEELRTLEEKWEQDPSNVVKDANIVVDYEDNP
FT                   QVVLAIKEFCQDIAQEIIGYQINKLEPELIFQMFDNRSTKVEEQEYKINVNSLIISERL
FT                   TLWIEPEKVNN"
FT   sig_peptide     complement(569667..569801)
FT                   /locus_tag="Nther_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.350 at
FT                   residue 45"
FT   gene            complement(569798..570127)
FT                   /locus_tag="Nther_0548"
FT   CDS_pept        complement(569798..570127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bld:BLi03073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84144"
FT                   /db_xref="GOA:B2A6D3"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D3"
FT                   /protein_id="ACB84144.1"
FT                   /translation="MSTFFGTLIVNFSIALGVVIGGSFIGGLGASIGGQPPIQTTLTIA
FT                   EKLKIWALVASLGGTFTTIKEIEMGFLGGQLHTVVKQLIFILGAFLGAHSGVIIISFIA
FT                   GGNNS"
FT   gene            570175..573579
FT                   /locus_tag="Nther_0549"
FT   CDS_pept        570175..573579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0549"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pth:PTH_2220 DNA polymerase III, alpha
FT                   subunit; TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   PHP domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DNA polymerase III alpha subunit;
FT                   SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84145"
FT                   /db_xref="GOA:B2A6D4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D4"
FT                   /protein_id="ACB84145.1"
FT                   /translation="MPKPFVHLHTHSQYSLLDGKCRINELVQKAKEYQMPALALTDHGV
FT                   MYGAVEFYKQAKEAGIKPILGCEVYVAPRGRTVKDPVKDKHQYHLVLLAENQTGYKNLM
FT                   KLVSLAFKEGFYYKPRVDYELLERYHDGIIALSACLAGEIPTLILQGQYEVAKNRADRL
FT                   KSIFGQNNFYLELQDHGLTEEQQVNTHLLQISRELDIGLVATNDIHYLTNQESSIHDVL
FT                   LCIQTGKHLDDQDRMKFPSNEFYFKDGDEMSNIFKDFPGAIENTLAIADRCQVELDFDT
FT                   LHLPEFRVPEGYDENSYLRKLCQKGLLERYEQVTTKIQERLEYELDVISKMGYASYFLI
FT                   VWDFVRFAHENNILVGPGRGSAAGSLVAYSLRITNVDPIRYGLLFERFLNPERVNMPDI
FT                   DIDFCYENRERVIQYVVEKYGNDNVAHIITFGTMQARAAVRDVGRVMGMNYGDVDRVAK
FT                   MIPHDPGMTIDKALELNKDFKKLYDEDPQVRELINISKSIEGLPRHASIHAAGIVISKA
FT                   PLTEYVPLQCNDDQVVTQFPMGTLEELGLLKMDFLGLKTLTMMNRAVEIVNQTQAETVD
FT                   LNKIPLDDEQTFRLIREGNTLGVFQLESSGMRGVLRDLKPTSFEDIIATSALYRPGPME
FT                   QIPTFIESKHGQREISYPHEDLKPILEETYGIIVYQEQIMQVASTMAGFSLGEADLLRR
FT                   AIGKKKKNILAEQKEKFVQGCINRGYGKETGEHVYDLIVKFADYGFNKSHSAAYAYIAY
FT                   QSAYLKANYPTQFMAALLTNSMNDTDKLALYIDNAREMGIEILPPDVNESLVDFTAVSD
FT                   FRIRFGLAAVKNVGRGAVEEIITRRRKEGGFTSLDDFCSRTDLRACNKKAIESLIKVGA
FT                   FDAFEHNRKQMLQVLDEAVKKAQAFTSGSVKGQVTMFEIVSDGTNKIDLDYPDVEEFTL
FT                   NELLQMEKELLGFFVSGHPLDNYKEKLANIDTSSLAELNQIKEGFRIKVAGICQDVKEI
FT                   ITKKGEQMAFCTLEDQSGTVELVIFPDQYSKGRQLILDGAPVLITGKVDYKEEGETKIL
FT                   VEKLLALESISQQIYIKVPEKLYPKIPELKQVLLKSPGELPVFLYFPEQGKLKKVSKEF
FT                   FATGDNEFCHKVQEIMGTDSIKLKYSL"
FT   gene            573630..575372
FT                   /locus_tag="Nther_0550"
FT   CDS_pept        573630..575372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0550"
FT                   /product="pyruvate kinase"
FT                   /note="TIGRFAM: pyruvate kinase; PFAM: PEP-utilising
FT                   protein mobile region; Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta; KEGG: aoe:Clos_0586 pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84146"
FT                   /db_xref="GOA:B2A6D5"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D5"
FT                   /protein_id="ACB84146.1"
FT                   /translation="MLRKTKIVATIGPACENKESLARMAQNGMDVCRLNFSHGEHQEHL
FT                   DRINLIREVYQELKFPPAILLDTRGPEIRLGTFENGEVDLEKGQEFTLSTEEIEGDTTR
FT                   VHVNYPQVTSDISPGDKVLLDDGLIELLVNEVTETEVKTVVNNDGTIKDNKGVNLPGVT
FT                   LSLPAMTDKDQQDILFGIENQVDFIAASFIRKPEDVLEIRKFLEEHGSDIPVISKIENK
FT                   EGVENLERILEVSDGLMVARGDLGVDIPPEEVPLVQKRMINRCNDEGKPVITATQMLES
FT                   MTENPRPTRAEASDVANAIIDGTDAVMLSGETAAGAYPVESVSTMANIAKSTERELSRK
FT                   PQEVTAKDTGMTEAIGYSTCQIAGQLEANAILTATQSGYTARMVAKYKPKAPIVAVTPI
FT                   EKVARRLSLSWGVYPITCDPSETTDEMFQEAIQTALITQYISEGDLIVITAGIPVGVSG
FT                   TTNLIRVHTVGEILVSGAGIGKKPATGKVVKVEDSNDLSKISSGDIVVLRGTTDEMVPH
FT                   LAQVSGLVAEEGGYTSPSAIVGLDLGLPVIVGAEGALEKLADGDQVTIDPLRGFVYKGQ
FT                   ATIL"
FT   gene            575400..575840
FT                   /locus_tag="Nther_0551"
FT   CDS_pept        575400..575840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0551"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   tte:TTE1814 predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84147"
FT                   /db_xref="GOA:B2A6D6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D6"
FT                   /protein_id="ACB84147.1"
FT                   /translation="MISKTNIRVRYQETDQMGVVYYANYLVWFEVGRNHYFRELDFPYR
FT                   DMEKAGIYIPVISANCNYQKPARYDDLIEIQTKITKMTSAKIWFNYEIIRGTQDTTTSG
FT                   KGDRFLAKGETSHAFVNETGKPVAFKKYFPDLYNDLKNYIIT"
FT   gene            575907..576398
FT                   /locus_tag="Nther_0552"
FT   CDS_pept        575907..576398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0552"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   amt:Amet_4063 FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84148"
FT                   /db_xref="GOA:B2A6D7"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D7"
FT                   /protein_id="ACB84148.1"
FT                   /translation="MLVKALLLFTIVPLIEVWFLVRLGQNIGAFPTIFLVAVTGFIGVF
FT                   LAKSQGFIVIHRLQRKLASGAFPTDELYNGACILIGGTLLLTPGLFTDLFGLSLLIPFT
FT                   RVFWKMVFSRIIKKLIKDGKVTVHTNNQEFWGNTGSEKSDYIDTDFEVNYDEDKDEDYH
FT                   "
FT   gene            576618..576863
FT                   /locus_tag="Nther_0553"
FT   CDS_pept        576618..576863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84149"
FT                   /db_xref="GOA:B2A6D8"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D8"
FT                   /protein_id="ACB84149.1"
FT                   /translation="MEFEAYDVALIPFVMGMIQVFKKLGMPKKAAPVVALIVGNVMGYV
FT                   YLAPGEPEKAIIWGTSIGLSAIGAYSGAKNTMEYNK"
FT   gene            577011..577670
FT                   /locus_tag="Nther_0554"
FT   CDS_pept        577011..577670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0554"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: pth:PTH_1985 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase related protein;
FT                   PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84150"
FT                   /db_xref="GOA:B2A6D9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6D9"
FT                   /protein_id="ACB84150.1"
FT                   /translation="MRSFTISKHGFSTIGFFLIGALISWFINQWLMLTFLCFATFTAAF
FT                   FRNPKRFPPQGEEVVVSPADGKVMEVDEVIEPNFTNNKMKRVRIFLSLFNVHMNRMPID
FT                   GNIAGTSYLPGKYLLAWKDKVSDENERNAILIDHYGSPFVVVQIAGFVARRIVSQVTEG
FT                   QAVTKGDLFGMIKFGSCTELYLPMETVVKVKSGDKVKAGETILAEMPEKNKSTVKK"
FT   gene            complement(577714..579069)
FT                   /locus_tag="Nther_0555"
FT   CDS_pept        complement(577714..579069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0555"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: tte:TTE1776
FT                   predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84151"
FT                   /db_xref="GOA:B2A6E0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E0"
FT                   /protein_id="ACB84151.1"
FT                   /translation="MNYKKLIGSAVINQGLNYIEKDPLNNIPKLLKYIKKFTAFDHHHK
FT                   AIDNFGKAIEDPDNNWNQLTQKVLNNYDMNIVKKFVANFVLNSVILGRKVSVEYSEKYD
FT                   CNVPWAILMDPTAACNLKCEGCWAADYDKTSMSFETMDRIIREGKELGVYMYVFSGGEP
FT                   FLKKQDLIKLAGKHNDCAFLSFTNGTLIDEELAKDLSQVGNFALAISVDGFEAVSDQRR
FT                   GEGTYSQIDETMGILSSYGVPFGFSTTYHRYNTETVASEEYIDAMVDKGCLFGWYFTYM
FT                   PIGKQGTPDMLVTPEQRAYMFEQIHKFRAEKPIFLIDFWNDGEFSGGCIAGGRNYLHIN
FT                   ANGDVEPCAFIHYANVNIHDHSLLEALRSPLFQEYRKRQPFDDNLLKPCPLLDNPDILT
FT                   EMVQNSDAYSTQILEKEPVERVANKCQPIASKWARKADELWEENYSVSSESD"
FT   gene            complement(579245..579760)
FT                   /locus_tag="Nther_0556"
FT   CDS_pept        complement(579245..579760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0556"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: mac:MA3586 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84152"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E1"
FT                   /protein_id="ACB84152.1"
FT                   /translation="MIYYYYDNKHGLLKELVIRHVQETLEFKETLLEEIDNYSEEEIKK
FT                   ISQRLFNFLKQKSKILSILTIETLKSGSQDHNIFRILHPIYEKTLKDLEEKGYKIDNHT
FT                   EQILNLFFFGTIPVTLFIALKEKWSEFYGIDSDETEKIFQAKIDEFHINFYQALINDKT
FT                   NTSNLINK"
FT   gene            complement(580017..583544)
FT                   /locus_tag="Nther_0557"
FT   CDS_pept        complement(580017..583544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0557"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="KEGG: dsy:DSY2035 hypothetical protein; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 77; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84153"
FT                   /db_xref="GOA:B2A6E2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E2"
FT                   /protein_id="ACB84153.1"
FT                   /translation="METPIKLFHDSHNPLYRKPFGAVSINKEILLRLYIRTTNPKELQV
FT                   LANCIDDQGNKVAYPMYQTGISENDCDQIDYDNGNGSIYKEELTGYFYEASIKSPDTPG
FT                   LFWYTFTVVSNETKVYFGNNQELSGGPGQESHQEPLGYQVTVHEQDLQIPNWLKDAVIY
FT                   QIFIDRFNNGNEDGTVSNPKRNSFLHSHWDNSPLYVRDQEGKILRWDFFGGNLEGVRQK
FT                   LVYLKKLGVSIIYFNPIFEAESNHRYDVGDYHKIDAMIGNNEEFRQFCKEAENMNIKVI
FT                   LDGVFSHTGSNSLYFNKYGSYPSLGAYQSKESPYYNWYRFLEHPHKYESWWGIDNLPNV
FT                   EEHNPDYQNFIISDDNSVLKHWFRHGAKGWRLDVIDEIPDEFLQNFYQTLKSQDPESIV
FT                   IGEVWEDASNKISYDRRRQYLLGKELDSVTNYPLRNIMLDFVLDHNSSQETARRVLSLM
FT                   ENYPEDYFYTAMNLLGSHDVERVLTVLKDNTPDDLREDLDSIAKKRLKLLTLWQMTFPG
FT                   IPSIYYGDEAGLEGYQDPDNRKTYPWGNEDQELVSWFRKLTAIRNHYDVLRTGDFSLVT
FT                   TVSDSQQDLDKDILLYRRKISQNQDRFHQKRLNNTAVIVLNRNPRERKNLKIHISEVTG
FT                   TNSGQSFVDPLEDYNIVSTDNDGYLEITLEPLECKLLLADRYQGNANFERNAGILLHPT
FT                   SLPSPYGIGDLGKEAYRFVDFLRDSGQKFWQILPLNPPGYGNSPYQCFSAFAGNPLLIS
FT                   LDKLTEQGLLTQNRLSEAQQKQTNYVDYEKTYQLKEPLLQAAFENFIDNGGKESHDFRE
FT                   FISQHSYWLEDYAMFMALKAHFNYKPWHQWDDEEIIWRKPHALAKYREKLANTIDYHKF
FT                   LQYIFFNQWHSLKNYTNKQNIHIIGDLPIFVAHDSSDVWALKHYFELDSQGKPAKKAGV
FT                   PPDYFSENGQLWGNPHYDWNELEQDNYRWWIERIKVLMQLSDVVRIDHFRGFEAYWEIP
FT                   GSEDTAVNGTWVKGPGEKFFNTIESNLQDKYDPQIIAEDLGVITSEVEELKLKFDYPGM
FT                   SILQFAIHNEPDHKFRVPLYNKNTVAYTGTHDNDTIVGWLENELGERFSSQQEQINAAW
FT                   KHIEMVYESDARSAIIPLQDFLGLNSNHRMNTPGTIGDNWEWRFCWDQIGQELSDKINN
FT                   LVYKTKRKP"
FT   gene            complement(583528..586014)
FT                   /locus_tag="Nther_0558"
FT   CDS_pept        complement(583528..586014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0558"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: gtn:GTNG_2778 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84154"
FT                   /db_xref="GOA:B2A6E3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E3"
FT                   /protein_id="ACB84154.1"
FT                   /translation="MFESRDKFKREFKEKLRKERGKAIDNASYLDLYKTLGRMVREEIN
FT                   DNWVATNSQMADKDKTQVHYISMEFLMGRMLKQNLLSIGALDTCQESFKELGIDFDKVV
FT                   QKEPDPGLGNGGLGRLAADFLDSLSALSIPAVGHCLRFKYGLFDQKIVNGYQVELPGNW
FT                   LREGNIWEIRRGDHAHEIKFGGRVTSSHQNGKLTFHHEDYESILAVPYDIPIIGYKNQV
FT                   VNTLRLWNTEPAVQDFYFKPIDGNSCHQVLNYKKSIESISEFLYPDDSHEEGKVLRLKQ
FT                   QYFLVSATLQSILDNYKLKQKSIHELPQEVSVHINDTHPVLAIPELMRILMDEEGLDWD
FT                   TAFDLTKRTISFTNHTTLPEALESWPEETIKCLLPRIHMIVHELNERFCQSLWDKYPGD
FT                   WNRIENMAILAHGRVKMAHLALAGSHTVNGVAALHTKLLKEKLFKNFYEYMPEKFQNKT
FT                   NGITHRRWLMLSNPKIADTVTDYIGTNWITEPKELEALEKHQDDVGLQEQLVKIRHENK
FT                   QDLAEIIKKENGLTVDPNSIFDVQVKRFHAYKRQLMNALHILKIYNQIKENPNTLFYPR
FT                   TFIFSGKAAPGYHYAKKIIKLINSIAELVNNDPQVNDQLKIVYLENYRVALAEKIIPAS
FT                   DVNQQISTASKEASGTGNMKFMMNGSIIVGTNDGANIDIREAVGDDNIFVFGLESEEVL
FT                   QYYHHGEYSPFEIYENDLKIKRILDQLVSDFLPGEENFRDIYDSLLLGNDEYFVLKDLT
FT                   SLEEAQQKVSQAYQDRSKWFKKAIVNIANSGRFSSDYTIKSYADKIWQATPLKTMTVNQ
FT                   ADSSQMPAGEYSGNTY"
FT   gene            complement(586014..587504)
FT                   /locus_tag="Nther_0559"
FT   CDS_pept        complement(586014..587504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0559"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: amt:Amet_2946
FT                   glycogen/starch synthase, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84155"
FT                   /db_xref="GOA:B2A6E4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2A6E4"
FT                   /protein_id="ACB84155.1"
FT                   /translation="MKVLVATAEASPFAKRGGLGDVLGALPIAIKKQSEIDIRVVLPGY
FT                   SAIPSQFKSEFQPIDSIIIPLGWRAQKSRVSSYNFRNVTFYFIENDYYFNREDIYGYFD
FT                   EAEQFGFFSKAILDIMPLLDFYPDIIHLNDWHTAMVSPLLKYKYAHKTNYNQMKTILTI
FT                   HNLKYQGIFTPHVLEDFFDLHDHKLQHDPEYLEYHGQISFLKGGLIFSDAITTVSPTYA
FT                   KEIQSPELGMGVDGLLHKRRDDLYGILNGIDYQDYNPKTDVNIYRNYNLPDEGKTNEKL
FT                   INKLRLQEDLRLPVSSRVPLIAFINRLVKQKGLDLITYVLPELLESEEVQFVFLGTGDP
FT                   HYEQYLSYLAEKHQNLSAQIKFDEGLARKIYAASDLFLMPSLFEPCGIGQQIAIRYGSV
FT                   PIVRKVGGLHDTVYPSISEEGTRGIGFTFESFNAHEMLFTIKEAIQYYHQKAFWQEIIN
FT                   NLTTIDFSWEKSACEYIELYHKLIHRNTNSTRKESYLK"
FT   gene            complement(587569..588630)
FT                   /locus_tag="Nther_0560"
FT   CDS_pept        complement(587569..588630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0560"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /note="KEGG: cno:NT01CX_0724 glucose-1-phosphate
FT                   adenylyltransferase, GlgD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84156"
FT                   /db_xref="GOA:B2A6E5"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E5"
FT                   /protein_id="ACB84156.1"
FT                   /translation="MKDLMGIIYLNKPEQDGKLPILTRNRCIASLPIWSKFRLIDFILT
FT                   NMVQSGIENIALLSTIKYRALINHLQGGAAWGLDKKRDGLFIFIPTMSQSSYNLGHFDF
FT                   QLLSENIDHIKKSHQDYLVFAPGNLVGNIDFQWLLNFHKKQEKDITYVRPGTDYASYSK
FT                   DLSEDGYYQMHPIFLISKSLMVKLIREYYYTNFNGSITDLMTSSIRNNGLTINEVNYPN
FT                   LNCITNMENYFNFSMNILETPEMLTGNMEVPVTKKRDLPPTRYYEGCEISQSLIAEGCH
FT                   IKGEVNSSIIFHSVSIERGTQISNSIIFPETIINENSLLNEVIADKQVYISENKQLINS
FT                   STKPLVLSKQARV"
FT   gene            complement(588627..589796)
FT                   /locus_tag="Nther_0561"
FT   CDS_pept        complement(588627..589796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0561"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: bcy:Bcer98_3503
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84157"
FT                   /db_xref="GOA:B2A6E9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E9"
FT                   /protein_id="ACB84157.1"
FT                   /translation="MINNGQDWVAMILAGGKGSRLNELTSETAKPAVLFGGKYRIIDFT
FT                   LSNCRNSGVNTVGVLIQYKPFELNTHIGEGRSWDLHGTWSGVYILPPYTEKNGVCWYKG
FT                   TADSVYQNLEFLSTYNPKYVLILSGDHIYKMDYQKMLQFHIASQASVTISVMEVPYSEA
FT                   HRFGIMNTDNKGKIFEFEEKPQQPKNNLASMGIYIFNYDKLKEYLEKDSQNPTSTRDFG
FT                   KDIIPQMLANEERLCSYIYQGYWRDVGTVKSFYDANMDLLSSKPFLKLDCQEWPILSRS
FT                   SSYPPQYISETAKVRNSIISEGCHLEGTVENSVLSPGVTIKKNAVVENSVLLENTIVEQ
FT                   NATIKHAITCQNCHIKSFASINQENHQEPVLVPQNTTITQETKLEEVLT"
FT   gene            complement(589798..591714)
FT                   /locus_tag="Nther_0562"
FT   CDS_pept        complement(589798..591714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0562"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: drm:Dred_1453 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84158"
FT                   /db_xref="GOA:B2A6F0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6F0"
FT                   /protein_id="ACB84158.1"
FT                   /translation="MVQTKTITEFETHLFHEGTYFESYRKFGAHLSNEKGTVGTRFTVW
FT                   APNAKKIEIVGSFNDWHGEQYAMNKITTSGIWSLFIPEVTEGELYKYKIYPEGGGEPLL
FT                   KADPYAFYSEKRPKSASIVYSLEGYNWGDREWQRKKRRENILKKPVSIYEVHLGSWKKT
FT                   EDGDFLSYRELAHDLVDYVKEMGYTHIELLPVVEHPFDRSWGYQATGYFSVTSRYGTPK
FT                   DFMYFVDRCHQEGIGVILDWNPCHFCRDGHGLRLFDGAPVFEYQDPHRAENTEWDTNNF
FT                   DLGKPEVISFLVSNAFFWFDLFHIDGLRVDAVSSILYMDYGKEDGEEWLPNKYGGRENL
FT                   EGLNFLRTLNEAVFERFPNVMMVAEESTSWPLVSKPTYSGGLGFNFKWNMGWMNDMLEY
FT                   MKKDPIHRKHHHQNITFSFLYAFSENFVLPLSHDEVVHSKRSLLNKMPGDYWQKFANLR
FT                   VLLGYQMGHPGKKLLFMGGELGQFDEWKDLEQLDWNLLQFEFHWKMRQYCRQLNQLYTT
FT                   EPALYEQDHTSKGFEWIDPHDHSQSIISFIRWGYNFQDHLIIVCNFTPQVYHGYRIGVP
FT                   KDVSYKEIFNSDAEEYGGSGILNSDELQPHEVEWHHRPYSIELNIPPLATFILKPLAAR
FT                   EEN"
FT   gene            complement(591825..592544)
FT                   /locus_tag="Nther_0563"
FT   CDS_pept        complement(591825..592544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0563"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: amt:Amet_4265
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84159"
FT                   /db_xref="GOA:B2A6F1"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6F1"
FT                   /protein_id="ACB84159.1"
FT                   /translation="MEIMIFSTLAGMSTLMGAGIVFLFGTPSRIILAVILGFSGGVMFS
FT                   VSIFELITEALKLSYQGPVLAAFFAGGFIMWCFSVVINKFLTPTHQMYETEDFLKTGYL
FT                   VILGIALHNLPEGLAIGTGIEASPDLSLIIAITLAIHNIPEGMATAGPLKAGGLNTFSI
FT                   IILITFAGLVTPLGTMAGIIFMGVLPDLVGISLGIAGGAMIYLVIDELLPKAQSSNKVL
FT                   ANSGFFLGFILGKLIVG"
FT   sig_peptide     complement(592473..592544)
FT                   /locus_tag="Nther_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.444 at
FT                   residue 24"
FT   gene            592704..593546
FT                   /locus_tag="Nther_0564"
FT   CDS_pept        592704..593546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0564"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: amr:AM1_4001
FT                   oxidoreductase, aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84160"
FT                   /db_xref="GOA:B2A6E6"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E6"
FT                   /protein_id="ACB84160.1"
FT                   /translation="MKERQLGKTGIKVKLFSLGGEATVEQRGLKREAIELINKALDLGV
FT                   NYIDTAPAYGEGGSEENIGMVMKDRRDEVTLASKTPERTYDDTMKSFEKSLKRLQTDYL
FT                   DIYQVHDIKTEAELLQVLDQGEGAIKALEELKANGDIRFIGITGHKRPKPMLKGIKEYD
FT                   FDTVLHALNPGDIHYNSFKTEFLEEAVNRQLGIIAMKVTAVGKIFANNKSISMGQILNY
FT                   VWSHPISTAIIGISNLKELEENVNLAQNFTPYTTEQIKDLEEKTASNQRQVNFFKYEW"
FT   gene            593634..593978
FT                   /pseudo
FT                   /locus_tag="Nther_0565"
FT   gene            593980..594438
FT                   /locus_tag="Nther_0566"
FT   CDS_pept        593980..594438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0566"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ctc:CTC01168 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84161"
FT                   /db_xref="GOA:B2A6E7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E7"
FT                   /protein_id="ACB84161.1"
FT                   /translation="MGADMNIEIKTFDELTLQELYAVIKARIQVFVVEQNCPYMECDDL
FT                   DQMAYHCFIQSSGNVVAYARVIPPGYKFQEASMGRLLTIERVRGTGLGLELMEQVMSFM
FT                   CRQKNWQEIRIEAQKYLESFYKKFHFRTVSDTFILDGIEHIEMLYQKG"
FT   gene            594512..595183
FT                   /locus_tag="Nther_0567"
FT   CDS_pept        594512..595183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0567"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   bld:BLi00631 YoqW"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84162"
FT                   /db_xref="GOA:B2A6E8"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6E8"
FT                   /protein_id="ACB84162.1"
FT                   /translation="MCGRFTLTIDLKEIIENYGFEISYVSQIASNYTPRFNIAPSQAVL
FT                   AIAAGQKQNRLGYINWGLKAFPKGSPIINARAETLREKKSFAKLVDQRRCLILADGFFE
FT                   WKKTHQGKEPYYIYLQGKKFFSMAALWNRWKQNGEEYTGCVIITQQAPNYSNLTEIHSR
FT                   MPLLLTEQGEKEWLYSSNIVLSEIVSESQALMTQKADWHKVSTAVNSYKNDFPEVVEPV
FT                   S"
FT   gene            complement(595244..595906)
FT                   /locus_tag="Nther_0568"
FT   CDS_pept        complement(595244..595906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0568"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cch:Cag_0125 hydroxyacylglutathione hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84163"
FT                   /db_xref="GOA:B2A6N0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N0"
FT                   /protein_id="ACB84163.1"
FT                   /translation="MTIEQFKCPHRAKNFSYVISSPSSNKIAIVDPSFCDELLATKLTE
FT                   AQYDVQYIINTHAHFDHTWGNDTLKNIFPKAKLIAHTNTKYKPNASSVDIAVEDGESIW
FT                   LDQLEIKILHTPGHTPEDICLLVNNSLITGDTLFVGKVGGTRDRETAKTQFESLKKLMQ
FT                   LPQDTKIYPGHNYGPSPSSTIQAEKEANPFCLRLDNFENFYWLKENWKTFKEKHNLD"
FT   gene            596057..596827
FT                   /locus_tag="Nther_0569"
FT   CDS_pept        596057..596827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0569"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dsy:DSY1441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84164"
FT                   /db_xref="GOA:B2A6N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N1"
FT                   /protein_id="ACB84164.1"
FT                   /translation="MNVLETVNLTKKYGSFYAVKDVNFQVSSGEIFGFLGPNGAGKTTT
FT                   INMLTGLLQPTTGKVYLDGQQFDSRSVESKRVFGYAPDEPVLYEKLTLSEFLDFIIRIY
FT                   DLDYQAATTRAEELLELFELANSSYKLLGSFSRGMKQKASLVASLLPDPKIIILDEPTS
FT                   GLDPRSVKRLKDLLTREAQRGKAVFMSTHILEIAEKMSHRIGIIQHGELKALGTMDELY
FT                   SQKNQTPHSSQEDETNLEQLFLELTGGDEHEYLE"
FT   gene            596811..598520
FT                   /locus_tag="Nther_0570"
FT   CDS_pept        596811..598520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2453 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84165"
FT                   /db_xref="GOA:B2A6N2"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N2"
FT                   /protein_id="ACB84165.1"
FT                   /translation="MSIWNELVFLLKHQFNLTKKDFLIKDDHKSNNSFWLSIVAFGFIA
FT                   LLLLRLSSSIFSGIRFLFETEEQWDAGLMPILETHILATTAVLVFFFLMLNGIRIVFEN
FT                   YFESRDVQILLTLPLSVQAIFASKFLQSFCINVVQIIPFIGTIWLGYGLAVGAGILYLP
FT                   IILFVLICGGLIFTAVATILLLVIARFVPSVVMKQAITICSFAMAFIIFVGWQYFVQIA
FT                   EVEITPEGILTISQNMQAYLELELPHLWMARSLMFPLAEFDVTIWESLIPLAVTAILGF
FT                   LMSVFIAEKVFLTGWSKSMDVQAGSRGKFSRKNGGIFSRLINHLSLPAISPVVKKDLLL
FT                   LKRTPFMWYNILIIVAMLGILAVNFPQEGQTHHPGIFNLEASLNLLLIGLFGTQAGGSV
FT                   AGIAFSAEGKALWNLQTAPISKHRLYFWKLSFGLIINLAIMKIAYLIFYLIPNLTVYPW
FT                   YLSLPLLFGKALVITSVILYLDIENPKFENGDKLNRIGGDNKIQGEIRSIVSVLIQLVT
FT                   AAFLGLLVIIPGAFPIWWVITISLGIFVGTAVFVTRWCYLKSIDRLSNFLIG"
FT   gene            598571..600427
FT                   /locus_tag="Nther_0571"
FT   CDS_pept        598571..600427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0571"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; protein of unknown function DUF362; KEGG:
FT                   mac:MA1031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84166"
FT                   /db_xref="GOA:B2A6N3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N3"
FT                   /protein_id="ACB84166.1"
FT                   /translation="MSSKVSIAQVGCQYSDDIIAAKMKQLFFDTGLNDYIAPNKQVLIK
FT                   PNLVAVPPEDFRGAITHPLIVQKLSDIVRSLGGQVIIGDSSAVGVNTEDVISTTGYEKL
FT                   RQQGYQVIDLKQDSVVDLQVPGGGKALSQLPVAKTVKDVDLIISVPVMKTHDQVEVSLS
FT                   IKNLKGLLPDKIKKAFHNKYGLAKGVSDILATVPPVVSVLDATYALEGMGPVYGESVPM
FT                   GLILASSDPVALDSIAAGIMGLEEDELKIEGECYNRCLGELRRDKITISGDVTDIDQVA
FT                   RRFTRIKDLDYQFNVDFDLIFNEEVCTGCKNTVMSSLDDIQTQGVEPYLSGKTVYAGPL
FT                   TQGEISGSSNSILIGNCLYKHKSQGTFVPGCPPENLPVIEGLVGEGKIARRYTSENQSQ
FT                   FNHPWGIIYDLDNTLINSKINFNKMKVEVMNYLQEEQLLPEITNLEKHTAATLIQTARQ
FT                   HSTLDQEQEDGLWALITAIEAEGMDKAETEPDINEVISTLANEYTLIVLTNNSYKAAMK
FT                   ALKQFGLDEYFQLVVGREQMTSLKPSPSGAEYILEHFGDTKAEDWVMVGDSWIDAKAAQ
FT                   DASIPFLAYNCNLQELIDRDIPWEENLKHPWDIINYLDKLKN"
FT   gene            600447..601424
FT                   /locus_tag="Nther_0572"
FT   CDS_pept        600447..601424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0572"
FT                   /product="conserved hypothetical radical SAM protein"
FT                   /note="KEGG: drm:Dred_1358 conserved hypothetical radical
FT                   SAM protein; TIGRFAM: conserved hypothetical radical SAM
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84167"
FT                   /db_xref="GOA:B2A6N4"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N4"
FT                   /protein_id="ACB84167.1"
FT                   /translation="MIKNEWTGSDNRYRTYSSYLKSKYGEKVYKIPINLPGTCPNRDGV
FT                   MGEEGCIFCDEEGSGFDCLPNSMAIKEQVAKNKEYFGKRFKAKKFIVYFQAFSNTYWPL
FT                   DKFKEFLWSAAEDQDLVGISVSTRPDCINEAYLDVLEEIHHEFNLDIDVELGLQTVNYK
FT                   TLQYINRGHTLAEFLDAMWRIKQRGFSTCIHLILNLPGDSLEDIVESAKIMSAVNADQI
FT                   KIHSLYVVEGTKLGELYKKDELNIISLTEYVNRVITFLEYLSPQIVVQRLVGKGPKDKV
FT                   IFNNWDRSWWYLKEQIESELEQRNTWQGAKCDYLNGKALKRFLK"
FT   gene            601552..602991
FT                   /locus_tag="Nther_0573"
FT   CDS_pept        601552..602991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84168"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N5"
FT                   /protein_id="ACB84168.1"
FT                   /translation="MVKKLLIILSLALVMIFSVTACNNSETTDSPKDNEENIDQEEKNE
FT                   NSKDQDQNDDSDEQTEKEDEEEKDLGPEFTYPEDGVRGIYVTGHTAGGSRMEELIELVD
FT                   DTELNSMVIDVKDDYGNITFKLDGTEFDEFSKNYISDPEEMLEKLSEHDIYPIARVVVF
FT                   KDTVLAEEQPEYSFRRSDGSVWKNSGGEAFVNPYKEEVWDYNLKIAEKAAEMGFQEIQF
FT                   DYVRFPEGHGSRADELEYSLGNYTEEELTPRIEEEWEEMLEEQASDNPDFTEYNIDEED
FT                   VVEKNEDILEDEEEIKEYKAEELKEKASPPEYEYGLARVMAVSDFTEYAYDRLQSYDVD
FT                   VSVDVFGYTVTVPESREIGQNFFSILQNVDVISSMIYPSHWGPGYFGISQPDTEPYELV
FT                   YKYTERENELLDKLEEPPISRPWIQDFTASWLGQGNYISYGVDEVEDQIRALNEQGVEE
FT                   FLLWNASNRYTKGVDYKPLED"
FT   sig_peptide     601552..601617
FT                   /locus_tag="Nther_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.830 at
FT                   residue 22"
FT   gene            complement(603084..604082)
FT                   /locus_tag="Nther_0574"
FT   CDS_pept        complement(603084..604082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0574"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: amt:Amet_1200 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84169"
FT                   /db_xref="GOA:B2A6N6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N6"
FT                   /protein_id="ACB84169.1"
FT                   /translation="MTSSNKPIIFSGAQPSGSMTLGNYIGAVQNWKEMEQDYQCIFSIV
FT                   DLHSLTVRQDPKQFKKTVLSFLAQYLACGLDPNNSIIFFQSHVKEHSELSWILGCNTYL
FT                   GELNRMTQFKEKSERHADNVNAGLYTYPILMAADILLYQTDLVPVGEDQKQHLELARDI
FT                   AERFNGAYGNAFKVPEIHIPKIGARIMSLQEPEKKMSKSDENEKGVLFLLDEENVIRKK
FT                   IKRAVTDNENQIAYNDSQPGIKNLITIYSKLKPCTVEEVVEEYADQGYGTFKKDVADLV
FT                   VDRLQPVKDEYNKYMENKDYLEDVYHEGARKAAEIAADTMEKVKDKLGLVN"
FT   gene            complement(604110..604601)
FT                   /locus_tag="Nther_0575"
FT   CDS_pept        complement(604110..604601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0575"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: deb:DehaBAV1_0617
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84170"
FT                   /db_xref="GOA:B2A6N7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N7"
FT                   /protein_id="ACB84170.1"
FT                   /translation="MSLELLFQRRSIRSYQDRPVEDDKIKKLIEAGMAAPSARNIRPWH
FT                   FVVIKDREILNKITDIHPYSSMLREAPMAIAVCGKHSEPYWVQDCSAAMQNILLAATAQ
FT                   GLGSVWLGIYPREDRTQEVKDLLDLPEEISPLGVTAIGYPNETKPQKEMYEEDKVTVIE
FT                   "
FT   gene            604770..605825
FT                   /locus_tag="Nther_0576"
FT   CDS_pept        604770..605825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0576"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: amr:AM1_4001
FT                   oxidoreductase, aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84171"
FT                   /db_xref="GOA:B2A6N8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N8"
FT                   /protein_id="ACB84171.1"
FT                   /translation="MTISRRTFLKIGGVVIAGSVIYVINSEIFPEKDQDSSPHYNNLKD
FT                   NEDSVKLNADKNKDPNPANKEHQNMIPRRKLGKTERSVSLLGLGGGGILAQEGNESQEE
FT                   IQELIQKAVDNGINFIDTAPTYGPSEENIGTALEGLAIDRSELFIATKTLSRSYDETMK
FT                   LVEESLNRLKTDYIDLYQIHGINGQEDLEEAFSQDGSIQALEKLKQEGVIKSTGVSGHR
FT                   EPRVLMDALEEYDFDCIMMPLNAGDIHDRPFQTKLLNKARDRNMGIIAMKVMAYGNIFN
FT                   EEGIRKAEQALSYTCSFPISTAIIGISQINQLEDNIQILKNFSPLENHDLEKLEQLTEH
FT                   YQDKINHFRDW"
FT   gene            complement(605834..606268)
FT                   /locus_tag="Nther_0577"
FT   CDS_pept        complement(605834..606268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0577"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU0538
FT                   heat shock protein, HSP20 family"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84172"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6N9"
FT                   /protein_id="ACB84172.1"
FT                   /translation="MVRYADSGKNLFNWTPGFGVLNPPAEELVKTGFGGADIYKKDREL
FT                   NFDIVLPGLNKEDINVRVENNYLVVKGELKKSEQVEQENYLMVERQSGLFQRNYPIPEE
FT                   VDMGSLNHITATYDKGILNVKLPLKNEPNSHGDSHEIDIE"
FT   gene            606448..606849
FT                   /locus_tag="Nther_0578"
FT   CDS_pept        606448..606849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0578"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; KEGG:
FT                   mst:Msp_1119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84173"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P0"
FT                   /protein_id="ACB84173.1"
FT                   /translation="MNQYNFYLIVYQISDSINLTIGKLGDFELPKGYYLYIGRDKRNIR
FT                   SRVSRHIAHKKKLRWHIDYLSQNATPILMRLLPYRLDELSECDIAEKFIQQGAQVIVPG
FT                   FGASDCNCFSHLLHFENFQDLTRLIDEMF"
FT   gene            606836..607480
FT                   /locus_tag="Nther_0579"
FT   CDS_pept        606836..607480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0579"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: vvy:VV2073 predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84174"
FT                   /db_xref="GOA:B2A6P1"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P1"
FT                   /protein_id="ACB84174.1"
FT                   /translation="MKCFNSRSKIMLGKGGNIMSSQQRFKQQLNFLAEIDSLKEIYRKT
FT                   KLNTGDRFENDAEHSWELAMMAVVLQEYAEEELDLSRVIKMLLIHDLVEIDAGDTFVYD
FT                   EEAVQDQEEREQAAAERIFGLLPSDQEQELRTLWYEFEEEQTAEARFALALDRMQPIIH
FT                   NFYNQGGTWQEFSINREQVEEKNKKIDFGSSQLWKFTQEILDTAQKQGYLD"
FT   gene            607494..608303
FT                   /locus_tag="Nther_0580"
FT   CDS_pept        607494..608303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0580"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   cth:Cthe_2176 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84175"
FT                   /db_xref="GOA:B2A6P2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P2"
FT                   /protein_id="ACB84175.1"
FT                   /translation="MRFVRLSAIILFVIAVYFLSNVLSGLLMGFYYAVLAEETSSMAQI
FT                   NLYITENILLSMTIASIIGIIIYLVYLSVRGDRPGEFLEFNPTNVPIVVMSLVLGAGVA
FT                   LFLNSIFAAIEIERFFGEEMEMLQDVIDRGGLGIRFLSVGIVIPIFEEVMYRGMIFNDL
FT                   KRNLNMNLAILIQAIIFGILHANLYQFVYVVPAGILLALVYQWTATLLAPILIHISWNS
FT                   MSLVMNEYFPGEILAFVNYGLIVVGFLLILVSTTFIKNQPRRNKYIF"
FT   sig_peptide     607494..607568
FT                   /locus_tag="Nther_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.624 at
FT                   residue 25"
FT   gene            complement(608311..608727)
FT                   /locus_tag="Nther_0581"
FT   CDS_pept        complement(608311..608727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84176"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P3"
FT                   /protein_id="ACB84176.1"
FT                   /translation="MWQVAHKVQDSSPVYFKECISRTGHITLVVISENPFRLQLFPNTF
FT                   MEELYYRPDTNNNSMNHDNHVNLDQEQVYDALISTDNMERAIDLGEQELAVWGDNNLDY
FT                   RKLRSILSDVIIDPEVDSIIDLTVNITRKHNFGQ"
FT   gene            608803..610314
FT                   /locus_tag="Nther_0582"
FT   CDS_pept        608803..610314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0582"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: drm:Dred_0365 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84177"
FT                   /db_xref="GOA:B2A6P4"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P4"
FT                   /protein_id="ACB84177.1"
FT                   /translation="MLFFQGGKNIKKQNKFSNQYDLVVIGGGPGGTACALKAARLGLTT
FT                   ALIEKDFPGGGSVARGYFPVKALIEAAKLKENKLAPNEECLAKANERVNKARAQWDSSL
FT                   TKRFEQLYLIPGEGELLSSTSEFYQIKIHSSKYQGEIQDPNIIDGDRYISAKSIVMATG
FT                   TAPGSPIPELTIDGKNVITHEHLLDMHYNNINSIAIIGADVEGCEFAGLFNRLGIQVHL
FT                   LEMEDNILPNCDQEISNSLSTEYKKQGIKIKTNTQVTGVQNLEGEALKLTYNSNTPQAH
FT                   GDYYSSKTENESDKSLEVDKILVTGKRIPQLPKGYANLPLKITQEGLVEVNSQLESSAP
FT                   EVYVIGDLAGGVPSANAAIHEGKLVSQNLTEPRKNKHINYSFTPYVFFTDPQTSGIGVT
FT                   EDYLRNKKIPYKKGIAYFKENLRTLSLGHDNGFVKVLLGKNESLLGVHMIGHDISELIS
FT                   VITVAMQSKIPASKIVDLPLPHPSMGELMIEAIEEAINTRITTTG"
FT   gene            610423..610908
FT                   /locus_tag="Nther_0583"
FT   CDS_pept        610423..610908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0583"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: aoe:Clos_0687
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84178"
FT                   /db_xref="GOA:B2A6P5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P5"
FT                   /protein_id="ACB84178.1"
FT                   /translation="MKKELELLKQAAINEQEGYEFYMMAAQNSDNQESQEALNELAQEE
FT                   KQHKEWILELYEKFEQGSADSFDFDQVTAPSPELFRWENLPLDNTSKALSVFSIGVKME
FT                   YAAVEFYKDAKEKTDDPNVEKLLDILIDWERQHLNDFQKRYDELQKEWWDEQRFSPS"
FT   gene            611364..612791
FT                   /locus_tag="Nther_0584"
FT   CDS_pept        611364..612791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0584"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: swo:Swol_1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84179"
FT                   /db_xref="GOA:B2A0J9"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B2A0J9"
FT                   /protein_id="ACB84179.1"
FT                   /translation="MTVTNKGMKCRQLLTGESCKEGSPQKNSAEHEGYAGVHSSLRITE
FT                   NNISNANLSKGNLLEEILDRDNMNKAFKKIKSNKGSHGIDGMGVDELLQYLKENGDHLR
FT                   QRVLDGKYRPNPVRRVEIPKEDGKKRKLGIPTVVDRVIQQAIAQVLSPIYEEQFSDNSY
FT                   GFRPGRSTHDAIKKSQQNINEGYKYVVDMDLEKYFDTVNQSKLIEVLSKTIKDGRVISL
FT                   INKYLRAGVMIKHTYKDTEVGVPQGGPLSPILSNIMLHELDKELEKRGHEFVRYADDLL
FT                   IFCKSRRSAGRTLKNILPFIENKLFLKVNKDKTVVAYVGKVRFLGFGFYRHKGKARLRV
FT                   HLKSVTKMRTRIKELTSRSYGISNEARAKKLSRYIMGWVNYFKPADMKNLLINTDSWMR
FT                   RRIRMIYWKQWKKVRTKFKMLKFFGANKYKAWEYANTRKGYWRISNSPVLSKSLGNDVI
FT                   KGFGFLFFSEYYRQVKA"
FT   gene            complement(612975..613355)
FT                   /locus_tag="Nther_0585"
FT   CDS_pept        complement(612975..613355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2635 heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84180"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P7"
FT                   /protein_id="ACB84180.1"
FT                   /translation="MFTNYNHNPNSKPNFNDNETTHEFRATLESIVNNFDNELVKSDDF
FT                   HKDAYEYNGYLVIELELPGIKNANISIANNTMYLTGEWDKDDPIQTGLPLPSIVDTNRS
FT                   DQISWEHCNEILRVYLPLSYSD"
FT   gene            613462..614214
FT                   /locus_tag="Nther_0586"
FT   CDS_pept        613462..614214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0586"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pab:PAB0163 NADH oxidase
FT                   (NoxC)"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84181"
FT                   /db_xref="GOA:B2A6P8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P8"
FT                   /protein_id="ACB84181.1"
FT                   /translation="MQGNVLSRSGLLVLGLTILLIGGLTACQTKESQDRNTEENFNNDN
FT                   NIIELSSPNIEGDLTIEEAIEERRSVRSYQEEGLSEQELSQLLWAAQGITDKNRNYRAA
FT                   PSAGATFPMEIFVLVEQVEGLASGVYHYLPEKHSLKVLKSEDEDKSEELSQELMKAALG
FT                   QDSIGEAPVNIIIAAVYDRVTAEYGEVGYRYGKMEAGHISQNIYLQSQGLDLGTVAIGA
FT                   FHQDSVSNILELSQDTEPLYIMPVGKLD"
FT   sig_peptide     613462..613542
FT                   /locus_tag="Nther_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.815 at
FT                   residue 27"
FT   gene            614297..615598
FT                   /locus_tag="Nther_0587"
FT   CDS_pept        614297..615598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0587"
FT                   /product="acetyltransferase involved in intracellular
FT                   survival and related acetyltransferase-like protein"
FT                   /note="KEGG: oih:OB0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84182"
FT                   /db_xref="GOA:B2A6P9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6P9"
FT                   /protein_id="ACB84182.1"
FT                   /translation="MAINNNVSYKALTDDLELEYKNHQGYAFTPEDGPQPEGPKYPDRW
FT                   RGPAIGEKRGIFQNEQLVSVGRLLPTEISIGGNYVPAGGIADVATMPENRGKGFFKQLF
FT                   SGFIQEMRDRGLCLSILWPSSYHIYSKLGYSTAGSKIVYDMNFNSFSLSSNIKLTEKKL
FT                   EFVPIERGQEHDSLKEVYRRNTKKFNLSINRDSNWWDAFVTTQSKVSSGKPAYVYAVID
FT                   PNDNPEDYKGYLIYDFDTVPSVNSQGQPANITKMRIRELVYDNFEVYSAILKFISGHSL
FT                   QAEQLSIEGITDQYFTDKIMAPEALSCQIESGPMVKIVDVVSALSYLEPPKNLTGKLNL
FT                   QIEDKFTPDNSGIYMIEVEEGNISVNSEPTTTSMENPDFIMDINSLSQIYAGYIQPYQL
FT                   VQEQRITPGNSDPEKLTLLNRIFPSHPIFPLEYF"
FT   gene            615717..615983
FT                   /locus_tag="Nther_0588"
FT   CDS_pept        615717..615983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84183"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q0"
FT                   /protein_id="ACB84183.1"
FT                   /translation="MSVKFIRDVLITYEGESFQQKRGKQFTYKVKGNSIVPDTTKYPIP
FT                   IKDIIKGLNRGQVTRVADLKDLRGSSYIYALVTDKRIKDNIKC"
FT   gene            complement(616178..616846)
FT                   /locus_tag="Nther_0589"
FT   CDS_pept        complement(616178..616846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0589"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   fre:Franean1_5082 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84184"
FT                   /db_xref="GOA:B2A6Q1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q1"
FT                   /protein_id="ACB84184.1"
FT                   /translation="MGLASLFPLTTLMFLNFFTDNPSSGQMAHIITGNMMFALVITGLN
FT                   VVAQNISQQKHQGHFTFYASLPISKINFILANLARGAMTSLPSFCILFVIGRLVYDVDF
FT                   YMTWALFPATFLIIMSVVGIGAYIGFWSPNQQLTSMLVQALMMLISFLTPVMVRIEDLP
FT                   SLLQLISRLLPTTYAAETLRILLISGLTQEVLFNAAILLVFTCCFYILILNNLDWRIEE
FT                   "
FT   gene            complement(616886..617059)
FT                   /locus_tag="Nther_0590"
FT   CDS_pept        complement(616886..617059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84185"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q2"
FT                   /protein_id="ACB84185.1"
FT                   /translation="MVNNTRGFTYKSAGSDSYSESYPGSVSDFYHKDQDDIEEIMETNN
FT                   LRQLIVELWYLL"
FT   gene            complement(617052..618017)
FT                   /locus_tag="Nther_0591"
FT   CDS_pept        complement(617052..618017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0591"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO2061 ABC transport ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84186"
FT                   /db_xref="GOA:B2A6Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q3"
FT                   /protein_id="ACB84186.1"
FT                   /translation="MQDSLFEIDNVTKIYKKKDKQVTANLDINCSIRSGEIIGLLGPNG
FT                   AGKSTLVKQMLAHIQPTKGEIRYRGQNVLKNSHKLAQEISYYSQEPSCLTPLQVREAIY
FT                   FTGRLRGLKHEPANKKTEELISELELTDVKDNKIKEISGGQRRLTGMGITLIGRPSVLI
FT                   LDEPTNELDPEKRKLVWKIIREKNKQDTTVILVTHNILEAEQVVDRVAVINNGKLQDID
FT                   TVDKLKQRVDQRLKCQVSTESGANDSIGELLDSWGTIISNTETKVDLLIDKEKASSLVK
FT                   FLTNNEQDLPIENFSIIPPSLEDVYFQIHDRYKREELQDG"
FT   gene            618268..619536
FT                   /locus_tag="Nther_0592"
FT   CDS_pept        618268..619536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ter:Tery_1776 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84187"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q4"
FT                   /protein_id="ACB84187.1"
FT                   /translation="MRADQAYREAIRYYGGHQYISKLRGKYDNVRLFWEDYTTGYYLKP
FT                   YLRRMVSEKQELGQGLRVCELGCGAGDGYDFLTRLSRERVLDQADTKVISNQDLAFYKG
FT                   VDLNNDLITEANNRFQDHSKVKFTQGDISQGLPVESGEFPYDLYFTAYATLSHCNDQEL
FT                   EKLFSDIAVHGRNGSIIVGDWLGRYSYEWQSLWTQHPENKPFVSYKLNFYSDQAKNVST
FT                   FPMRVMTPEEITEIVDRVSERTGIKLKIKKIFDRSLFVGRHIETGDYNDYPQPLRSMVN
FT                   SLHEPGHRTYLPNLLVDYITRPGYTWQNNRLKDLEKSWNSLIRYTIKLLQAIADRNKQQ
FT                   PGDDIIGENIQLPDPPDTNSSALRQAYQVIRRTIENSYYFYGDVRADIIENQLGCCLRN
FT                   LEMKYQQGEGLGHSIVSIIQVIK"
FT   gene            619682..620248
FT                   /locus_tag="Nther_0593"
FT   CDS_pept        619682..620248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dsy:DSY4928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84188"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q5"
FT                   /protein_id="ACB84188.1"
FT                   /translation="MSEFNDSVINNSRDIMLELLYEANLDDGEIIVIGCSTSEVMGEKI
FT                   GSSSSWEIAESIYEGIISAINSYLTDYQKQLFLAFQCCEHLNRALLIEEKCLQQYNFEQ
FT                   VTVVPSPKAGGSLPSVAYTRFDSPVMIERITAHAGLDIGDTFIGMHLKPVAVPVRPSIQ
FT                   NIGSAHVTMAKTRPRLIGGNRAIYK"
FT   gene            620445..620801
FT                   /locus_tag="Nther_0594"
FT   CDS_pept        620445..620801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84189"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q6"
FT                   /protein_id="ACB84189.1"
FT                   /translation="MLLKLKEVEKTLEDTLAKLRQTGKISEQIESELNYVLDFAMANLI
FT                   TENAEEGFKIRPELINEYPEGVHYLQDPFPDYLKEMKQILNVDQPDSQNVLYFGTEILQ
FT                   RLKSFSKVSSPSTF"
FT   gene            621130..621642
FT                   /locus_tag="Nther_0595"
FT   CDS_pept        621130..621642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0595"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: cpe:CPE1401 probable DNA
FT                   polymerase III epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84190"
FT                   /db_xref="GOA:B2A6Q7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q7"
FT                   /protein_id="ACB84190.1"
FT                   /translation="MEAGEIIEKQHWYIRPKPFYFHPYNVYIHGIKPEDVRDEPDFSEI
FT                   WREISTYLENNLVVAHNASFDISVLRHVLDLYDLDYPQFDYLCTKKLAEKQWPHLDKYG
FT                   LKSIAKFLDVKFKHHDAMEDAYACAQIAVSACKSQNVDCLYSLARELRLGLGKVYQGGY
FT                   RPARIRS"
FT   gene            621674..621985
FT                   /locus_tag="Nther_0596"
FT   CDS_pept        621674..621985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mta:Moth_1616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84191"
FT                   /db_xref="GOA:B2A6Q8"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q8"
FT                   /protein_id="ACB84191.1"
FT                   /translation="MAIFFVVISLTISLVGAYICYQRISVSTIFRTGFYFFVLLGMSEL
FT                   FSYTPSILMMTGAINNYLDPSQFGYFSSFIQLASRVFFWASMITLLIGLYKYLPQNNN"
FT   gene            622035..622577
FT                   /locus_tag="Nther_0597"
FT   CDS_pept        622035..622577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0597"
FT                   /product="putative sporulation protein YtaF"
FT                   /note="KEGG: cpr:CPR_2044 putative sporulation protein
FT                   YtaF"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84192"
FT                   /db_xref="GOA:B2A6Q9"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6Q9"
FT                   /protein_id="ACB84192.1"
FT                   /translation="MELLSILMLVISSNLDDLGVGFSIGIQKRIPVPIILVIASISGLT
FT                   MALGIGMGVQLLNFIPRGINDLIGALVFLGLGIYFVVNGLRNQENDENRPIKFTLSMAI
FT                   ILGLTLGINSLALGVSAGITGYPLLPTSIAAFLVSFIFLFLGSVFGGALQPILKKSDII
FT                   SGILLVFLAFAILLTPL"
FT   gene            622605..623411
FT                   /locus_tag="Nther_0598"
FT   CDS_pept        622605..623411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0598"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: amt:Amet_1426 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84193"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R0"
FT                   /protein_id="ACB84193.1"
FT                   /translation="MKTSIQRSKLRLLLGKFYYQIKRYLEWYLSTTKWASMYKDKLLKY
FT                   SVFQHKTPLLRKLSQVEMWMQYNKITNLEIATKRLNKIIIKPGETFSYWRLIGRPTRTK
FT                   GYLEGMVLYNGKVESGVGGGLCQLSNLIYWMTLHTPLTVTERYRHSYDVFPDSNRTVPF
FT                   GSGATCAYNYIDLQIYNGTKQTYQLLVYLTDDYLVGEWRSDNEPCHTYEVYQGDHWITH
FT                   EPGIGYVRHNTIYRKVYNLKGEDIDDEFVTENHAIMMYQPYLEQGD"
FT   gene            623563..623865
FT                   /locus_tag="Nther_0599"
FT   CDS_pept        623563..623865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84194"
FT                   /db_xref="GOA:B2A6R1"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R1"
FT                   /protein_id="ACB84194.1"
FT                   /translation="MLPIQYFGWIIIALALLRLKNKAYLKDKWRLAFSMFTGLYSLGEL
FT                   FAYYNIHNFINFCYLLSAASFLIPFLKFDFDKKLDIEKIGDTALILGVGIIVLTS"
FT   gene            624022..625776
FT                   /locus_tag="Nther_0600"
FT   CDS_pept        624022..625776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0600"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: amt:Amet_3467
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84195"
FT                   /db_xref="GOA:B2A6R2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R2"
FT                   /protein_id="ACB84195.1"
FT                   /translation="MEKIEVSKKELEKKLFDRNYTKYGLDLNPVVSFGSGIFIILFSLY
FT                   ALLDLDRANQVFQFVNETIVTRFDWVFIMSSNFFILVCLYLAFSKLGNVKIGGLNSEPE
FT                   FSNFAWYSMLISAGMGIGLMFWAVGEPLHHFMEAPPIFTSTSADKAALATTFFHWGLHP
FT                   WGVYALLALALAFFAYNRKLPLSLRSVFYPLFKEKVYGTLGDVIDTFAVLSTLFGLATS
FT                   LGLGIKQINSGLDYLFGIGFNVQMQVTLIAIITLLATISVISGIHKGVRFLSELNIRLA
FT                   FIFMIAIFLLGPTTYILRLFSNSVGLYFSNIVEYASFINIDGGSWQGDWSIFYLAWWIS
FT                   WSPFVGMFIARISRGRTIREFILGVLIVPSLLSFFWLSVFGGTSIFLDGQAGGALFETV
FT                   QDDYPVALFEMIDLLPMPFLAGALRVLMFILVIALVSSYFVTSSDSGSLVVDKITSSGK
FT                   INTPKKQRVFWACLEGLVAATLLLIGGEKALDTLQTAVISAGLPLAFILTVMAISLIKG
FT                   ITVTHKKQKKIRDKRKFEELFEDLEEEREQDQEQGEGQHTSETETAVKKTDHQAEPEVS
FT                   PNVTPPQD"
FT   gene            complement(625777..626016)
FT                   /locus_tag="Nther_0601"
FT   CDS_pept        complement(625777..626016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84196"
FT                   /db_xref="GOA:B2A6R3"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R3"
FT                   /protein_id="ACB84196.1"
FT                   /translation="MFLIWAILILVAAIQIPRMIKKKQFNTLKVYIPLWLFAGIYASLV
FT                   VAGAPIPNVTDIILVIQEFIITNVLEPFGFNFLS"
FT   gene            complement(626085..627344)
FT                   /locus_tag="Nther_0602"
FT   CDS_pept        complement(626085..627344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0602"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="TIGRFAM: germination protein, Ger(x)C family; PFAM:
FT                   spore germination B3 GerAC family protein; KEGG:
FT                   pth:PTH_1838 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84197"
FT                   /db_xref="GOA:B2A6R4"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R4"
FT                   /protein_id="ACB84197.1"
FT                   /translation="MKLINNNLSKQNKKSSKLVILMTIITVIPLIITGCWDRNEPENRA
FT                   FVLATGFDYDEDQDLYEITVQVADPTGIEGGNGLGGGGGNDGPNVGVMSAKGRTPYHAA
FT                   KNLQLHMTREPFFTHNKLLIISEDLARRGIGPVLDYFDRERETRLIAFPAILPEEHDIT
FT                   QLFRTELPFETYIGEGIERQIILSVFERSVFPSRSLIESFNVLSMPGRETVIGKIDLGD
FT                   QEEEDILGEEDVVRGTTRLEGGAVFKGDQMQGWFDIEETRGWFWIHGNVDNAIKVINCP
FT                   VHDTHPISIEIFESESHVNPIITEEGDYQIDIKISADGRIQDQTCPQGYEEEGELIDSI
FT                   ENRTATAIKNEIKSSIERAHQHESDVFGFGNVFYRKKPDVWDGIKHEWQEEIFTDLAVN
FT                   VDVEFELRRAGLVTDPLIRD"
FT   sig_peptide     complement(627240..627344)
FT                   /locus_tag="Nther_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.615 at
FT                   residue 35"
FT   gene            complement(627360..628451)
FT                   /locus_tag="Nther_0603"
FT   CDS_pept        complement(627360..628451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0603"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: bcz:pE33L466_0136 spore
FT                   germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84198"
FT                   /db_xref="GOA:B2A6R5"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R5"
FT                   /protein_id="ACB84198.1"
FT                   /translation="MLQEKIANRQLLFMIFLVRATIAIAFLPVLTTGNAGQDAWLATII
FT                   MTFTTVALIFLVVGLGIKFPEQTIVEYSQDLLGKYPGKLITLLILWFFLHMAATEVRIY
FT                   GELLNIAFLPRTPLVFVIGAMVFLAAITVYIGVEVLGRMADLLFPFYIFLIGISILLPL
FT                   PELVPENFEPVLAGGLTQVMSSALTPTAIGSQVLVVTILLPRVVEPKKGIKTIIVAFTA
FT                   ANLLVLLISIAVIGKLGSVEGAKAVFPFLLTIRALELSEYIERLEIFAVLAWGMGIYIS
FT                   LSVYLYCGAKGLSQWFGLRDYRPLTFPMAIVWVVMAMHSFESIFQIRNFFAPEVFFPYA
FT                   MTGFLPFILLWVSYVFKKLTKSN"
FT   gene            complement(628462..630066)
FT                   /locus_tag="Nther_0604"
FT   CDS_pept        complement(628462..630066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0604"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   gka:GK1624 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84199"
FT                   /db_xref="GOA:B2A6R6"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R6"
FT                   /protein_id="ACB84199.1"
FT                   /translation="MNLEDRSQFIKEKTLDKKIYTNLDQIKSYLGSSYDLQIKQFVIGH
FT                   KEIQGAAVFLSGLEDPRAIERIIGDLTSELHKANLTPENPKEAFNIAHRKILSNEDMLP
FT                   TDNFADIFNKILIGETAILIDGVSQAILCDTKEWETRGIEEPEAEKTIRGPREGFIESL
FT                   RVNTGLVRRRIRSPNLWMEKVTVGQEAGNEVAFAYLKGLAHEDLINEVRHRLENIDLDG
FT                   VLESGYVEEMIEDTPFTLFPLTHRTERVDIVSSAILEGKVAIFTDGTPFVMIVPIKFLE
FT                   LLQAPDDYHEKFPVGTLIRLGRHIGFLFSIFFPGAYVAVINFHPELLPTSLMLQITAAR
FT                   QGVPFPAAMEVLLMEFLFELLREAGLRLPGMIGPALGIVGALILGDAAIGAGLVSPAVV
FT                   VVVALTAISSFIVPAYSLAIAGRITRFIAVLFGSAFGLFGIQFVFLLLGLHLCSLRSFG
FT                   YPYMAPVGPLIKSDWKDAILRVPWPLQKTRPKLEGGKDPSKQKTQFPSPPQGLETSEDQ
FT                   DHEEQPEVENDSDSKDS"
FT   gene            630442..631884
FT                   /locus_tag="Nther_0605"
FT   CDS_pept        630442..631884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0605"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="PFAM: glucose-inhibited division protein A; KEGG:
FT                   drm:Dred_1583 glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84200"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6R9"
FT                   /protein_id="ACB84200.1"
FT                   /translation="MKKYDVIVVGAGPTGIFTCYELIEQNPSLNILLVEKGRDIYRRSC
FT                   PILENKVSKCPHATKKQDIASCYPNCSITNGFGGAGAYSDGKFNITTEFGGWLTDYMSP
FT                   SQVLELIKYVDEINVSHGAKSQVSDPTTSEVKNIEKRGLAAGLKLLRAKVKHLGTEQNF
FT                   QILTDIFDNLQTKVDMVFETEVADFITKSNNQQDSSSYEIHGLLTEDNEEYYADKIVIA
FT                   PGRDGSEWLTKILQRYDQEVSSNQVDIGVRVETLDTIMEEINKNLYEGKFLYRTSVGTT
FT                   VRSFCNNPSGHVVIENHSGVMLANGHAYKDKNRGSNNTNFALLVSHKFSYPFNKPVEYA
FT                   KSISKLANDLSEGSVLIQSYGDVMKGRRSTDKRIDECFIEPTLKEAVPGNLGLVLPYST
FT                   MISIIEMIEALDVVTPGIASDHTLLYGVEAKFYSSRPLLNNNFETGIKNLYVGGDGAGI
FT                   TRGLAQASACGVAIARDIVKRL"
FT   gene            632029..632631
FT                   /locus_tag="Nther_0606"
FT   CDS_pept        632029..632631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0606"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: iho:Igni_1207
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84201"
FT                   /db_xref="GOA:B2A6S0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6S0"
FT                   /protein_id="ACB84201.1"
FT                   /translation="MGSPRHINIEDCALLIVNMQNDFLDKITSFECPRCREIVPNLQKF
FT                   KHDMKFFRVPVIYTKELHRPGMVDYGKELSKEGEEHCIEGTKGAEIVSELTPDEDDHVI
FT                   LKRRHSGFYATDLEILLRGLKKNTIILAGVPTNICYYATALDAHQLNFNIIAVPDCTAP
FT                   SKGVDKEPFLRSIEKVVGEVMSSQEIKERFHMMVEEP"
FT   gene            632876..633418
FT                   /locus_tag="Nther_0607"
FT   CDS_pept        632876..633418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84202"
FT                   /db_xref="GOA:B2A6S1"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6S1"
FT                   /protein_id="ACB84202.1"
FT                   /translation="MNQGQRINVRQLVYMGLLVGIGTLLMVTVQIPVFTEYLMYDPSDV
FT                   AMLIGGFWFGPLAGIVMSFFKALLYLFSKGLAGPIGAMANFFATAAFVGVAAFIYQRDR
FT                   TFRGAVKGMIMGTLAMVILSGFTNYFIALPLWGIPQEALLPTILAATTPFNIFRGTVNS
FT                   ILTIFVYKRVKKLLQSL"
FT   gene            complement(633491..634963)
FT                   /locus_tag="Nther_0608"
FT   CDS_pept        complement(633491..634963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0608"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: mem:Memar_0160
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84203"
FT                   /db_xref="GOA:B2A6S2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6S2"
FT                   /protein_id="ACB84203.1"
FT                   /translation="MKMQTVFIVSLAITLIVLGLGIFNQPALEYYVETAYQGILEYFGW
FT                   VYMLATFFFLVFAIGLSFSRFGQIKLGADHEKPQYSYFGWFSMLFAAGMGIGLIFWGVS
FT                   EPLVHYLEPPAHIPEASGDAAGFAMRYSFFHWGLQPWAIYIIMSLSIAYFSFRRGMPPL
FT                   ISSCFYPMLGENIYKFPGYLIDILAVVATIFGVATSLGLGATQIHSGLSFLYGLPDGFN
FT                   ITLIIVIIATILYMISSVVGLDKGIQALSKLNMFIALILMVFMLIMGPTSYIFNIFTST
FT                   IGTYTNRLLEMSLDTNPFTGHEWIESWTLFYWAWWISWSPFVGLFVARISRGRTIKEFI
FT                   HGVLLVPTLMTFLWFSVFGGAGFQLQLTEGIHIAEIAQQDASLALFHLFEAFPLGSILS
FT                   SVTILLLFVFFITSADSATFVLGILSSNGTLNPSLAKKMTWGASQSGIALILLFTGGIQ
FT                   ALQQMSITAALPFSIIMVLLCYNLLSALKEEV"
FT   sig_peptide     complement(634889..634963)
FT                   /locus_tag="Nther_0608"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.310 at
FT                   residue 25"
FT   gene            complement(634988..635839)
FT                   /locus_tag="Nther_0609"
FT   CDS_pept        complement(634988..635839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0609"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mem:Memar_0161 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Nther_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACB84204"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2A6S3"
FT                   /protein_id="ACB84204.1"
FT                   /translation="MFKKALMPLTLREQQDEFLSSVSLLAKLSTNTVHLCHVIDSGFTK
FT                   YSLVSNKIKLYKNILADKFPSLNVSSEILSGHAGSKIIESAKTSESEFIYLPASQRHRL
FT                   GQLLIGSTASDVVRLSDRPVFVHKSQPIIKFEESNSEIEKENNDHNKGLFGQVIVAIDF
FT                   GPNTDRTSYSLTELGNLASTVTYLHIGKRAGDPFSESKRREHVQQQLEELKKDYQCYCH
FT                   DINTRDRIGIPSKEILKEAKQTQADLIILGKLKVKSPGEIIMGTTAERVLKGTQSSVLI
FT                   IP"
FT   gene            635976..638159
FT                   /locus_tag="Nther_0610"
FT   CDS_pept        635976..638159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Nther_0610"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: gtn:GTNG_0209
FT                   S1 RNA binding domain protein"
FT                   /db_xref=