(data stored in ACNUC28527 zone)

EMBL: CP001037

ID   CP001037; SV 1; circular; genomic DNA; STD; PRO; 8234322 BP.
XX
AC   CP001037; AAAY02000000-AAAY02000203;
XX
PR   Project:PRJNA216;
XX
DT   25-APR-2008 (Rel. 95, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Nostoc punctiforme PCC 73102 strain ATCC 29133 chromosome, complete genome.
XX
KW   .
XX
OS   Nostoc punctiforme PCC 73102
OC   Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
XX
RN   [1]
RP   1-8234322
RX   DOI; 10.1104/pp.112.213116.
RX   PUBMED; 23463784.
RA   Ekman M., Picossi S., Campbell E.L., Meeks J.C., Flores E.;
RT   "A Nostoc punctiforme Sugar Transporter Necessary to Establish a
RT   Cyanobacterium-Plant Symbiosis";
RL   Plant Physiol. 161(4):1984-1992(2013).
XX
RN   [2]
RP   1-8234322
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Meeks J.C., Elhai J.,
RA   Campbell E.L., Thiel T., Longmire J., Potts M., Atlas R.;
RT   ;
RL   Submitted (07-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8215045a78e78926595b9e61891fb8f2.
DR   BioSample; SAMN02598449.
DR   EnsemblGenomes-Gn; EBG00001181863.
DR   EnsemblGenomes-Gn; EBG00001181864.
DR   EnsemblGenomes-Gn; EBG00001181865.
DR   EnsemblGenomes-Gn; EBG00001181866.
DR   EnsemblGenomes-Gn; EBG00001181867.
DR   EnsemblGenomes-Gn; EBG00001181868.
DR   EnsemblGenomes-Gn; EBG00001181869.
DR   EnsemblGenomes-Gn; EBG00001181870.
DR   EnsemblGenomes-Gn; EBG00001181871.
DR   EnsemblGenomes-Gn; EBG00001181872.
DR   EnsemblGenomes-Gn; EBG00001181873.
DR   EnsemblGenomes-Gn; EBG00001181874.
DR   EnsemblGenomes-Gn; EBG00001181875.
DR   EnsemblGenomes-Gn; EBG00001181876.
DR   EnsemblGenomes-Gn; EBG00001181877.
DR   EnsemblGenomes-Gn; EBG00001181878.
DR   EnsemblGenomes-Gn; EBG00001181879.
DR   EnsemblGenomes-Gn; EBG00001181880.
DR   EnsemblGenomes-Gn; EBG00001181881.
DR   EnsemblGenomes-Gn; EBG00001181882.
DR   EnsemblGenomes-Gn; EBG00001181883.
DR   EnsemblGenomes-Gn; EBG00001181884.
DR   EnsemblGenomes-Gn; EBG00001181885.
DR   EnsemblGenomes-Gn; EBG00001181886.
DR   EnsemblGenomes-Gn; EBG00001181887.
DR   EnsemblGenomes-Gn; EBG00001181888.
DR   EnsemblGenomes-Gn; EBG00001181889.
DR   EnsemblGenomes-Gn; EBG00001181890.
DR   EnsemblGenomes-Gn; EBG00001181891.
DR   EnsemblGenomes-Gn; EBG00001181892.
DR   EnsemblGenomes-Gn; EBG00001181893.
DR   EnsemblGenomes-Gn; EBG00001181894.
DR   EnsemblGenomes-Gn; EBG00001181895.
DR   EnsemblGenomes-Gn; EBG00001181896.
DR   EnsemblGenomes-Gn; EBG00001181897.
DR   EnsemblGenomes-Gn; EBG00001181898.
DR   EnsemblGenomes-Gn; EBG00001181899.
DR   EnsemblGenomes-Gn; EBG00001181900.
DR   EnsemblGenomes-Gn; EBG00001181901.
DR   EnsemblGenomes-Gn; EBG00001181902.
DR   EnsemblGenomes-Gn; EBG00001181903.
DR   EnsemblGenomes-Gn; EBG00001181904.
DR   EnsemblGenomes-Gn; EBG00001181905.
DR   EnsemblGenomes-Gn; EBG00001181906.
DR   EnsemblGenomes-Gn; EBG00001181907.
DR   EnsemblGenomes-Gn; EBG00001181908.
DR   EnsemblGenomes-Gn; EBG00001181909.
DR   EnsemblGenomes-Gn; EBG00001181910.
DR   EnsemblGenomes-Gn; EBG00001181911.
DR   EnsemblGenomes-Gn; EBG00001181912.
DR   EnsemblGenomes-Gn; EBG00001181913.
DR   EnsemblGenomes-Gn; EBG00001181914.
DR   EnsemblGenomes-Gn; EBG00001181915.
DR   EnsemblGenomes-Gn; EBG00001181916.
DR   EnsemblGenomes-Gn; EBG00001181917.
DR   EnsemblGenomes-Gn; EBG00001181918.
DR   EnsemblGenomes-Gn; EBG00001181919.
DR   EnsemblGenomes-Gn; EBG00001181920.
DR   EnsemblGenomes-Gn; EBG00001181921.
DR   EnsemblGenomes-Gn; EBG00001181922.
DR   EnsemblGenomes-Gn; EBG00001181923.
DR   EnsemblGenomes-Gn; EBG00001181924.
DR   EnsemblGenomes-Gn; EBG00001181925.
DR   EnsemblGenomes-Gn; EBG00001181926.
DR   EnsemblGenomes-Gn; EBG00001181927.
DR   EnsemblGenomes-Gn; EBG00001181928.
DR   EnsemblGenomes-Gn; EBG00001181929.
DR   EnsemblGenomes-Gn; EBG00001181930.
DR   EnsemblGenomes-Gn; EBG00001181931.
DR   EnsemblGenomes-Gn; EBG00001181932.
DR   EnsemblGenomes-Gn; EBG00001181933.
DR   EnsemblGenomes-Gn; EBG00001181934.
DR   EnsemblGenomes-Gn; EBG00001181935.
DR   EnsemblGenomes-Gn; EBG00001181936.
DR   EnsemblGenomes-Gn; EBG00001181937.
DR   EnsemblGenomes-Gn; EBG00001181938.
DR   EnsemblGenomes-Gn; EBG00001181939.
DR   EnsemblGenomes-Gn; EBG00001181940.
DR   EnsemblGenomes-Gn; EBG00001181941.
DR   EnsemblGenomes-Gn; EBG00001181942.
DR   EnsemblGenomes-Gn; EBG00001181943.
DR   EnsemblGenomes-Gn; EBG00001181944.
DR   EnsemblGenomes-Gn; EBG00001181945.
DR   EnsemblGenomes-Gn; EBG00001181946.
DR   EnsemblGenomes-Gn; EBG00001181947.
DR   EnsemblGenomes-Gn; EBG00001181948.
DR   EnsemblGenomes-Gn; EBG00001181949.
DR   EnsemblGenomes-Gn; EBG00001181950.
DR   EnsemblGenomes-Gn; EBG00001181951.
DR   EnsemblGenomes-Gn; EBG00001181952.
DR   EnsemblGenomes-Gn; EBG00001181953.
DR   EnsemblGenomes-Gn; EBG00001181954.
DR   EnsemblGenomes-Gn; EBG00001181955.
DR   EnsemblGenomes-Gn; EBG00001181956.
DR   EnsemblGenomes-Gn; EBG00001181957.
DR   EnsemblGenomes-Gn; EBG00001181958.
DR   EnsemblGenomes-Gn; EBG00001181959.
DR   EnsemblGenomes-Gn; EBG00001181960.
DR   EnsemblGenomes-Gn; EBG00001181961.
DR   EnsemblGenomes-Gn; EBG00001181962.
DR   EnsemblGenomes-Gn; EBG00001181963.
DR   EnsemblGenomes-Gn; EBG00001181964.
DR   EnsemblGenomes-Gn; EBG00001181965.
DR   EnsemblGenomes-Gn; EBG00001181966.
DR   EnsemblGenomes-Gn; EBG00001181967.
DR   EnsemblGenomes-Gn; EBG00001181968.
DR   EnsemblGenomes-Gn; EBG00001181969.
DR   EnsemblGenomes-Gn; EBG00001181970.
DR   EnsemblGenomes-Gn; EBG00001181971.
DR   EnsemblGenomes-Gn; EBG00001181972.
DR   EnsemblGenomes-Gn; EBG00001181973.
DR   EnsemblGenomes-Gn; EBG00001181974.
DR   EnsemblGenomes-Gn; EBG00001181975.
DR   EnsemblGenomes-Gn; EBG00001181976.
DR   EnsemblGenomes-Gn; EBG00001181977.
DR   EnsemblGenomes-Gn; EBG00001181978.
DR   EnsemblGenomes-Gn; EBG00001181979.
DR   EnsemblGenomes-Gn; EBG00001181980.
DR   EnsemblGenomes-Gn; EBG00001181981.
DR   EnsemblGenomes-Gn; EBG00001181982.
DR   EnsemblGenomes-Gn; EBG00001181983.
DR   EnsemblGenomes-Gn; EBG00001181984.
DR   EnsemblGenomes-Gn; EBG00001181985.
DR   EnsemblGenomes-Gn; EBG00001181986.
DR   EnsemblGenomes-Gn; EBG00001181987.
DR   EnsemblGenomes-Gn; EBG00001181988.
DR   EnsemblGenomes-Gn; EBG00001181989.
DR   EnsemblGenomes-Gn; EBG00001181990.
DR   EnsemblGenomes-Gn; EBG00001181991.
DR   EnsemblGenomes-Gn; EBG00001181992.
DR   EnsemblGenomes-Gn; EBG00001181993.
DR   EnsemblGenomes-Gn; EBG00001181994.
DR   EnsemblGenomes-Gn; EBG00001181995.
DR   EnsemblGenomes-Gn; EBG00001181996.
DR   EnsemblGenomes-Gn; EBG00001181997.
DR   EnsemblGenomes-Gn; EBG00001181998.
DR   EnsemblGenomes-Gn; EBG00001181999.
DR   EnsemblGenomes-Gn; EBG00001182000.
DR   EnsemblGenomes-Gn; EBG00001182001.
DR   EnsemblGenomes-Gn; EBG00001182002.
DR   EnsemblGenomes-Gn; EBG00001182003.
DR   EnsemblGenomes-Gn; EBG00001182004.
DR   EnsemblGenomes-Gn; EBG00001182005.
DR   EnsemblGenomes-Gn; EBG00001182006.
DR   EnsemblGenomes-Gn; EBG00001182007.
DR   EnsemblGenomes-Gn; EBG00001182008.
DR   EnsemblGenomes-Gn; EBG00001182009.
DR   EnsemblGenomes-Gn; EBG00001182010.
DR   EnsemblGenomes-Gn; EBG00001182011.
DR   EnsemblGenomes-Gn; EBG00001182012.
DR   EnsemblGenomes-Gn; EBG00001182013.
DR   EnsemblGenomes-Gn; EBG00001182014.
DR   EnsemblGenomes-Gn; EBG00001182015.
DR   EnsemblGenomes-Gn; EBG00001182016.
DR   EnsemblGenomes-Gn; EBG00001182017.
DR   EnsemblGenomes-Gn; EBG00001182018.
DR   EnsemblGenomes-Gn; EBG00001182019.
DR   EnsemblGenomes-Gn; EBG00001182020.
DR   EnsemblGenomes-Gn; EBG00001182021.
DR   EnsemblGenomes-Gn; EBG00001182022.
DR   EnsemblGenomes-Gn; EBG00001182023.
DR   EnsemblGenomes-Gn; EBG00001182024.
DR   EnsemblGenomes-Gn; EBG00001182025.
DR   EnsemblGenomes-Gn; EBG00001182026.
DR   EnsemblGenomes-Gn; EBG00001182027.
DR   EnsemblGenomes-Gn; EBG00001182028.
DR   EnsemblGenomes-Gn; EBG00001182029.
DR   EnsemblGenomes-Gn; EBG00001182030.
DR   EnsemblGenomes-Gn; EBG00001182031.
DR   EnsemblGenomes-Gn; EBG00001182032.
DR   EnsemblGenomes-Gn; EBG00001182033.
DR   EnsemblGenomes-Gn; EBG00001182034.
DR   EnsemblGenomes-Gn; EBG00001182035.
DR   EnsemblGenomes-Gn; EBG00001182036.
DR   EnsemblGenomes-Gn; EBG00001182037.
DR   EnsemblGenomes-Gn; EBG00001182038.
DR   EnsemblGenomes-Gn; EBG00001182039.
DR   EnsemblGenomes-Gn; EBG00001182040.
DR   EnsemblGenomes-Gn; EBG00001182041.
DR   EnsemblGenomes-Gn; EBG00001182042.
DR   EnsemblGenomes-Gn; EBG00001182043.
DR   EnsemblGenomes-Gn; EBG00001182044.
DR   EnsemblGenomes-Gn; EBG00001182045.
DR   EnsemblGenomes-Gn; EBG00001182046.
DR   EnsemblGenomes-Gn; EBG00001182047.
DR   EnsemblGenomes-Gn; EBG00001182048.
DR   EnsemblGenomes-Gn; EBG00001182049.
DR   EnsemblGenomes-Gn; EBG00001182050.
DR   EnsemblGenomes-Gn; EBG00001182051.
DR   EnsemblGenomes-Gn; EBG00001182052.
DR   EnsemblGenomes-Gn; EBG00001182053.
DR   EnsemblGenomes-Gn; EBG00001182054.
DR   EnsemblGenomes-Gn; EBG00001182055.
DR   EnsemblGenomes-Gn; EBG00001182056.
DR   EnsemblGenomes-Gn; EBG00001182057.
DR   EnsemblGenomes-Gn; EBG00001182058.
DR   EnsemblGenomes-Gn; EBG00001182059.
DR   EnsemblGenomes-Gn; EBG00001182060.
DR   EnsemblGenomes-Gn; EBG00001182061.
DR   EnsemblGenomes-Gn; EBG00001182062.
DR   EnsemblGenomes-Gn; EBG00001182063.
DR   EnsemblGenomes-Gn; EBG00001182064.
DR   EnsemblGenomes-Gn; EBG00001182065.
DR   EnsemblGenomes-Gn; EBG00001182066.
DR   EnsemblGenomes-Gn; EBG00001182067.
DR   EnsemblGenomes-Gn; EBG00001182068.
DR   EnsemblGenomes-Gn; EBG00001182069.
DR   EnsemblGenomes-Gn; EBG00001182070.
DR   EnsemblGenomes-Gn; EBG00001182071.
DR   EnsemblGenomes-Gn; EBG00001182072.
DR   EnsemblGenomes-Gn; EBG00001182073.
DR   EnsemblGenomes-Gn; EBG00001182074.
DR   EnsemblGenomes-Gn; EBG00001182075.
DR   EnsemblGenomes-Gn; EBG00001182076.
DR   EnsemblGenomes-Gn; EBG00001182077.
DR   EnsemblGenomes-Gn; EBG00001182078.
DR   EnsemblGenomes-Gn; EBG00001182079.
DR   EnsemblGenomes-Gn; EBG00001182080.
DR   EnsemblGenomes-Gn; EBG00001182081.
DR   EnsemblGenomes-Gn; EBG00001182082.
DR   EnsemblGenomes-Gn; EBG00001182083.
DR   EnsemblGenomes-Gn; EBG00001182084.
DR   EnsemblGenomes-Gn; EBG00001182085.
DR   EnsemblGenomes-Gn; EBG00001182086.
DR   EnsemblGenomes-Gn; EBG00001182087.
DR   EnsemblGenomes-Gn; EBG00001182088.
DR   EnsemblGenomes-Gn; EBG00001182089.
DR   EnsemblGenomes-Gn; EBG00001182090.
DR   EnsemblGenomes-Gn; EBG00001182091.
DR   EnsemblGenomes-Gn; EBG00001182092.
DR   EnsemblGenomes-Gn; EBG00001182093.
DR   EnsemblGenomes-Gn; EBG00001182094.
DR   EnsemblGenomes-Gn; EBG00001182095.
DR   EnsemblGenomes-Gn; EBG00001182096.
DR   EnsemblGenomes-Gn; EBG00001182097.
DR   EnsemblGenomes-Gn; EBG00001182098.
DR   EnsemblGenomes-Gn; EBG00001182099.
DR   EnsemblGenomes-Gn; EBG00001182100.
DR   EnsemblGenomes-Gn; EBG00001182101.
DR   EnsemblGenomes-Gn; EBG00001182102.
DR   EnsemblGenomes-Gn; EBG00001182103.
DR   EnsemblGenomes-Gn; EBG00001182104.
DR   EnsemblGenomes-Gn; EBG00001182105.
DR   EnsemblGenomes-Gn; EBG00001182106.
DR   EnsemblGenomes-Gn; EBG00001182107.
DR   EnsemblGenomes-Gn; EBG00001182108.
DR   EnsemblGenomes-Gn; EBG00001182109.
DR   EnsemblGenomes-Gn; EBG00001182110.
DR   EnsemblGenomes-Gn; EBG00001182111.
DR   EnsemblGenomes-Gn; EBG00001182112.
DR   EnsemblGenomes-Gn; EBG00001182113.
DR   EnsemblGenomes-Gn; EBG00001182114.
DR   EnsemblGenomes-Gn; EBG00001182115.
DR   EnsemblGenomes-Gn; EBG00001182116.
DR   EnsemblGenomes-Gn; EBG00001182117.
DR   EnsemblGenomes-Gn; EBG00001182118.
DR   EnsemblGenomes-Gn; EBG00001182119.
DR   EnsemblGenomes-Gn; EBG00001182120.
DR   EnsemblGenomes-Gn; EBG00001182121.
DR   EnsemblGenomes-Gn; EBG00001182122.
DR   EnsemblGenomes-Gn; EBG00001182123.
DR   EnsemblGenomes-Gn; EBG00001182124.
DR   EnsemblGenomes-Gn; EBG00001182125.
DR   EnsemblGenomes-Gn; Npun_r001.
DR   EnsemblGenomes-Gn; Npun_r002.
DR   EnsemblGenomes-Gn; Npun_r003.
DR   EnsemblGenomes-Gn; Npun_r004.
DR   EnsemblGenomes-Gn; Npun_r005.
DR   EnsemblGenomes-Gn; Npun_r006.
DR   EnsemblGenomes-Gn; Npun_r007.
DR   EnsemblGenomes-Gn; Npun_r008.
DR   EnsemblGenomes-Gn; Npun_r009.
DR   EnsemblGenomes-Gn; Npun_r010.
DR   EnsemblGenomes-Gn; Npun_r011.
DR   EnsemblGenomes-Gn; Npun_r012.
DR   EnsemblGenomes-Gn; Npun_r013.
DR   EnsemblGenomes-Gn; Npun_r014.
DR   EnsemblGenomes-Gn; Npun_r015.
DR   EnsemblGenomes-Gn; Npun_r016.
DR   EnsemblGenomes-Gn; Npun_r017.
DR   EnsemblGenomes-Gn; Npun_r018.
DR   EnsemblGenomes-Gn; Npun_r019.
DR   EnsemblGenomes-Gn; Npun_r020.
DR   EnsemblGenomes-Gn; Npun_r021.
DR   EnsemblGenomes-Gn; Npun_r022.
DR   EnsemblGenomes-Gn; Npun_r023.
DR   EnsemblGenomes-Gn; Npun_r024.
DR   EnsemblGenomes-Gn; Npun_r025.
DR   EnsemblGenomes-Gn; Npun_r026.
DR   EnsemblGenomes-Gn; Npun_r027.
DR   EnsemblGenomes-Gn; Npun_r028.
DR   EnsemblGenomes-Gn; Npun_r029.
DR   EnsemblGenomes-Gn; Npun_r030.
DR   EnsemblGenomes-Gn; Npun_r031.
DR   EnsemblGenomes-Gn; Npun_r032.
DR   EnsemblGenomes-Gn; Npun_r033.
DR   EnsemblGenomes-Gn; Npun_r034.
DR   EnsemblGenomes-Gn; Npun_r035.
DR   EnsemblGenomes-Gn; Npun_r036.
DR   EnsemblGenomes-Gn; Npun_r037.
DR   EnsemblGenomes-Gn; Npun_r038.
DR   EnsemblGenomes-Gn; Npun_r039.
DR   EnsemblGenomes-Gn; Npun_r040.
DR   EnsemblGenomes-Gn; Npun_r041.
DR   EnsemblGenomes-Gn; Npun_r042.
DR   EnsemblGenomes-Gn; Npun_r043.
DR   EnsemblGenomes-Gn; Npun_r044.
DR   EnsemblGenomes-Gn; Npun_r045.
DR   EnsemblGenomes-Gn; Npun_r046.
DR   EnsemblGenomes-Gn; Npun_r047.
DR   EnsemblGenomes-Gn; Npun_r048.
DR   EnsemblGenomes-Gn; Npun_r049.
DR   EnsemblGenomes-Gn; Npun_r050.
DR   EnsemblGenomes-Gn; Npun_r051.
DR   EnsemblGenomes-Gn; Npun_r052.
DR   EnsemblGenomes-Gn; Npun_r053.
DR   EnsemblGenomes-Gn; Npun_r054.
DR   EnsemblGenomes-Gn; Npun_r055.
DR   EnsemblGenomes-Gn; Npun_r056.
DR   EnsemblGenomes-Gn; Npun_r057.
DR   EnsemblGenomes-Gn; Npun_r058.
DR   EnsemblGenomes-Gn; Npun_r059.
DR   EnsemblGenomes-Gn; Npun_r061.
DR   EnsemblGenomes-Gn; Npun_r062.
DR   EnsemblGenomes-Gn; Npun_r063.
DR   EnsemblGenomes-Gn; Npun_r064.
DR   EnsemblGenomes-Gn; Npun_r065.
DR   EnsemblGenomes-Gn; Npun_r066.
DR   EnsemblGenomes-Gn; Npun_r067.
DR   EnsemblGenomes-Gn; Npun_r068.
DR   EnsemblGenomes-Gn; Npun_r069.
DR   EnsemblGenomes-Gn; Npun_r070.
DR   EnsemblGenomes-Gn; Npun_r071.
DR   EnsemblGenomes-Gn; Npun_r072.
DR   EnsemblGenomes-Gn; Npun_r073.
DR   EnsemblGenomes-Gn; Npun_r074.
DR   EnsemblGenomes-Gn; Npun_r075.
DR   EnsemblGenomes-Gn; Npun_r076.
DR   EnsemblGenomes-Gn; Npun_r077.
DR   EnsemblGenomes-Gn; Npun_r078.
DR   EnsemblGenomes-Gn; Npun_r079.
DR   EnsemblGenomes-Gn; Npun_r080.
DR   EnsemblGenomes-Gn; Npun_r081.
DR   EnsemblGenomes-Gn; Npun_r082.
DR   EnsemblGenomes-Gn; Npun_r083.
DR   EnsemblGenomes-Gn; Npun_r084.
DR   EnsemblGenomes-Gn; Npun_r085.
DR   EnsemblGenomes-Gn; Npun_r086.
DR   EnsemblGenomes-Gn; Npun_r087.
DR   EnsemblGenomes-Gn; Npun_r088.
DR   EnsemblGenomes-Gn; Npun_r089.
DR   EnsemblGenomes-Gn; Npun_r090.
DR   EnsemblGenomes-Gn; Npun_r091.
DR   EnsemblGenomes-Gn; Npun_r092.
DR   EnsemblGenomes-Gn; Npun_r093.
DR   EnsemblGenomes-Gn; Npun_r094.
DR   EnsemblGenomes-Gn; Npun_r095.
DR   EnsemblGenomes-Gn; Npun_r096.
DR   EnsemblGenomes-Gn; Npun_r097.
DR   EnsemblGenomes-Gn; Npun_r098.
DR   EnsemblGenomes-Gn; Npun_r099.
DR   EnsemblGenomes-Gn; Npun_r100.
DR   EnsemblGenomes-Gn; Npun_r101.
DR   EnsemblGenomes-Gn; Npun_r102.
DR   EnsemblGenomes-Gn; Npun_r103.
DR   EnsemblGenomes-Gn; Npun_r104.
DR   EnsemblGenomes-Tr; EBT00001760259.
DR   EnsemblGenomes-Tr; EBT00001760260.
DR   EnsemblGenomes-Tr; EBT00001760261.
DR   EnsemblGenomes-Tr; EBT00001760262.
DR   EnsemblGenomes-Tr; EBT00001760263.
DR   EnsemblGenomes-Tr; EBT00001760264.
DR   EnsemblGenomes-Tr; EBT00001760265.
DR   EnsemblGenomes-Tr; EBT00001760266.
DR   EnsemblGenomes-Tr; EBT00001760267.
DR   EnsemblGenomes-Tr; EBT00001760268.
DR   EnsemblGenomes-Tr; EBT00001760269.
DR   EnsemblGenomes-Tr; EBT00001760270.
DR   EnsemblGenomes-Tr; EBT00001760271.
DR   EnsemblGenomes-Tr; EBT00001760272.
DR   EnsemblGenomes-Tr; EBT00001760273.
DR   EnsemblGenomes-Tr; EBT00001760274.
DR   EnsemblGenomes-Tr; EBT00001760275.
DR   EnsemblGenomes-Tr; EBT00001760276.
DR   EnsemblGenomes-Tr; EBT00001760277.
DR   EnsemblGenomes-Tr; EBT00001760278.
DR   EnsemblGenomes-Tr; EBT00001760279.
DR   EnsemblGenomes-Tr; EBT00001760280.
DR   EnsemblGenomes-Tr; EBT00001760281.
DR   EnsemblGenomes-Tr; EBT00001760282.
DR   EnsemblGenomes-Tr; EBT00001760283.
DR   EnsemblGenomes-Tr; EBT00001760284.
DR   EnsemblGenomes-Tr; EBT00001760285.
DR   EnsemblGenomes-Tr; EBT00001760286.
DR   EnsemblGenomes-Tr; EBT00001760287.
DR   EnsemblGenomes-Tr; EBT00001760288.
DR   EnsemblGenomes-Tr; EBT00001760289.
DR   EnsemblGenomes-Tr; EBT00001760290.
DR   EnsemblGenomes-Tr; EBT00001760291.
DR   EnsemblGenomes-Tr; EBT00001760292.
DR   EnsemblGenomes-Tr; EBT00001760293.
DR   EnsemblGenomes-Tr; EBT00001760294.
DR   EnsemblGenomes-Tr; EBT00001760295.
DR   EnsemblGenomes-Tr; EBT00001760296.
DR   EnsemblGenomes-Tr; EBT00001760297.
DR   EnsemblGenomes-Tr; EBT00001760298.
DR   EnsemblGenomes-Tr; EBT00001760299.
DR   EnsemblGenomes-Tr; EBT00001760300.
DR   EnsemblGenomes-Tr; EBT00001760301.
DR   EnsemblGenomes-Tr; EBT00001760302.
DR   EnsemblGenomes-Tr; EBT00001760303.
DR   EnsemblGenomes-Tr; EBT00001760304.
DR   EnsemblGenomes-Tr; EBT00001760305.
DR   EnsemblGenomes-Tr; EBT00001760306.
DR   EnsemblGenomes-Tr; EBT00001760307.
DR   EnsemblGenomes-Tr; EBT00001760308.
DR   EnsemblGenomes-Tr; EBT00001760309.
DR   EnsemblGenomes-Tr; EBT00001760310.
DR   EnsemblGenomes-Tr; EBT00001760311.
DR   EnsemblGenomes-Tr; EBT00001760312.
DR   EnsemblGenomes-Tr; EBT00001760313.
DR   EnsemblGenomes-Tr; EBT00001760314.
DR   EnsemblGenomes-Tr; EBT00001760315.
DR   EnsemblGenomes-Tr; EBT00001760316.
DR   EnsemblGenomes-Tr; EBT00001760317.
DR   EnsemblGenomes-Tr; EBT00001760318.
DR   EnsemblGenomes-Tr; EBT00001760319.
DR   EnsemblGenomes-Tr; EBT00001760320.
DR   EnsemblGenomes-Tr; EBT00001760321.
DR   EnsemblGenomes-Tr; EBT00001760322.
DR   EnsemblGenomes-Tr; EBT00001760323.
DR   EnsemblGenomes-Tr; EBT00001760324.
DR   EnsemblGenomes-Tr; EBT00001760325.
DR   EnsemblGenomes-Tr; EBT00001760326.
DR   EnsemblGenomes-Tr; EBT00001760327.
DR   EnsemblGenomes-Tr; EBT00001760328.
DR   EnsemblGenomes-Tr; EBT00001760329.
DR   EnsemblGenomes-Tr; EBT00001760330.
DR   EnsemblGenomes-Tr; EBT00001760331.
DR   EnsemblGenomes-Tr; EBT00001760332.
DR   EnsemblGenomes-Tr; EBT00001760333.
DR   EnsemblGenomes-Tr; EBT00001760334.
DR   EnsemblGenomes-Tr; EBT00001760335.
DR   EnsemblGenomes-Tr; EBT00001760336.
DR   EnsemblGenomes-Tr; EBT00001760337.
DR   EnsemblGenomes-Tr; EBT00001760338.
DR   EnsemblGenomes-Tr; EBT00001760339.
DR   EnsemblGenomes-Tr; EBT00001760340.
DR   EnsemblGenomes-Tr; EBT00001760341.
DR   EnsemblGenomes-Tr; EBT00001760342.
DR   EnsemblGenomes-Tr; EBT00001760343.
DR   EnsemblGenomes-Tr; EBT00001760344.
DR   EnsemblGenomes-Tr; EBT00001760345.
DR   EnsemblGenomes-Tr; EBT00001760346.
DR   EnsemblGenomes-Tr; EBT00001760347.
DR   EnsemblGenomes-Tr; EBT00001760348.
DR   EnsemblGenomes-Tr; EBT00001760349.
DR   EnsemblGenomes-Tr; EBT00001760350.
DR   EnsemblGenomes-Tr; EBT00001760351.
DR   EnsemblGenomes-Tr; EBT00001760352.
DR   EnsemblGenomes-Tr; EBT00001760353.
DR   EnsemblGenomes-Tr; EBT00001760354.
DR   EnsemblGenomes-Tr; EBT00001760355.
DR   EnsemblGenomes-Tr; EBT00001760356.
DR   EnsemblGenomes-Tr; EBT00001760357.
DR   EnsemblGenomes-Tr; EBT00001760358.
DR   EnsemblGenomes-Tr; EBT00001760359.
DR   EnsemblGenomes-Tr; EBT00001760360.
DR   EnsemblGenomes-Tr; EBT00001760361.
DR   EnsemblGenomes-Tr; EBT00001760362.
DR   EnsemblGenomes-Tr; EBT00001760363.
DR   EnsemblGenomes-Tr; EBT00001760364.
DR   EnsemblGenomes-Tr; EBT00001760365.
DR   EnsemblGenomes-Tr; EBT00001760366.
DR   EnsemblGenomes-Tr; EBT00001760367.
DR   EnsemblGenomes-Tr; EBT00001760368.
DR   EnsemblGenomes-Tr; EBT00001760369.
DR   EnsemblGenomes-Tr; EBT00001760370.
DR   EnsemblGenomes-Tr; EBT00001760371.
DR   EnsemblGenomes-Tr; EBT00001760372.
DR   EnsemblGenomes-Tr; EBT00001760373.
DR   EnsemblGenomes-Tr; EBT00001760374.
DR   EnsemblGenomes-Tr; EBT00001760375.
DR   EnsemblGenomes-Tr; EBT00001760376.
DR   EnsemblGenomes-Tr; EBT00001760377.
DR   EnsemblGenomes-Tr; EBT00001760378.
DR   EnsemblGenomes-Tr; EBT00001760379.
DR   EnsemblGenomes-Tr; EBT00001760380.
DR   EnsemblGenomes-Tr; EBT00001760381.
DR   EnsemblGenomes-Tr; EBT00001760382.
DR   EnsemblGenomes-Tr; EBT00001760383.
DR   EnsemblGenomes-Tr; EBT00001760384.
DR   EnsemblGenomes-Tr; EBT00001760385.
DR   EnsemblGenomes-Tr; EBT00001760386.
DR   EnsemblGenomes-Tr; EBT00001760387.
DR   EnsemblGenomes-Tr; EBT00001760388.
DR   EnsemblGenomes-Tr; EBT00001760389.
DR   EnsemblGenomes-Tr; EBT00001760390.
DR   EnsemblGenomes-Tr; EBT00001760391.
DR   EnsemblGenomes-Tr; EBT00001760392.
DR   EnsemblGenomes-Tr; EBT00001760393.
DR   EnsemblGenomes-Tr; EBT00001760394.
DR   EnsemblGenomes-Tr; EBT00001760395.
DR   EnsemblGenomes-Tr; EBT00001760396.
DR   EnsemblGenomes-Tr; EBT00001760397.
DR   EnsemblGenomes-Tr; EBT00001760398.
DR   EnsemblGenomes-Tr; EBT00001760399.
DR   EnsemblGenomes-Tr; EBT00001760400.
DR   EnsemblGenomes-Tr; EBT00001760401.
DR   EnsemblGenomes-Tr; EBT00001760402.
DR   EnsemblGenomes-Tr; EBT00001760403.
DR   EnsemblGenomes-Tr; EBT00001760404.
DR   EnsemblGenomes-Tr; EBT00001760405.
DR   EnsemblGenomes-Tr; EBT00001760406.
DR   EnsemblGenomes-Tr; EBT00001760407.
DR   EnsemblGenomes-Tr; EBT00001760408.
DR   EnsemblGenomes-Tr; EBT00001760409.
DR   EnsemblGenomes-Tr; EBT00001760410.
DR   EnsemblGenomes-Tr; EBT00001760411.
DR   EnsemblGenomes-Tr; EBT00001760412.
DR   EnsemblGenomes-Tr; EBT00001760413.
DR   EnsemblGenomes-Tr; EBT00001760414.
DR   EnsemblGenomes-Tr; EBT00001760415.
DR   EnsemblGenomes-Tr; EBT00001760416.
DR   EnsemblGenomes-Tr; EBT00001760417.
DR   EnsemblGenomes-Tr; EBT00001760418.
DR   EnsemblGenomes-Tr; EBT00001760419.
DR   EnsemblGenomes-Tr; EBT00001760420.
DR   EnsemblGenomes-Tr; EBT00001760421.
DR   EnsemblGenomes-Tr; EBT00001760422.
DR   EnsemblGenomes-Tr; EBT00001760423.
DR   EnsemblGenomes-Tr; EBT00001760424.
DR   EnsemblGenomes-Tr; EBT00001760425.
DR   EnsemblGenomes-Tr; EBT00001760426.
DR   EnsemblGenomes-Tr; EBT00001760427.
DR   EnsemblGenomes-Tr; EBT00001760428.
DR   EnsemblGenomes-Tr; EBT00001760429.
DR   EnsemblGenomes-Tr; EBT00001760430.
DR   EnsemblGenomes-Tr; EBT00001760431.
DR   EnsemblGenomes-Tr; EBT00001760432.
DR   EnsemblGenomes-Tr; EBT00001760433.
DR   EnsemblGenomes-Tr; EBT00001760434.
DR   EnsemblGenomes-Tr; EBT00001760435.
DR   EnsemblGenomes-Tr; EBT00001760436.
DR   EnsemblGenomes-Tr; EBT00001760437.
DR   EnsemblGenomes-Tr; EBT00001760438.
DR   EnsemblGenomes-Tr; EBT00001760439.
DR   EnsemblGenomes-Tr; EBT00001760440.
DR   EnsemblGenomes-Tr; EBT00001760441.
DR   EnsemblGenomes-Tr; EBT00001760442.
DR   EnsemblGenomes-Tr; EBT00001760443.
DR   EnsemblGenomes-Tr; EBT00001760444.
DR   EnsemblGenomes-Tr; EBT00001760445.
DR   EnsemblGenomes-Tr; EBT00001760446.
DR   EnsemblGenomes-Tr; EBT00001760447.
DR   EnsemblGenomes-Tr; EBT00001760448.
DR   EnsemblGenomes-Tr; EBT00001760449.
DR   EnsemblGenomes-Tr; EBT00001760450.
DR   EnsemblGenomes-Tr; EBT00001760451.
DR   EnsemblGenomes-Tr; EBT00001760452.
DR   EnsemblGenomes-Tr; EBT00001760453.
DR   EnsemblGenomes-Tr; EBT00001760454.
DR   EnsemblGenomes-Tr; EBT00001760455.
DR   EnsemblGenomes-Tr; EBT00001760456.
DR   EnsemblGenomes-Tr; EBT00001760457.
DR   EnsemblGenomes-Tr; EBT00001760458.
DR   EnsemblGenomes-Tr; EBT00001760459.
DR   EnsemblGenomes-Tr; EBT00001760460.
DR   EnsemblGenomes-Tr; EBT00001760461.
DR   EnsemblGenomes-Tr; EBT00001760462.
DR   EnsemblGenomes-Tr; EBT00001760463.
DR   EnsemblGenomes-Tr; EBT00001760464.
DR   EnsemblGenomes-Tr; EBT00001760465.
DR   EnsemblGenomes-Tr; EBT00001760466.
DR   EnsemblGenomes-Tr; EBT00001760467.
DR   EnsemblGenomes-Tr; EBT00001760468.
DR   EnsemblGenomes-Tr; EBT00001760469.
DR   EnsemblGenomes-Tr; EBT00001760470.
DR   EnsemblGenomes-Tr; EBT00001760471.
DR   EnsemblGenomes-Tr; EBT00001760472.
DR   EnsemblGenomes-Tr; EBT00001760473.
DR   EnsemblGenomes-Tr; EBT00001760474.
DR   EnsemblGenomes-Tr; EBT00001760475.
DR   EnsemblGenomes-Tr; EBT00001760476.
DR   EnsemblGenomes-Tr; EBT00001760477.
DR   EnsemblGenomes-Tr; EBT00001760478.
DR   EnsemblGenomes-Tr; EBT00001760479.
DR   EnsemblGenomes-Tr; EBT00001760480.
DR   EnsemblGenomes-Tr; EBT00001760481.
DR   EnsemblGenomes-Tr; EBT00001760482.
DR   EnsemblGenomes-Tr; EBT00001760483.
DR   EnsemblGenomes-Tr; EBT00001760484.
DR   EnsemblGenomes-Tr; EBT00001760485.
DR   EnsemblGenomes-Tr; EBT00001760486.
DR   EnsemblGenomes-Tr; EBT00001760487.
DR   EnsemblGenomes-Tr; EBT00001760488.
DR   EnsemblGenomes-Tr; EBT00001760489.
DR   EnsemblGenomes-Tr; EBT00001760490.
DR   EnsemblGenomes-Tr; EBT00001760491.
DR   EnsemblGenomes-Tr; EBT00001760492.
DR   EnsemblGenomes-Tr; EBT00001760493.
DR   EnsemblGenomes-Tr; EBT00001760494.
DR   EnsemblGenomes-Tr; EBT00001760495.
DR   EnsemblGenomes-Tr; EBT00001760496.
DR   EnsemblGenomes-Tr; EBT00001760497.
DR   EnsemblGenomes-Tr; EBT00001760498.
DR   EnsemblGenomes-Tr; EBT00001760499.
DR   EnsemblGenomes-Tr; EBT00001760500.
DR   EnsemblGenomes-Tr; EBT00001760501.
DR   EnsemblGenomes-Tr; EBT00001760502.
DR   EnsemblGenomes-Tr; EBT00001760503.
DR   EnsemblGenomes-Tr; EBT00001760504.
DR   EnsemblGenomes-Tr; EBT00001760505.
DR   EnsemblGenomes-Tr; EBT00001760506.
DR   EnsemblGenomes-Tr; EBT00001760507.
DR   EnsemblGenomes-Tr; EBT00001760508.
DR   EnsemblGenomes-Tr; EBT00001760509.
DR   EnsemblGenomes-Tr; EBT00001760510.
DR   EnsemblGenomes-Tr; EBT00001760511.
DR   EnsemblGenomes-Tr; EBT00001760512.
DR   EnsemblGenomes-Tr; EBT00001760513.
DR   EnsemblGenomes-Tr; EBT00001760514.
DR   EnsemblGenomes-Tr; EBT00001760515.
DR   EnsemblGenomes-Tr; EBT00001760516.
DR   EnsemblGenomes-Tr; EBT00001760517.
DR   EnsemblGenomes-Tr; EBT00001760518.
DR   EnsemblGenomes-Tr; EBT00001760519.
DR   EnsemblGenomes-Tr; EBT00001760520.
DR   EnsemblGenomes-Tr; EBT00001760521.
DR   EnsemblGenomes-Tr; Npun_r001-1.
DR   EnsemblGenomes-Tr; Npun_r002-1.
DR   EnsemblGenomes-Tr; Npun_r003-1.
DR   EnsemblGenomes-Tr; Npun_r004-1.
DR   EnsemblGenomes-Tr; Npun_r005-1.
DR   EnsemblGenomes-Tr; Npun_r006-1.
DR   EnsemblGenomes-Tr; Npun_r007-1.
DR   EnsemblGenomes-Tr; Npun_r008-1.
DR   EnsemblGenomes-Tr; Npun_r009-1.
DR   EnsemblGenomes-Tr; Npun_r010-1.
DR   EnsemblGenomes-Tr; Npun_r011-1.
DR   EnsemblGenomes-Tr; Npun_r012-1.
DR   EnsemblGenomes-Tr; Npun_r013-1.
DR   EnsemblGenomes-Tr; Npun_r014-1.
DR   EnsemblGenomes-Tr; Npun_r015-1.
DR   EnsemblGenomes-Tr; Npun_r016-1.
DR   EnsemblGenomes-Tr; Npun_r017-1.
DR   EnsemblGenomes-Tr; Npun_r018-1.
DR   EnsemblGenomes-Tr; Npun_r019-1.
DR   EnsemblGenomes-Tr; Npun_r020-1.
DR   EnsemblGenomes-Tr; Npun_r021-1.
DR   EnsemblGenomes-Tr; Npun_r022-1.
DR   EnsemblGenomes-Tr; Npun_r023-1.
DR   EnsemblGenomes-Tr; Npun_r024-1.
DR   EnsemblGenomes-Tr; Npun_r025-1.
DR   EnsemblGenomes-Tr; Npun_r026-1.
DR   EnsemblGenomes-Tr; Npun_r027-1.
DR   EnsemblGenomes-Tr; Npun_r028-1.
DR   EnsemblGenomes-Tr; Npun_r029-1.
DR   EnsemblGenomes-Tr; Npun_r030-1.
DR   EnsemblGenomes-Tr; Npun_r031-1.
DR   EnsemblGenomes-Tr; Npun_r032-1.
DR   EnsemblGenomes-Tr; Npun_r033-1.
DR   EnsemblGenomes-Tr; Npun_r034-1.
DR   EnsemblGenomes-Tr; Npun_r035-1.
DR   EnsemblGenomes-Tr; Npun_r036-1.
DR   EnsemblGenomes-Tr; Npun_r037-1.
DR   EnsemblGenomes-Tr; Npun_r038-1.
DR   EnsemblGenomes-Tr; Npun_r039-1.
DR   EnsemblGenomes-Tr; Npun_r040-1.
DR   EnsemblGenomes-Tr; Npun_r041-1.
DR   EnsemblGenomes-Tr; Npun_r042-1.
DR   EnsemblGenomes-Tr; Npun_r043-1.
DR   EnsemblGenomes-Tr; Npun_r044-1.
DR   EnsemblGenomes-Tr; Npun_r045-1.
DR   EnsemblGenomes-Tr; Npun_r046-1.
DR   EnsemblGenomes-Tr; Npun_r047-1.
DR   EnsemblGenomes-Tr; Npun_r048-1.
DR   EnsemblGenomes-Tr; Npun_r049-1.
DR   EnsemblGenomes-Tr; Npun_r050-1.
DR   EnsemblGenomes-Tr; Npun_r051-1.
DR   EnsemblGenomes-Tr; Npun_r052-1.
DR   EnsemblGenomes-Tr; Npun_r053-1.
DR   EnsemblGenomes-Tr; Npun_r054-1.
DR   EnsemblGenomes-Tr; Npun_r055-1.
DR   EnsemblGenomes-Tr; Npun_r056-1.
DR   EnsemblGenomes-Tr; Npun_r057-1.
DR   EnsemblGenomes-Tr; Npun_r058-1.
DR   EnsemblGenomes-Tr; Npun_r059-1.
DR   EnsemblGenomes-Tr; Npun_r061-1.
DR   EnsemblGenomes-Tr; Npun_r062-1.
DR   EnsemblGenomes-Tr; Npun_r063-1.
DR   EnsemblGenomes-Tr; Npun_r064-1.
DR   EnsemblGenomes-Tr; Npun_r065-1.
DR   EnsemblGenomes-Tr; Npun_r066-1.
DR   EnsemblGenomes-Tr; Npun_r067-1.
DR   EnsemblGenomes-Tr; Npun_r068-1.
DR   EnsemblGenomes-Tr; Npun_r069-1.
DR   EnsemblGenomes-Tr; Npun_r070-1.
DR   EnsemblGenomes-Tr; Npun_r071-1.
DR   EnsemblGenomes-Tr; Npun_r072-1.
DR   EnsemblGenomes-Tr; Npun_r073-1.
DR   EnsemblGenomes-Tr; Npun_r074-1.
DR   EnsemblGenomes-Tr; Npun_r075-1.
DR   EnsemblGenomes-Tr; Npun_r076-1.
DR   EnsemblGenomes-Tr; Npun_r077-1.
DR   EnsemblGenomes-Tr; Npun_r078-1.
DR   EnsemblGenomes-Tr; Npun_r079-1.
DR   EnsemblGenomes-Tr; Npun_r080-1.
DR   EnsemblGenomes-Tr; Npun_r081-1.
DR   EnsemblGenomes-Tr; Npun_r082-1.
DR   EnsemblGenomes-Tr; Npun_r083-1.
DR   EnsemblGenomes-Tr; Npun_r084-1.
DR   EnsemblGenomes-Tr; Npun_r085-1.
DR   EnsemblGenomes-Tr; Npun_r086-1.
DR   EnsemblGenomes-Tr; Npun_r087-1.
DR   EnsemblGenomes-Tr; Npun_r088-1.
DR   EnsemblGenomes-Tr; Npun_r089-1.
DR   EnsemblGenomes-Tr; Npun_r090-1.
DR   EnsemblGenomes-Tr; Npun_r091-1.
DR   EnsemblGenomes-Tr; Npun_r092-1.
DR   EnsemblGenomes-Tr; Npun_r093-1.
DR   EnsemblGenomes-Tr; Npun_r094-1.
DR   EnsemblGenomes-Tr; Npun_r095-1.
DR   EnsemblGenomes-Tr; Npun_r096-1.
DR   EnsemblGenomes-Tr; Npun_r097-1.
DR   EnsemblGenomes-Tr; Npun_r098-1.
DR   EnsemblGenomes-Tr; Npun_r099-1.
DR   EnsemblGenomes-Tr; Npun_r100-1.
DR   EnsemblGenomes-Tr; Npun_r101-1.
DR   EnsemblGenomes-Tr; Npun_r102-1.
DR   EnsemblGenomes-Tr; Npun_r103-1.
DR   EnsemblGenomes-Tr; Npun_r104-1.
DR   EuropePMC; PMC2567498; 18812508.
DR   EuropePMC; PMC2576649; 18790872.
DR   EuropePMC; PMC3251135; 22123943.
DR   EuropePMC; PMC4675709; 26494835.
DR   EuropePMC; PMC5311044; 28261178.
DR   EuropePMC; PMC5313495; 28211005.
DR   EuropePMC; PMC6166771; 30165616.
DR   EuropePMC; PMC6273044; 26999083.
DR   EuropePMC; PMC6403370; 30842510.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00028; Intron_gpI.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00772; mir-328.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01318; CRISPR-DR5.
DR   RFAM; RF01329; CRISPR-DR15.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001037.
DR   SILVA-SSU; CP001037.
DR   StrainInfo; 106453; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351359
CC   Source DNA available from John C. Meeks (jcMeeks@ucdavis.edu)
CC   Bacteria available from ATCC: ATCC 29133
CC   Contacts: John C. Meeks (jcMeeks@ucdavis.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   NOTE: This genome has an insertion element which pops out under
CC   certain growth conditions. When it pops out, gene Npun_R0414 is put
CC   together in one piece.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8234322
FT                   /organism="Nostoc punctiforme PCC 73102"
FT                   /strain="ATCC 29133; PCC 73102"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:63737"
FT                   /culture_collection="ATCC:29133"
FT                   /type_material="type strain of Nostoc punctiforme"
FT   gene            167..1546
FT                   /locus_tag="Npun_F0001"
FT   CDS_pept        167..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ava:Ava_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78804"
FT                   /db_xref="GOA:B2J2B2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J2B2"
FT                   /protein_id="ACC78804.1"
FT                   /translation="MEIPIESLWSQVLERLQVELSRPTFETWIKTASAERLENNCLVIR
FT                   TPNPFARNWLQKYYINTIAHAVQDILGHPVGIYITVAQGDEVSHFSEREVSWESTNPSS
FT                   IPESLPHHNHKTTELNSKYVFSRFVVGANNRMAHAASLAVAESPGKEFNPLFLCGGVGL
FT                   GKTHLMQAIGHYRWKICPDCKIFYVSTEQFTNDLITAIRKDSMQSFREHYRAADVLLVD
FT                   DIQFLEGKEYTQEEFFYTFNTLHEAGKQVVIASDRPPNQIPSLQERLCSRFSMGLIADI
FT                   QKPDLETRMAILQKKAEDENIRLPRDVIEYIASNYTSNIRELEGALIRAVAYISIWGLP
FT                   MTVENITPVLEPPNEKMAASPEAILKVVADNFDVSIDDLKGNSRRREISWARQIGMYLM
FT                   RQHTSLSLPRIGEEFGGKDHTTVIYSCDKITQLHQGDRTLAQTLRQLSDRINMTSRSQK
FT                   S"
FT   gene            1766..2947
FT                   /locus_tag="Npun_F0002"
FT   CDS_pept        1766..2947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0002"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187; KEGG:
FT                   ana:all8067 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78805"
FT                   /db_xref="GOA:B2J2B3"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B3"
FT                   /protein_id="ACC78805.1"
FT                   /translation="MSSKKKEPIGCGCSNIPISIILIILGGGYWWFSQKGYPEISKFLD
FT                   NSKNINIHIPKPTKTSFSTINTTPYITPIPSLASTPTFTDNPKIIPDKKILLLQTAWEK
FT                   KVIRGIYLTRYQITNNANEQTIRERVRYYHSQGINTIIHGVWGNGCTMYNSEVMQQTFG
FT                   YKSCPNQFQEQWLNWLIDEAHKQGMQVHAYFEKGIKIDKNSPIFDLAIFRKWIVPGVDK
FT                   TYSGIDHYVLDVEIPEVANLFQNILVEFVKKYPDIDAVQWDDYLGYYAELSGKVDRTAN
FT                   LTKFVQQMVTSMKKANPSVSFDICHHNPYWAKKYFAADWEKWGADRIFIQAYNDSNFVE
FT                   ELNYAQKYAGVAITDRQLGRLKELVDNPKIKSILVFPFSGNPEETASSLKNSL"
FT   gene            complement(3195..4685)
FT                   /locus_tag="Npun_R0003"
FT   CDS_pept        complement(3195..4685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0003"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   bja:bll1069 probable glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78806"
FT                   /db_xref="GOA:B2J2B4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B4"
FT                   /protein_id="ACC78806.1"
FT                   /translation="MKRPGFIERHHLWTEIQKEASEKIKTIVKEQDLLLIRTAWSDQHG
FT                   IVRSKSLLPQAFFSALENGMQISTGTFLLDTGGAIVFNPFVPGGSLDMPLMTGAPNLVA
FT                   VPDPDTFKIVPWAKRTGFILCDEYFQNGQPMPFSSRGILRQSLIDLHQRGLEHIVGLEV
FT                   EWYLAKLEDPMLAIANVGSSGKPGEPAKVSAVDHSFQYLLESHNPEIQDLLGLLAENLV
FT                   EMKLPLRSVENEGGVGQFEFTFDPIPALQAADTMMIFRMATKQICRQQGYIASFMCRPG
FT                   LQGSSSNGWHLHQSLVDLTTGENAFMSANSQTLTSDLAKHFVGGLLKHANAASVFTTPT
FT                   INGYKRFRPYSLAPDRAGWGLENRGAMIRLQGGFDDPSTHIENRVGEPAANPYLYMASQ
FT                   LISGLDGVDCKLDPGSPTEEPYTTENPILPKSLSEAISYLSQSELFPQKMGQQFINFII
FT                   KMKESEINRFLQSVADQPPEEYLKQVTNWEQREYFELF"
FT   gene            complement(5193..6053)
FT                   /locus_tag="Npun_R0004"
FT   CDS_pept        complement(5193..6053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0004"
FT                   /product="aminotransferase, class I and II"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   sus:Acid_3616 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78807"
FT                   /db_xref="GOA:B2J2B5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B5"
FT                   /protein_id="ACC78807.1"
FT                   /translation="MASVMLATVDPGDEVIVFEPYYENYGPDAILAGATPRYVTLHPPH
FT                   WTFDEAQLHQAFNANTKAIIINTPHNPTGKVFTREELTLIAELCQKWDVLAFTDEIYEH
FT                   ILYDGTQHIALATLPGMEERTITINGLSKTYSVTGWRVGYILANPALTGAIRKVHDFLT
FT                   VGAPAPLQRAGVTAMQLPPSYYEELGKLYHQKRDSILQILDGVGIPYFLPQGAYYVLAD
FT                   ISKFGYKTDIEFTYHLIKNIGVAVVPGSSFFSQPEKGHSLIRFCFSKTPETLQAASDRL
FT                   LKLSK"
FT   gene            6568..7167
FT                   /locus_tag="Npun_F0005"
FT   CDS_pept        6568..7167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78808"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B6"
FT                   /protein_id="ACC78808.1"
FT                   /translation="MKSLHRPDLYSWSNFNPARNIDFNGIAWIRPDGNILIDPVALSNH
FT                   DWNHLKSLGGVVWIVLTNSEHVRASKDIADQTYAKIAGPVAEKDTFPIPCDRWLSDGEE
FT                   FVPGLEVIELHGSKTPGELALLLEETTLITGDLVRARKAGSLTILPDDKLLNREEAVAS
FT                   VRRLAELSRVEAVLVGDGWPVFRDGRDRLEELVATL"
FT   gene            complement(7215..13253)
FT                   /locus_tag="Npun_R0006"
FT   CDS_pept        complement(7215..13253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0006"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ava:Ava_2104 WD-40
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78809"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B7"
FT                   /protein_id="ACC78809.1"
FT                   /translation="MSDSYQPEDVVVYNERSLKKLIRSITNSQGHFALILARCNYCSLR
FT                   DQMVQQIKEECQVEIRELHLSKSIKTLYTTIEANLGNQLPQALMIFDLELVDAIDQLLI
FT                   STNQVREEFRKNFQFPIVIWVNDPTFQKLIQLMPDFKSWTGNSIKFKIATNQLINNLHQ
FT                   IVNSLFAAILNVGAGKFLDNAYLNLDLGILHLGEIESAVRDLQISIEKLEPELEASLQF
FT                   LLGREADANGHKSEAKNYYEQSITVWEKKVKNKQNVSSDDLKRYGCLLWHLGFWWEQYA
FT                   ILHRSEYYEACLKAKDYFQKCVEGFRQHKYPNLAAKFINAWGEVLTRLEAWDELEKVAL
FT                   VAIELHQIYPEPIRLGYSYGLMAEVVLKKSQWVEAKEYAELALQTNANISSEEIINWEW
FT                   ERKSYKNLYLLLLAEAEQNLNQIPEAIANLETARSESNPQHDPLLYIRILAKLRSLYFD
FT                   QGNYLEAFQVKLEQRSIEQQYGLRAFVGAGRLQSKLQVINPGLAVPDPKAAVTQEIAAS
FT                   GRMQDVNRLIERISRDDHKLTVIYGQSGVGKSSLVQAGLLPALKQRAIDARDVVPVLLQ
FT                   VYTDWTKVLGTCFVESLEEVRGLSFPLFLDSMAGFVEELNKNIEKGLLTVLIFDQFEEF
FT                   FFAYKDQDKRRPFFEFIRDCLNIPYVKIILSLREDYLHYLLECNRLTHLDAIDNNILDK
FT                   KILYYLGNFSPEDARSVIQSLTESSQFYLEPPLIDELVRDLARDFNEIRPIELQVVGAQ
FT                   LQTEKITTLIQYQEQGPKEKLVGRFLEEVVKDCGNNNEQFAKLVLYLLTDENNTRPLKN
FT                   RAELEADLALEPARLDLILKILVKSGLVFQVPGFPADRYQLVHDYLVPFVREQQSARLI
FT                   AELEKEKEQRKLTEAKLNQVLTQQLRTARKQTVTLIGLITAISVIAVGVTAAYINTSLT
FT                   SDISSKDDIGLGELVSAIKVGKKLKFLSIGVIPETRLKVISNLSNAIHKIKEINRIEGY
FT                   DKAITALSFSQDSKMLATASEDGKVKILNISDGQERIWSAHKKSVTSISFNSDGKMLAT
FT                   VSEDGNAKIWNIPERKSWSTPKFKPIKILKIDKDGLGFITFSPNDKLLATTTKNKTVKI
FT                   WSWEDGKLKSLPQRFNDKNIIVNFSPDNKTVATGGRYDTVKLWKLTPKKLENKPTEIYD
FT                   SGTFTMNFNNSGDAISLFNKQGNLRVWSTDDKPHLIKSAENVCKNSFGLKDFLNNSLDN
FT                   QLSIFQDSEDKKTFFETIIFQGQCSNYNIFKHDDSITYTSFSPDSKLLASASKDGVVKI
FT                   WDIDDNKLPSFQRTDRDEDINRKIRFSFDGQTVALGSSDNSIELQNRDGTHIKTIRGDS
FT                   SILSFSPDNQTLATGSPDDILKLWKLDTNKEITLKGSTNKITTIDFSPDGNLVAAASAD
FT                   NFVRLWRSSDGTFIGHLKGNTKQVTNVSFSPNSQIIATISDDNKVQLWNSRDRSLIQAL
FT                   KTDSDKVTTVIFSHDSKMLAICDDNLVKLYKSDGTPVKPLIGHNAKVQSVEFSPDDKKL
FT                   MSVSANSGEIKIWDISNSEPLQSIDNYGMISAKFNPNGKYITSINQNYTVKLWTVEGEP
FT                   RATLKGHNDTITKVDFSHDGTKIVTSSADNTIKIWDINQLLLKKYNYEPLTLQKHIKGV
FT                   NDVAFSFDNKYIASASADNTVNIYNGNGNFIKQLSGFSNGINDDISIDKVSFSSDGKII
FT                   GATSCKTYWSNEIYRSKYVMKFWSIEDSAKFQELKSIKGHANFSCNNIDSFIRFSLNKK
FT                   TVASVSKDDSLKLWDLKGKPLATLWGHTDWVNSVAFSPNKKIIASASDDKTVRFWNRNG
FT                   KLLKPIIKHGDKVNSVSFTHDGKIIASASDDQIIRLWNLDGKLQKPTIRDPDKITNIRF
FT                   QADDKKIAFISGSSAKLGNLDNGKIEPLKTDYSSNTLSFDNDNKMLAVGSDYNTGLYFL
FT                   NSWFTKDPYLLYPISSFLGERFNLNTNKTIELNSNEGKIYLNNNLDDLLKRACKLASGY
FT                   LKNNPNMKNDRTLCDDINTQ"
FT   gene            complement(13250..14554)
FT                   /locus_tag="Npun_R0007"
FT   CDS_pept        complement(13250..14554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ter:Tery_3770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B8"
FT                   /protein_id="ACC78810.1"
FT                   /translation="MALDPIKFFNACNPSKTLKIENKEDQQYYIDFSPVRGGNVIQRLR
FT                   RTIANQPDESTCQLFTGHIGCGKSTELFRLKDELEKQGFHVVYFESSADLDMADVDVSD
FT                   ILLAITRQVSASLEKVKIKLRPSYFVDLFNEIADFLQTPVVPEFEFSLPLGIGKVTAKT
FT                   KDSPRLRSQLRQYLEPRTSSILEAINQQVLERAKEQLKLQGYQGLVVIIDNLDRVDISP
FT                   KASGRSQPEYLFIDRGEQLKKLNCHLVYTIPLVLIFSNELSTLTNRFGIKPVVLPMVTV
FT                   KNREGTYNLEGMKLLQQMVLARAFPWLGETQRLSHINEVFDSDETLDRLCRVSGGHVRN
FT                   LLVLLYSCLQEDDPPIGRDCLEMVIREYRDDLVSAISDSEWALLLQVLQQRDNVKGEDE
FT                   YQTLLRSMFLFEYRDVDGRWFDINPAIAESKKFKL"
FT   gene            15003..16226
FT                   /locus_tag="Npun_F0008"
FT   CDS_pept        15003..16226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0008"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein; KEGG: ava:Ava_1457
FT                   riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78811"
FT                   /db_xref="GOA:B2J2B9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2B9"
FT                   /protein_id="ACC78811.1"
FT                   /translation="MDNSPVVAQTDASLPNYTQENIHLVESAVIKEKIGTDFDSRMMLR
FT                   CLELARRALGRTSPNPLVGAVIVKDGEIVGEGFHPRAGEPHAEVFALQAAGVGAASPQE
FT                   NRARGATIYVNLEPCNHYGRTPPCSEGLIQAGVAKVVVGMVDPNPLVAGGGIARLRAAG
FT                   IEVLVGVEESACHQLNEAFVHRILYKRPLGILKYAMTLDGKIATTSGHSAWVTSQEARS
FT                   EVHQLRAACDAIIVGGNTVRQDNPYLTSHHLEAHNPLRVVMSRHLNLPESAHLWKTADA
FT                   PTLVLTQKGANPDFQELLLNQGVEIVELTSLTPDNAMAYLYERGFCSVLWECGGTLAAS
FT                   AIAQGAVQKVLAFIAPKIIGGSIAPTPVGDLGFTTMTEALSLERVRWRVVGSDCLVEGY
FT                   FSQKANSQ"
FT   gene            complement(16269..16487)
FT                   /locus_tag="Npun_R0009"
FT   CDS_pept        complement(16269..16487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78812"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C0"
FT                   /protein_id="ACC78812.1"
FT                   /translation="MTPTIMRQLWSVVETAQAKLLLQLDDASLVQWLVKQTETQVLLDP
FT                   NETDFLCHYIQSRLALIRDLAHERQCS"
FT   gene            complement(16727..18235)
FT                   /locus_tag="Npun_R0010"
FT   CDS_pept        complement(16727..18235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78813"
FT                   /db_xref="GOA:B2J2C1"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C1"
FT                   /protein_id="ACC78813.1"
FT                   /translation="MNTLNYETSVSEVVNIIETASDSVPILVDLDETIFLRNSTQEYLD
FT                   TLRPRILGWLLLTLLNLLKPWNWLPGKIKGEVSRDWIRVLVVTLFFPWTVILWQWRAKH
FT                   LAQAYGNTILIDALTKKKNSRVIVATHGFGFIARSLCKHLPVTFNAVITCRFWQGGIDR
FT                   QKGKYSLVKEILGEDEVSRAIAITDSTDDNPLLASVATPCLVIWPEAKYVSAMANTYIP
FT                   FLYLERAKRPGVRYFLTKILYDDFTILLLGLSWVNNQPIIHSISMFFLLLSFWCIYELG
FT                   YIENDIVAEKFEKKPTLSETYQRYKNRVNTWQPWVWALAFAVPGILILELTKIVSSNVS
FT                   LVAKVSAIDLKTALIDMASWIGLLLVVRVTFFIYNYIDKQTRSWLHLVLQAYKCFGFLV
FT                   VTKTNIIGSMLFASQVISRWIPYFVHRYSKSEWLKELPNEILRAFVFVFLVIAIALGTQ
FT                   NIFILVSWQTLVIFIWYTYRARHRLWKVVREIHPISKDMWDTKN"
FT   gene            complement(18584..20419)
FT                   /locus_tag="Npun_R0011"
FT   CDS_pept        complement(18584..20419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0011"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG: ava:Ava_3308
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78814"
FT                   /db_xref="GOA:B2J2C2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C2"
FT                   /protein_id="ACC78814.1"
FT                   /translation="MTITLLNNRYQVIQVIGAGGFGETFLAEDVHMPSRRRCVIKQLKP
FT                   ITNNDPQNYQLIQQRFEREAATLEYLGESSNQIPKLYAYFSENGQFYLVQEWIHGQTLT
FT                   QIVEAKGFESETAVRQILLSLLSVLNYVHSKGIIHRDIKPENIILRFVDNKPVLIDFGA
FT                   VKETIRSVVNSSGYPTRSLVIGTPGYMPSEQAVGRPVYATDIYSLGLTAIYLLTGKHPQ
FT                   ELQTDLKTGEILWQQHAPNVSSQLAGVLNQAIKPHAGDRYSTASKMLHALQSASNIPPE
FT                   LAANTPTVNFYPPATSTRQTQPLYSPQKPTVISGTSTPGNWQKSAVIIGSLLVGGLIGA
FT                   VVIPNIIRQQQPETTIVTSRTPSLESLPTPASTKSPVSSQTTPVPVIPVSPPRKRVILN
FT                   PLPTFNPPVVSIPQPEKEPVASDTPAPEVPSTPQPEPENIAVPTPEAPFTPQKNDRSPS
FT                   KVAVTTSSQSVPAFPTGTSRSAVEATLGKPNQDLRGAWGKTRAVVYKLVPNKIDLGYLF
FT                   DRNSKVLRQTEVSFAQSVDPQLMEATLNGLLDGQATEEIKQGLKQVQQGQSDNFSFKNG
FT                   SVKGQIIRQECNFIYISIWDENLHDFVSPSTAKQC"
FT   gene            complement(20991..22043)
FT                   /locus_tag="Npun_R0012"
FT   CDS_pept        complement(20991..22043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4555 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78815"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C3"
FT                   /protein_id="ACC78815.1"
FT                   /translation="MTKYDKVFNSPKTSEESLSPEEAVAAIATVTAIADSMIEDVDAES
FT                   LAGILWEFEVFEEYSEDEIAEIVDRLLAIAEEEGIGPLFNAAKVSLSEELVLDGFAAGV
FT                   IVLLDDELAIAKPKQAYLKKLQAALDLEDEEAEEIIKEVIAAFKEAEEEEYADDDDDET
FT                   VVIEDFSEQTYQSPLGNFTVPIPVDPQQGGRIQSQEGVVGFSDDIGTLLRIDYYPFPLE
FT                   QLEELESVGQEEYLQTILVDKYVPQAIFANVPDASVEYTEYLENTLRGAYYVLIDMPKG
FT                   STISKQENNGTAIRLDAYRGLLTFISGEFLYIVSSQHSFLDGETPDSLEEEAEDIKESI
FT                   LEFVETIEFN"
FT   gene            22525..24453
FT                   /locus_tag="Npun_F0013"
FT   CDS_pept        22525..24453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0013"
FT                   /product="alpha amylase, catalytic region"
FT                   /EC_number="2.4.1.19"
FT                   /note="PFAM: glycoside hydrolase, starch-binding; alpha
FT                   amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain; KEGG:
FT                   ava:Ava_1429 glycoside hydrolase, starch-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78816"
FT                   /db_xref="GOA:B2J2C4"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C4"
FT                   /protein_id="ACC78816.1"
FT                   /translation="MVKTPPSQFSPDQYKVDSAQEKVNAIIETPPSETEIDLEFLYTRD
FT                   IEFRQETIYFLVVDRFYDGDPDNSEGENSELYDPNRQEWGKYWGGDLQGVIDKLDYLKN
FT                   MGVTALWLTPLFEQVEELFISNAAMHGYWTKDFKRINPRYIADGENPSLNATQEEKNTT
FT                   FDRLVTELHKRNMKLVLDIVCNHSSPDTSGSKGELYDDGVKIADFNDDVNHWYHHYGEV
FT                   QNWEDDWQVQNCELAGLATFNENNTEYRQYIKSAIKQWLDRGVDALRVDTVKHMPIWFW
FT                   QEFTGEMTNHKPDVFIFGEWIYSNPSDDRSVEFANHSGMTLLDFGLCVAIRAALGQGSE
FT                   MGFQTIQYIFDQDYRYSGATELVTFIDNHDMCRFQSLNPDPAMLKVAIALIMTSRGIPC
FT                   IYYGTEQYLHNDTDGGNDPYNRPMMENWDTDSEVYRCIRLLSGLRRLNPAVSMGSHWQK
FT                   YLTADIYCYVRRYRDSLCFVALNRGGEVILPEVETELPDGEHTCVVTRNKYEVKDGKIY
FT                   NLVLEERGVLVFSHVGERIKAQTIVRVQLNGVDTQPGEIIVVTGDCPELGNWDISKAYP
FT                   LEYINSNTWSAEIPFDESTGKLIAYKYAMWREGRSPLRENLVNRRWVIAKEGTVKWRDT
FT                   WASGRES"
FT   gene            24966..25703
FT                   /locus_tag="Npun_F0014"
FT   CDS_pept        24966..25703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA1727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78817"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C5"
FT                   /protein_id="ACC78817.1"
FT                   /translation="MFELLLKNQLSAPKKVKFKNEILARVQEQKSGTSNDEIKFYKTEL
FT                   LPYFIKLSQHNPVFSVTEQLRLLVGVWTPIWSTISFHESLPRRIQEQSFQIFQHDGYCA
FT                   SVARYIMGKEPYLSQSFHSRLPAYDFMVIQKYGVQNGKWYLQNIDRFQAFKNREIPLNL
FT                   ESVCTWFTDVLNTKVKRNASKLALSKALELENIEINHTNYLRKTSLAPSQVFQHLYIDN
FT                   DWRLVKTQTDASHLPSYTISVKR"
FT   gene            26198..26716
FT                   /locus_tag="Npun_F0015"
FT   CDS_pept        26198..26716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0015"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: tma:TM0938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78818"
FT                   /db_xref="GOA:B2J2C6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C6"
FT                   /protein_id="ACC78818.1"
FT                   /translation="MNEWYKEDLAFIHDDGFRDFALKSAPGILEILAQNKIHDGLVVDL
FT                   GCGSGLWAEELTKAHYRVLGVDISESMINIARTRVPDAEFRIDSLFKTDIPPCNAVTSI
FT                   SECISYLFDRDNDRQILVQLFQRIYNALTPGGVFIFDIAEKGQVAQGTTTKGFTEGESW
FT                   VVLVEKSED"
FT   gene            complement(27085..27501)
FT                   /locus_tag="Npun_R0016"
FT   CDS_pept        complement(27085..27501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78819"
FT                   /db_xref="GOA:B2J2C7"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C7"
FT                   /protein_id="ACC78819.1"
FT                   /translation="MQYTMAQLERLLKMAEDELTEYSTDARKMEKLRRKIGLTVSAIEQ
FT                   RQVKEALLVNKQSSNIITQIVEEQRQTVALPFWGIAGLGLLFGISLNQPICLLAAIVGT
FT                   VSAYRIQRWGWQLQARSLLLQTLEDIEARIAQPK"
FT   gene            27679..30159
FT                   /locus_tag="Npun_F0017"
FT   CDS_pept        27679..30159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0017"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   PEP-utilizing enzyme; pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region;
FT                   KEGG: ava:Ava_3841 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78820"
FT                   /db_xref="GOA:B2J2C8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C8"
FT                   /protein_id="ACC78820.1"
FT                   /translation="MTTISKNTLSPSAQERSLILWFDEVGIADIPLVGGKNASLGEMIQ
FT                   QLTPKGINVPTGFATTAYAYRHFIKSAGLEAKLRKLFADLDVEDVKNLRERGKKARSLL
FT                   IHTPFPVELREAIATAYQSLCEIYHTETDVAVRSSATAEDLPDASFAGQQETYLNVVGV
FT                   EGVLAACHKCFASIFTDRAISYRHTKGFDHFSIALAVGVQKMVRSDLATSGVMFSIDTE
FT                   TGFKDAALITAAYGLGENVVQGSVNPDEYYVFKPTLKAGFRPIIDKKLGSKELKMIYDD
FT                   GSKFTKNVSVSASERGKFALSDEEILQLGNWTCLIEDHYSQVHGISTPMDIEWAKDGIT
FT                   NQLFIVQARPETVQSQKTGNVLRSYRLVWGNREKSSHSSLHDSQSPIPLVTGSAIGEAI
FT                   SQGKARLILDVQKLEQFQVGEVLVTERTDPDWEPIMKRASAIVTNSGGRTCHAAIIARE
FT                   LGVPAIVGCGNATEILKPGQEVTISCAEGEEGKVYAGLLPFEVEEVALENLPRTHTQIL
FT                   MNVGNPQEALSLSAIPNDGVGLARTEFIIANQIQIHPMALINYELLKDEFAKAKIAEIT
FT                   SLYDDKPQYFVDKLAQGIGRIAAAFYPKPVIVRMSDFKSNEYANLLGGRQFEPHEENPM
FT                   LGWRGAARYYDEGYREAFALECHALKRVREEMGLTNVIPMIPFCRTPDEGRLVLAEMAK
FT                   NGLKQGVNGLQVYVMCELPSNVILAEEFAEVFDGFSIGSNDLTQLTLGIDRDSALVARL
FT                   FDERSPAVKRMVKMVIEAAKKCDRKIGICGQAPSDYPEFAQFLVEQGIDSISLNPDSVL
FT                   KTMLEVAKAEGTNS"
FT   gene            30366..30908
FT                   /locus_tag="Npun_F0018"
FT   CDS_pept        30366..30908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0018"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tfu:Tfu_0903 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78821"
FT                   /db_xref="GOA:B2J2C9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2C9"
FT                   /protein_id="ACC78821.1"
FT                   /translation="MTNFLETERLIIRSWIPERDAEQAFVIYNDPEVTHFLGKASLVTS
FT                   VESQRQRLIDNIEQWHRRNNGTGSWAIVEKETTTIVGTILLKQLPDKDGLPTQDYEVGW
FT                   HLRRASWGKGYATEAGQVMLNYGFNVLNLPVINAVVKPENHASIRVTERLGMKPIGRTN
FT                   KYYGIELLLFQLDAPEE"
FT   gene            30967..32535
FT                   /locus_tag="Npun_F0019"
FT   CDS_pept        30967..32535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0019"
FT                   /product="glycosyl transferase, family 39"
FT                   /EC_number="2.4.1.109"
FT                   /note="PFAM: glycosyl transferase, family 39; KEGG:
FT                   ava:Ava_3845 glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78822"
FT                   /db_xref="GOA:B2J2D0"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D0"
FT                   /protein_id="ACC78822.1"
FT                   /translation="MTKKWFRIGLLGIFILSLALRFWGLERFNTLVFDEVYFAKFGNNY
FT                   LTHTPFFNAHPPLSQYMIGIGIWIGSHIPFWHDTVNGLTGSLRSPWTYRWFNALTGSFI
FT                   PLVVAAIAYQLSYRRSFAILAGLFTACDGIFLVESRYALSNIYIVIFGLLGHWFLLLAL
FT                   DNQNRRRSFWLIFAGIAFGASVGTKWNGLWFLSGAYLIWIVAWVIHGMHSFANPKLFFT
FT                   SPSLEEEGGKRQKAGGRIQEPEVRSQEVGVSTYSPPFIPSTSSESPLQNLTQLNIFQML
FT                   FYLGIIPAFIYSIIWIPHLQLDKTYGFIAVHQQILKFHLHLGGNSSDVHPYCAAWYKWP
FT                   LMIRPMAYYYQTAESITEPLPVMGPPLPAGAGQVIYDVHAMGNPFLWWFGVAAMLFLVG
FT                   MLISQAVIPWVKEKRFLVPATLSIDTWIGLYLVINYAANLAPWIKVTRCVFIYHYMCAV
FT                   VFVFLAIAWFVDQCLRSYYQQLRTLGVTITFIILAAFIFWMPIYLGLPLSPDGYKLRMW
FT                   FNSWI"
FT   gene            32843..35149
FT                   /locus_tag="Npun_F0020"
FT   CDS_pept        32843..35149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0020"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region, ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   Phytochrome, central region domain protein; PAS fold-2
FT                   domain protein; KEGG: ava:Ava_3852 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78823"
FT                   /db_xref="GOA:B2J2D1"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D1"
FT                   /protein_id="ACC78823.1"
FT                   /translation="MEMNLQFPGINLISLKEAPIHISSQIQPHGVLLVLEEPELKILQV
FT                   STNTLKVFGIAPENMLHKKLEDLLDPFQIERIKTGLSGENLDFINPTKVWVRKKGDEYV
FT                   VFDAIFHRNIEGFLILELEPAITQENIPFLSFYHLARASINQLEKTANLRDFCQVIVQE
FT                   VRKITEFDRVMLYKFDDDGHGSVIAEEKLESLEPYLGLHYPESDIPKPARKLFAANSIR
FT                   IIPDAYSQPVKLFPVNNPISDRPINLTNSILRSAASCHTEYLHNMGVGASLTISLIKDQ
FT                   KLWGLIACHHQSPKYVSYELRKACEFLGRVIFAEISAREETEDYYHRINLTHLQSILIE
FT                   YMSQEENFIDGLVKNPQHLLDLASAQGAAVCFAGNCTVVGETPREEDLNFLVQWLKNNV
FT                   EEEVFYTDSLPQIYPDAESFKNVASGLLAIPIAKRTYVLWFRPEVIQTVNWGGDPNKAF
FT                   EVSQSEGNVRLCPRKSFELWKETVRLTSLPWKDVEVKAALELRKAIVNIVLRQADELAQ
FT                   LAQDLERSNAELKKFAYVASHDLQEPLNQVVNYVQLLEMRYSEELDEDAQEFISYAVQG
FT                   VSLMQTLIDDVLAYSKVDMQAIAFQMNDVETALMRGLGNLRQRINETGATITHDPLPTV
FT                   MADSTQLMQLFQNLIGNAIKFHSDQPPQIHVGAERIEDAWLFSVRDNGIGIDPKFSDRI
FT                   FVIFQRLHTRDEYTGTGMGLAICKKIVECHRGRIWVESELGQGATFYFTIPVGGRELER
FT                   RNGRKTQNHLFGRGQ"
FT   gene            35094..35540
FT                   /locus_tag="Npun_F0021"
FT   CDS_pept        35094..35540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0021"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ava:Ava_3853 response regulator receiver domain protein
FT                   (CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78824"
FT                   /db_xref="GOA:B2J2D2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D2"
FT                   /protein_id="ACC78824.1"
FT                   /translation="MSVETGEKHKTIFLVEDNKADIRLIQEALKNSSVPYQVVTVRDGI
FT                   DAMAYLRQEGEYADAPRPDLILLDLNLPKKDGREVLAEIKADPLLKRIPVVVLTTSKNE
FT                   DDIFHSYDLHVNCYITKSRNLNQLFQIVKSIEDFWLSTVTLPSE"
FT   gene            35672..36835
FT                   /locus_tag="Npun_F0022"
FT   CDS_pept        35672..36835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0022"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ana:alr3159 two-component hybrid sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78825"
FT                   /db_xref="GOA:B2J2D3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D3"
FT                   /protein_id="ACC78825.1"
FT                   /translation="MVVSYSVKILLIEDNLASARLLQEFLAQAQSQEFTLVHVTRLGEA
FT                   IQELSRCNYDVILLDLTLPDSQGLSSLPPLIGQAPSVPIVVLTNTNDEELAIEAVRQGA
FT                   QDYLVKRQVNVDVLVRSLRYAIERKQVLESLRTVNETLQTRVEERTAELVKANELNQFK
FT                   SEFVSMLSHDIRNPLNTILLAAGLLQNQDERLTKEKKLNHLQMIRSAIKNMAKLLDEVT
FT                   FIGKADSGRLGYELICIDLEAFCRQMVEEVRLMASDKHLTLVFASCGQLDEALWDESLL
FT                   RHILGNLLSNAIKYSLPGGIVRFELIGQEKTVIFRIQDSGIGIPQEDQKRLFQPFQRAD
FT                   NVGTIPGTGLGLAIVKKCVDAYGGEIIVNSQVEVGTTFTVTLPLLEA"
FT   gene            complement(37054..37707)
FT                   /locus_tag="Npun_R0023"
FT   CDS_pept        complement(37054..37707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0023"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   PFAM: putative methyltransferase; KEGG: ava:Ava_4784 tRNA
FT                   (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78826"
FT                   /db_xref="GOA:B2J2D4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D4"
FT                   /protein_id="ACC78826.1"
FT                   /translation="MAAVRVRQHVNPLANKYQTPASPQDFEKIYAKPNQPLHLDIGCAK
FT                   GQFLLNMASIEPNWNYLGLEIREPLVVEANKLRSELALTNLHYLFCNVNNSLHSLLSSL
FT                   PPGSLQRVTIQFPDPWFKTRHAKRRVVQPELVAELASYLAVGGVVFVQSDMEFIAVEMR
FT                   DRFAAHPAYQKVGTEEWLAENPLPVPTEREIGTQKKGEPVYRALFVRREVVNEG"
FT   gene            38120..39568
FT                   /locus_tag="Npun_F0024"
FT   CDS_pept        38120..39568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0024"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: ana:alr0704
FT                   unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78827"
FT                   /db_xref="GOA:B2J2D5"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D5"
FT                   /protein_id="ACC78827.1"
FT                   /translation="MANKIHLNKLAEGVTAWNDWRAANPNIDVDLSGVYLVYEISIRNQ
FT                   KKAWRLLTPFISLLVTLFLVHTNVTEHLIYLFENNPLLKINLSAWEELVLYTIIRLSLF
FT                   FIIMLTLFTGLELMLNYSKGKLNLINIDMNKVNLYGTDLKGVDFRYADLRYADLRNANL
FT                   SYLEAIGADFDYANFTGACIESWNIDSSTNLNNVKCDYIYYQFNYELDKFNQRRPIDIN
FT                   SIFAPNEFTERIKVIEKALETIDLTFTDGIDWKAFFKSFNELRQQYPEHNIDIQGIERK
FT                   SNTLIVRLDVNVESVINTVVIKGAIETGFKEFYEINVKFLEDKYRRDLQAKDDDINFYR
FT                   QQSMEILEIIKQQVTRPINVEKIMSDTYNNNFHKPNISNFANKMEDNARQQANQNIYTS
FT                   EQKQTLADVSTEIQQLIKQFEQNNPTANESEKIAYVNDETTPSLKRRAIGALQGFSETA
FT                   IEEFFDNSYINIAKAIIKGWIKPD"
FT   gene            39862..42477
FT                   /locus_tag="Npun_F0025"
FT   CDS_pept        39862..42477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0025"
FT                   /product="DNA gyrase, A subunit"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: ava:Ava_4464 DNA gyrase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78828"
FT                   /db_xref="GOA:B2J2D6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D6"
FT                   /protein_id="ACC78828.1"
FT                   /translation="MTTSQERIIPIDLRTEMSQSYLEYAMSVIVGRALPDARDGLKPVH
FT                   RRILYAMHELGLLHDRPFKKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLVN
FT                   GHGNFGSVDNDPPAAMRYTECRLQALTSAGLLHDIEYETVDFADNFDGSQQEPTVLPAR
FT                   IPQLLLNGSSGIAVGMATNIPPHNLGELIDALVAVIHNPEITDLELMQYVHGPDFPTGA
FT                   QILGTSAIREAYTTGRGSITMRGVANIETVEQRGRPDREAIIITELPYQTNKAALIEKI
FT                   AEMVNEKRLEGIADIRDESDRDGMRVVIELKRDAYPRVVLNNLYKQTPLQANFGANMLA
FT                   LVNSEPQVLTLKQFLSVFLDFRIESIARRTRYELRKAEERDHLLQGLLIALSQLDPIIV
FT                   LIRHAPDAPTAKGELITTYGLSEVQADAILQMQLRRLTALEADKIRLEHDELQAKITDL
FT                   QDILARRERVLEIIETEVAQLKTNFATPRRTVILPGEGELDDRDLIANEKAIILVTEQG
FT                   YIKRMPVNTFEAQSRATRGKAAAKVKDDDTIEHFLTCCDHDSILFFSERGVVYCLRAYQ
FT                   IPASSRTSRGTPIVQMLPIPKEEKITSIVPVDEFSSEEYLVMLTKGGNIKKTELAAFSH
FT                   IRANGLIAISLEEGDQLRWVRRARVEDSVIIGSRNGMAINFRCNHEQLRPLSRATRGVK
FT                   AMKLKNKDELVGMDILPAAILETLDIVTEAETEDIEAIETIETEDIEITETTEESAEVP
FT                   STGIVGPWVLVITMGGYGKRVPVAQFRLQNRAGQGLMATKFKNRKTKDKLATLRIVNND
FT                   DDEIMMVTNRGIIIRQAVNAISIQSRSATGVRVQRLDEDDAITGVAIVPPDAADAEEAE
FT                   "
FT   gene            42449..44047
FT                   /locus_tag="Npun_F0026"
FT   CDS_pept        42449..44047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0026"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: ava:Ava_4463 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78829"
FT                   /db_xref="GOA:B2J2D7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D7"
FT                   /protein_id="ACC78829.1"
FT                   /translation="MLPMQKKQNKKQGERLTTLLPYLIALASGILMGLTVAPVGAWFLA
FT                   WIAIVPLWVLVVTSAKGKNQFPPAFLWGIGFHGVALFWITGIHPMTWLGVPWLPSLVIT
FT                   LFCWGFISVLGGVFLTIWAAIMVRLGGKKPWLRVLIGTAAWCGLESLWSAGPLWWSSLA
FT                   YTQSPHNLVIVHLGQLSGPNTVTAAIVAVNGLIAEGWMNRRGTEGAEKISSVFSAPWRF
FT                   VNKYWVIATGLLITLHLIGFFLYSRPIAQPPEAALKVGIIQGNIPNRLLRSSEGFRRAQ
FT                   ENYTNGYLTLADQGVDAVLTPEGALPIFQRNLMQTALVAAVKEKGVVAWIGAFGERGDS
FT                   YTISLFTFNSKGEIVSRYDKSKLVPLGEYIPFEGIFGGLIQRLSPLDAHQVPGSANQIF
FT                   DTPFGRAIASICYESAFPEQFRRQAAAGGQFILSSSNDAHYTASMPFQHHAQDIMRAIE
FT                   TDRWSARATNTGYSAFIDPHGRTLWMSGYNTYETHVETIYRRQTKTLYVRWSDWLTPLL
FT                   LGLSILGWFVQRVIN"
FT   gene            44126..44461
FT                   /locus_tag="Npun_F0027"
FT   CDS_pept        44126..44461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78830"
FT                   /db_xref="GOA:B2J2D8"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2D8"
FT                   /protein_id="ACC78830.1"
FT                   /translation="MEDIQQRKLLSALSHGAIFFSSTIISIGIPIAILLISNDPIIKSN
FT                   AKESLNFHINLYIYALIFGLLIVVGIGILLLIALGVVSFIMPIIAIINVLNHPNVSYRY
FT                   PFIFRFV"
FT   gene            44847..45017
FT                   /pseudo
FT                   /locus_tag="Npun_F0028"
FT   gene            complement(45418..46422)
FT                   /locus_tag="Npun_R0029"
FT   CDS_pept        complement(45418..46422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0029"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: transaldolase; PFAM: Transaldolase; KEGG:
FT                   ana:all2563 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78831"
FT                   /db_xref="GOA:B2J2D9"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J2D9"
FT                   /protein_id="ACC78831.1"
FT                   /translation="MSKNLLEQLREVTVVVADTGDIQAIEKFKPQDATTNPSLITAAAQ
FT                   MPEYQGIVDQTLLQAKKDAGDGATQAQIVSLAFDRLAVAFGLKILQIIPGRVSTEVDAR
FT                   LSYDTEATLTKARDLIAQYKAAGIGRDRVLIKIASTWEGIRAAEILEKEGIHCNLTLLF
FT                   GLHQAIACAEAGVTLISPFVGRILDWYKKDTGRDSYPATEDPGVLSVTKIYNYYKKFGY
FT                   KTEVMGASFRNLGEITELAGSDLLTISPSLLAELQSTVAELPRKLDPAKAASLSIEKIS
FT                   IDKASYDKMHAADRMATDKLDEGIKGFTKALEDLEKLLADRLVRLEGEVVASH"
FT   gene            complement(46657..48087)
FT                   /locus_tag="Npun_R0030"
FT   CDS_pept        complement(46657..48087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0030"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: ana:all2564 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78832"
FT                   /db_xref="GOA:B2J2E0"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E0"
FT                   /protein_id="ACC78832.1"
FT                   /translation="MRRTKIICTVGPATSAPENLRGLVEAGMNVARLNFSHGAYEFHAQ
FT                   TAHYLRQISNEQQKPIAIMQDLCGPKIRLGTLPPEGLNLEAGTEVTFVLQEKGESIDEL
FT                   PLPLPTLFAMVRPGEPILINDGRVKLIVTDRDADRIRAQVKTGGLISTHKGVNLPQTPL
FT                   PVSSITEKDLLDLRFGIQLGVDWVAVSFVQSPQDLEPAKRMIEAAGASIRLIAKIERAE
FT                   ALENFDSILKVADAIMIARGDLGVEVPIHEVPLIQKDIIRRCNRAGKPVITATQMLESM
FT                   ISAPDPTRAEATDVANSILDGTDAVMLSGETAVGQYPIAAVQMMHNIAVRTEQALDEGS
FT                   KHAWCHEAGSLSVTESVAESVCRIAYETGSRAILCNTSSGNTARMVSKYRPTSPIIALT
FT                   SDITAYRQLALSWGVEALLIPPVHHAEEMFTNVVNTVVDMGLANKGDKVVITSGVPIGK
FT                   SGTTSLIKVHSIGQPISA"
FT   gene            complement(48381..49424)
FT                   /locus_tag="Npun_R0031"
FT   CDS_pept        complement(48381..49424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0031"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase;
FT                   KEGG: ava:Ava_0495 glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78833"
FT                   /db_xref="GOA:B2J2E1"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E1"
FT                   /protein_id="ACC78833.1"
FT                   /translation="MTKLKVGINGFGRIGRLVLRAGLDNPNIEFVGINDLVPPDNLAYL
FT                   LKYDSTHGQLKHKVEAKEDGILIDGHFIPCVSMRNPAELPWGKLGADYVVEATGLFTDY
FT                   EGAANHLKAGAKRVVISAPTKDPDRVTTLLMGVNHHLFDPGKDIIVSNASCTTNCLAPI
FT                   AKVINDNFGLTEGLMTTVHAMTATQPTVDGPSKKDWRGGRGASQNIIPSSTGAAKAVAL
FT                   VLPELKGRLTGMALRVPTPDVSVVDLTFKTAKATSYKEICAAMKEAAAGSLAGILGYTD
FT                   EEVVSTDFQGDTHSSIFDAGAGIELNSNFFKVIAWYDNEWGYSNRVIDLMLSISQKEKL
FT                   ASTVAVV"
FT   gene            complement(49663..50712)
FT                   /locus_tag="Npun_R0032"
FT   CDS_pept        complement(49663..50712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78834"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E2"
FT                   /protein_id="ACC78834.1"
FT                   /translation="MTMPLDNLEINEAIAAQFAQLVLDCIEREYPNSILRWAESDEDIK
FT                   SPRQLTPAFYGCLDWHSAVHGHWLLVRLLRHFPEASFNAASKQALGQSLTPEKIQGEIA
FT                   HFQRRPFFEFPYGVAWFLQLVAELHEWNHAQAKEWRVVLEPLEKLIADNLQRWINELKL
FT                   PNRTGVHSQTAFALGLMLDWARITENTDFTQLLENKARQFYLSDRNYSLQFEPLGYDFL
FT                   SPGLAEADLMRRILPTTDFTDWLTNFLPQIPIDNSVNWLEPARVDNPQDYMQAHFYGLN
FT                   LSRAWMLEGIISGLANSDRRIKTLRSAALHHRQHGLTDVVIEHYAASHWLGTFAVYLLT
FT                   NRGLQGQII"
FT   gene            complement(51075..52661)
FT                   /locus_tag="Npun_R0033"
FT   CDS_pept        complement(51075..52661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0033"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: ava:Ava_1795 cobalamin B12-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78835"
FT                   /db_xref="GOA:B2J2E3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E3"
FT                   /protein_id="ACC78835.1"
FT                   /translation="MNVLLLYPLFPKSFWSFEKTLALLDRKAMLPPLGLVTVAAILPQE
FT                   WEYKLVDRNVRACTEAEWAWADLVIMSAMIVQKEDLLCQILEAKRRGKRVAVGGPFPTA
FT                   LPDEMTSAGVDYLILDEGEITLPLFVAAIARGDRTGIFRSGGEKPDVTNTPTPRFDLLE
FT                   FEAYAEMSVQFSRGCPFQCEFCDIIVLYGRKPRTKNPEQLLAELDYLYKLGWRRSIFMV
FT                   DDNFIGNKRNVKLFLKSLLPWMVEHNYPFSFATEASVDLAQDQELMDLMVACNFGAVFL
FT                   GIETPDEESLTFTQKYQNTRDSLSDAVNRITRSGLRVMAGFIIGFDGEKVGAGARIVKF
FT                   VEQTAIPTALFSMLQALPDTALWHRLEKEGRLRNKSANINQTTLMNFVPTRPLEDIARE
FT                   YVQAFCDLYEPERFLERTYKHFRLLGEATYPKKGKAAKKPLNWKVLRAFLIICWRQGVR
FT                   RQTRWQFWRNLWSMYRHNPGGVSSYLAVCAQIEHFLEYRQIVRDEIEAQVADFLEAEAR
FT                   VKPEAQLMVNS"
FT   gene            complement(53308..54471)
FT                   /locus_tag="Npun_R0034"
FT   CDS_pept        complement(53308..54471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0034"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain; KEGG: ava:Ava_0002 DNA
FT                   polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78836"
FT                   /db_xref="GOA:B2J2E4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E4"
FT                   /protein_id="ACC78836.1"
FT                   /translation="MKLVCSQSDLSTNLSLVSRAVPSRPTHPVLANVLLQADAETNQVS
FT                   LTAFDLSLGIRTSFNAEVWQGGAIALPAKLLVDITSRLPEGEITLDDESALTGATSSGE
FT                   GLIVTLTPKSGHYQVRAMGPEEFPELPVIENTEVIYLTTAALVEGLRGSLFATSGDETK
FT                   QVLTGVHLTVKQDTLEFAATDGHRLAVVETSNERPLGGTSQLEVTVPARALRELQRMLA
FT                   HSASSDEPVALYFDQGQVVFAWQNQRLTSRTLEGQYPAYRQLIPRQFERQVTIERRQFV
FT                   STLERIAVLADQKNNIVKLSIDSKAQEITLSCEAQDVGSGRESMPAQISGENIEIAFNI
FT                   KYLMEGLKELPSSEIQMHLNQSLTPVIFTPLGGLKMTYLAMPVQLRS"
FT   gene            complement(54561..54833)
FT                   /locus_tag="Npun_R0035"
FT   CDS_pept        complement(54561..54833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78837"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E5"
FT                   /protein_id="ACC78837.1"
FT                   /translation="MTAREQLIQEIGQVSDSLVEEVLDFLLFIKGRQDQKNFTSDSEKS
FT                   QPSEQSILERMGGMPQHLLSVGNLSDRDVRRAIIASRIKQSHQTV"
FT   gene            55369..55794
FT                   /locus_tag="Npun_F0036"
FT   CDS_pept        55369..55794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78838"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E6"
FT                   /protein_id="ACC78838.1"
FT                   /translation="MARRKRNSSILERADRRIESLQSISVKLDFGEGVNIQAYTMTIND
FT                   LRSKLAAYNTALSTIDKLTDDVNNAEQVVIAMSEKMLLGVGSRYGKTSQEYEMAGGVRR
FT                   GNTKKKRSVVDNSQVTNSVQLSSVNGSMNGASAAIVS"
FT   gene            56243..56962
FT                   /locus_tag="Npun_F0037"
FT   CDS_pept        56243..56962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0037"
FT                   /product="4'-phosphopantetheinyl transferase, HetI"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   ava:Ava_2597 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78839"
FT                   /db_xref="GOA:B2J2E7"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E7"
FT                   /protein_id="ACC78839.1"
FT                   /translation="MTATHHLWLPASTDLTLLSDEIHVWRIELDQPELQLQNLAATLSS
FT                   DEMARAERFYFQEHRQRFIAGRGILRTILGRYLGIQPLQVQFNYQQRGKPVLADTFADS
FT                   GLEFNLSHSQGMGLCAVNCTHPIGVDLEYIRSMSDIEALAKRFFLPREYEMLRSLSPNQ
FT                   QQEVFFRYWTCKEAYLKATGDGLSQLEQVEVLLTPTEPAKLQILEDWSLFELVPTNNYV
FT                   AAVAIANYGWNLKCWQY"
FT   gene            complement(57053..57856)
FT                   /locus_tag="Npun_R0038"
FT   CDS_pept        complement(57053..57856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0038"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ava:Ava_1572 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78840"
FT                   /db_xref="GOA:B2J2E8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E8"
FT                   /protein_id="ACC78840.1"
FT                   /translation="MNKTHQGQSKKTALITGAAGGIGYELACIFATHDYNLVLVDRNGL
FT                   KLVEIAAKFQKKFGNLVKTIVKDLSISTAPEEIFTELQLANINVDVLVNNAGFGIYGLF
FT                   HKTDLATELEMLQVNLVCLTHLTKLFVKHMVKQGEGKILNVSSAAAFQPGPLMAVYFAT
FT                   KAYILSFSEAIANELEGTGVTVTVLCPGSTESGFHERTGMADSKLLKGKRMMDAQTVAE
FT                   IGFRGLMKGQTIVIPGFMNKLLAKCVRFVPRNLVTKIVRNMQEDK"
FT   gene            complement(58424..59938)
FT                   /locus_tag="Npun_R0039"
FT   CDS_pept        complement(58424..59938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0039"
FT                   /product="polyketide synthase thioester reductase subunit
FT                   HglB"
FT                   /EC_number="1.2.1.31"
FT                   /note="TIGRFAM: thioester reductase domain; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; phosphopantetheine-binding; Male
FT                   sterility C-terminal domain; KEGG: ana:alr5357 polyketide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78841"
FT                   /db_xref="GOA:B2J2E9"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2E9"
FT                   /protein_id="ACC78841.1"
FT                   /translation="MTIKQSFTADDIQIFLVSNLAKLLDVATDEIDVKEHLENYGLDSA
FT                   QAMILVSNLEKLLGFQPSPLLLWHYPNIEALSQRLAEEVQDGSPIQDTKVVASNANAAP
FT                   SVLDLGAEAVLDPTIHPGAASNVLVGEPKNIFLTGGTGFLGAFIIRELLQETNADIYCL
FT                   VRAANAQEGKSKLQKNLEQYAIWQEEFTSRIIPIVGDLSQPLLGIGSEQFQILAGNIDT
FT                   IYHSAALLNYVFPYSALKAANVLGTQEVLRLACQIKVKSVHYVSSVAVFESTAYAGKVV
FT                   KEQDEFNHWEGIYLGYSQTKWVAEKLVKIARDRGLPVTIHRPPLISGDSKTGICNTHDF
FT                   INLMTKGCLQMGYFPDVDYMLDMSPVDYVSKAIVYLSRQKESLGKAFNLQHPQPAALKM
FT                   LVEWIRSFGYSVEMIPYEKWQSELINNVTSADNPLYTLRPFLLERWSDEQLTIPDLYLQ
FT                   ARRPHISCQDTLHALAGSSIACPPIDSQLFMTYTAYLIQSGFLNLA"
FT   gene            complement(59941..61617)
FT                   /locus_tag="Npun_R0040"
FT   CDS_pept        complement(59941..61617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0040"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   ava:Ava_2594 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78842"
FT                   /db_xref="GOA:B2J2F0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014179"
FT                   /db_xref="InterPro:IPR040981"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F0"
FT                   /protein_id="ACC78842.1"
FT                   /translation="MTTVDTVLSKHDNGLNFSAWSHNKNQVWKGSLETVSFEKQTIKDK
FT                   LMVLNKPCYIVKVAGKIGVTNEGYLSPGDNGTTAQVELLTFAAPIRIQQFGDPNFLSSY
FT                   GVKYAYVTGAMAGGIASEEMVIALGKEQILSSFGAGGLTPERLEAAINRIQQALPQGPY
FT                   AFNLIHSPNEPAIERRAVDLYLKYQVRTVEASAFLDLTPNIVYYRVAGLGLNSANQIEI
FT                   KNKIIAKISRREVATKFLQPAPARIIKELLEQGLITELQATLAAKVPMADDITVEADSG
FT                   GHTDNRPLVCVLPSIIALRDEIQAQYHYQTPIRIGVAGGIGTPQSALAAFMMGAAYIMT
FT                   GSINQSCVESGACEHTKKLLAQAEMADMIMAPAADMFEMGVKLQVLKRGTMFPMRAQKL
FT                   FELYRAYDSIEEIPLAERQKLEKQVFRKTIAEVWEGTAAYLSQKNPEKLGKAVNNPKLK
FT                   MALIFRWYLGLSSRWSSSGEKGREVDYQIWCGPAMGGFNDWVRGSYLSEPNNRGVVDVA
FT                   NQIMTGAAFLYRVQNLKIQGLQASDYYSQYHPVRSTSLLEI"
FT   gene            complement(61892..66640)
FT                   /locus_tag="Npun_R0041"
FT   CDS_pept        complement(61892..66640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0041"
FT                   /product="beta-ketoacyl synthase HglC"
FT                   /EC_number="2.3.1.94"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: ana:alr5355
FT                   heterocyst glycolipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78843"
FT                   /db_xref="GOA:B2J2F1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014181"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F1"
FT                   /protein_id="ACC78843.1"
FT                   /translation="MEKIAIIALSCLFPDAENPEEYWQNIVNQKDSTSSATVEEIGVDP
FT                   TIFHNPVKGTPDKTYSLKGGYIRNFQFNPSEYNLPSEFVAGLDNTFKWSLYTAKQAIEQ
FT                   SGYWGNQTVLAKCGVILGNLSFPTKLSNQLFSPIYQKAINPAVRELLQYEDFNLAVPSG
FT                   TTASLYNAMISGLPASIVAQALSLSQINLCLDAACSSSFYAIKLASHYLWSHKADVMLA
FT                   GAISCADSLFVRMLFSGVQGYAENGISRPLDKSSRGLIPADGVGMVMLKRYSDAIRDGD
FT                   NILATICGNGLSNDGKGKHLLSPNPKGQVLAFERAYNEANFSPKTIDYLECHATGTLLG
FT                   DTTEFNSIETFFGQNQAAPLVGSAKANTGHLLTAAGMVGLTKVILSMSHGVIPATMNVS
FT                   EPLTSEKGTISADKIVRTATAWPNNNAPIKRAAISAFGFGGTNSHLILEQGNTRESVES
FT                   TPPVPPTKIAIVGMDAFFGNCNGLDAFERSIYDGTQHFTSLPPQRWHGIENQESVLKEY
FT                   GLADGKAPVGAYIKDFEIDTLSCKIPPNEIEKLNPQQLLLLKVSDRAVKDAKLQEGGNV
FT                   GVIVAAETEFSVHQLQQRWNLSWQVKDGLLNQGISLPVEQLAQLETIVKDSIHQPVEIG
FT                   EYVSHIANIMASRISALWNFTGPAFTVSAGENSALKALEIAQMLLATGEVDAVVVGAVD
FT                   LAGGVENVLFRSQFAPINTGVNTLGYDQQANGWTVGEGAGAVVLKRYEAAKEDNERIYA
FT                   VIDAMSFAQGNSTLSDALVKPDASAISNVCKQAFQMAEIQPTEVNYVEVFGSGVPQEDE
FT                   AEITGLLQAYPKVGNGLHCALGSVKANIGHTYTASGIASLIKTALCLYYRYIPATPKWS
FT                   GVKTPQVWEGSPFYVAMESRPWFVDKGGTRRIAAINSMGIDGSYAHLILSEEPSQEERD
FT                   NRYLQQMPFHLFPIAVSDRSTIPDLLNHLQKSIEASSSLAARASQTFATFQQQSDPKYV
FT                   LSITGRNTKDLLKEIESARKGVNNAFENGTDWQTPLGSYFTAKPLGKTGAVAYVYPAAV
FT                   NSYIGIGRTVFRLFPKVFEDLKSNNLYNRAADVEKLVYPRSLPKLTTRQLETLEKQLLD
FT                   DSLAMFESEIAFARYMTAIFRDDFKVKPQSVFGYSLGETSMMVAQGVWSDFEGGSNTLN
FT                   SSPLFGDKLSGPKNAVREYWGLTDSPNNNFWNTYVLMATPSQVRECLKHENHVYLTQIN
FT                   TPEEVLIAGDDAACKRVIATLGCNSFPAPFDHVIHCEAMRSQFEEIKKVNSLPSQNLPG
FT                   IVFYSAADYQPVALERDTIAHNIAKGLCQELDFPQLVNRVYGDGVKIFLEAGAGSVCSR
FT                   WIDKILGSKEHITVSLNRRGMDDHASMVKALAKLLSHQVNVDLSPLYCKAQDTANSSKA
FT                   TLRTVTLGGKAIAATILSEQNRKLVEDFAGDLRSDRFKIQHPDIPKVQQSEITDSLNTS
FT                   KHITQQESHSPNILPQPEEVKPKNIIDNVFQPREQLQSSESSAIRQSIPVSFPPVRTQK
FT                   ISSIISMFDLNKTQYQKLNANNSKITKAHTAFLQARQDYSQQMSEIIQLQLACAQNLLN
FT                   EES"
FT   gene            complement(66946..68673)
FT                   /locus_tag="Npun_R0042"
FT   CDS_pept        complement(66946..68673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0042"
FT                   /product="KR"
FT                   /EC_number="2.3.1.94"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ana:alr5353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78844"
FT                   /db_xref="GOA:B2J2F2"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F2"
FT                   /protein_id="ACC78844.1"
FT                   /translation="MTQTAQLSPSSVFVVSGGAKGITAECTIRLAQQQPCKFILLGRSE
FT                   LLETEPDYAQNSDESALKKCIMENLLSQGEKPTPMNVQKIYNKITSSREIKKTLAAIEK
FT                   TGAKAEYISVDVTDTPALQEKLATAVQHFGAITGIIHGAGNLADKLIEKKTEDDFEKVY
FT                   TAKVQGLENLLACVNPNQLQHLVLFSSVTGFYGNPGQSDYAIANEILNKSAHIFKQSYP
FT                   SCHVVAINWGAWDSGMVTAELKKIFQERKIDIIPIAVGAQMLVKEMDNTNHETSQVVIG
FT                   SPLVPLAAELDPELRTHRIRRQMTLEANPFLHDHTIAGSPVLPATCAMTWSINASEQLY
FT                   PGYRLFYYQDFKVLKGITFNETLAKEHILEIEEISKVNLERIELKAKISSKNLEGKTHF
FT                   HFSAQLNLQREIPDAPIYESLNLEPDNIITATGKDFYQNGGATLFHGPGFQEVKRVLNI
FT                   SPEKITTECLWPELTAKEQGQFPVQWVNPYTTDLSMHALWIWTQHFHEEGCLPGKVEKF
FT                   EQFEMIPHNETFYVSCEVKSKTPSSAIANFIIHDRQGKIYSRMLGAHAIIWSMKMLRS"
FT   gene            complement(68809..74142)
FT                   /locus_tag="Npun_R0043"
FT   CDS_pept        complement(68809..74142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0043"
FT                   /product="polyketide synthase phosphopantetheine-binding
FT                   HglE"
FT                   /EC_number="2.3.1.94"
FT                   /note="TIGRFAM: phosphopantetheine-binding; PFAM:
FT                   polyketide synthase; acyl transferase domain protein; KEGG:
FT                   ava:Ava_2590 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78845"
FT                   /db_xref="GOA:B2J2F3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004432"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F3"
FT                   /protein_id="ACC78845.1"
FT                   /translation="MKSDKSDKSVSINRINRQLQHNPIAIVGMASLLPQARNLREYWQN
FT                   IVNKIDCITDVPSTHWSVEDYYDPNPRTTEDKTYCKRGGFLPEVDFNPMEFGIPPSILE
FT                   VTDVSQLLSLVVAKEAMEDAGYGEKREFNREMVGVILGVAMAKQLGMPLSARLEYPIWE
FT                   KALKSSGLSDEDTQKIVDKIKSAYVKWDENAFPGMLANVVAGRIANRLNFGGMNCVVDA
FT                   ACASSFGALKMAISELVEHRSDMMLTGGVDTDNTIMAYISFSKTPAVSPSENVKPFDAK
FT                   SDGMMLGEGIGMIVLKRLEDAERDNDKIYAVIKGIGTSSDGRYKSIYAPRKEGQVKALE
FT                   RAYEDAGFSPATVGLMEAHGTGTMAGDPTEFGSLKDFFDVHDDKKQHIALGSVKSQIGH
FT                   TKAAAGAASLIKTALALHHKVLPPTINITEPNPKLNIKNSSFYLNTQTRPWIRPEGEAP
FT                   RRAGVSSFGFGGTNYHVVLEEYEADQNAAYRLHSDASEVLLFAPTVEQLLSKSEDILGK
FT                   LRSRSDSGGVSPEAITYYAQLVKKCKSPQIPLSAPRFGFVAENLEEACKFLQTSIDWLK
FT                   LKGTAASWEHPQGIYYRSSGMELGGKVVSLFSGQGSQYLEMGRELVMNFPLMRRLHGYM
FT                   DSLLLKDNLQPLSEIVFPHPVFGEAEKNVQVAALQRTEYAQPAIGVLSAGMYSILQQAG
FT                   FKSDFVAGHSFGELTALWAAGVLSTEDYLFLVKARGQAMAAPEDPDHDAGSMLAVKEDI
FT                   SKVEAVLRHFPQVAIANQNSPTQFVLAGPTAEIARIKEALHEKGYTAVLLPVSAAFHTP
FT                   LIAFAQKSFAIATKSVKFQSPKIPVYSNVTSKQYPKEAQGIQKILETHLSNSVLFKQEI
FT                   ENIYAAGGTCFVEFGPRRILSNLVKEILGDRPHITVSLNPSTQKNSDRSLREAVVQLRV
FT                   IGLALNNLDPYQLPQTIPPIETKKTLNVRLNGINYRSEKTKNAFALALQDGHKVTLPTP
FT                   EYPDAAPLFSSPGVTPPLAVIETNGHKKTTPVMNGVTSNIITQPEQQMNPVTLPQPVQE
FT                   SKMQPTPEKLTNYEQLLASLEYLLTQFQENQAENLQVHGTYLNHQMEYAKAFFQLMQQQ
FT                   NSLLSESKSTAETAKMKLVVMESLERSMMQFHSQQSETLRIHEQYLQEQLEYTKSFFQL
FT                   IQQEYSQIISGEGVTQLTEKLSDAVRHHFTTETTVTDAPTKIVESQPLPVAITQEPLPA
FT                   AVEPVVETPAPIQTRSIASLPTPHFATVETVEPVIAPPVPVVEPQAEVVVKISAPPVEE
FT                   VVAFTPEPAPTTAAPVSGATIDIVDLDKNLLAITSDKTGYPVEMLEMDMDMEADLGIDS
FT                   IKRVEILGALQEMYPNLPKPNLEELSEKRTIGQVVEYLQSHASKSVSVEIAIHEVQQTT
FT                   EISVEVAPVVEVVVAPEPSVVVAFTPEPEVASSTSDEFANLGETLLAITSDKTGYPVEM
FT                   LELEMDMEADLGIDSIKRVEILGAMQEMYPNLPKPNIEELGDLRTIGQIVDYLQQLAGG
FT                   EKKKSEPEFVQQQPPELEHNIPRYTVKLRSLAQPDYLDFTLPEGHIGLITDDGSLTTYK
FT                   LTESLIEKGWKVVVISFPQSLIAQQAPLPTGVTRVTLANLSEEHLQQQLQAIASHCGAI
FT                   GAFIHLHPMFVGNHTGSISYNESEKAIVKHVFLMAKHLKPSLNEAAKHGRSCFCTVAHL
FT                   DGAFGLEYKVNFGAIGAGLFGLTKTLRWEWPKVFTRAIDLSPRLDAKQSVQNIIAELHD
FT                   PNLYISEVGYGSQGRVTIIAD"
FT   gene            76173..77381
FT                   /locus_tag="Npun_F0044"
FT   CDS_pept        76173..77381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0044"
FT                   /product="secretion protein HlyD family protein, DevB"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ava:Ava_2587 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78846"
FT                   /db_xref="GOA:B2J2F4"
FT                   /db_xref="InterPro:IPR014315"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F4"
FT                   /protein_id="ACC78846.1"
FT                   /translation="MAVNKESRLFTKPVGRSQLILAASLTLAAGLIAFYSLVPFWSKPK
FT                   VVTPAANPPKAATPVKLAVTALGRLEPEGEVTSLTAPASNNGVRVDRLLVKEGETVKAG
FT                   QLLAYLENYGRSRTALQQALDQLQVAKAKLAQVKSGAKTGDIDAQKAAIARLEPQYKGD
FT                   VATQEATIARIQAEVDNAQAENNRYQQLYKQGAIAASVADTKALQLKTTQQQLSEAQAT
FT                   LKRTQDTFQEQRKQAQAQLTSISEVRSVDVQVAQTEVNSATTSVQQAKADLDLSYIKSP
FT                   INGKILKIHAKTGEVISTSRGFAEIGKTSQMYVIAEVYQTDVQKVRVGQKATITSTAFT
FT                   GTIKGTVKEIGWQVDKQNIFSINPGSDTDRRIVEVKISIDNPADSEKVARLTNLQVDVA
FT                   IHI"
FT   gene            77441..78634
FT                   /locus_tag="Npun_F0045"
FT   CDS_pept        77441..78634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0045"
FT                   /product="DevC protein"
FT                   /note="TIGRFAM: DevC protein; PFAM: protein of unknown
FT                   function DUF214; KEGG: ana:all5346 heterocyst specific
FT                   ABC-transporter, membrane spanning subunit DevC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78847"
FT                   /db_xref="GOA:B2J2F5"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F5"
FT                   /protein_id="ACC78847.1"
FT                   /translation="MTNKSMNFKIPLGWLQLAQQKVRLLVAVAGIGFIVLLMFVQLGFQ
FT                   DALYSSATAVHQNLKGDLFLVSSQYKSLTSNQSFSRTRLYQSLGFDGVESVSPMYLQFA
FT                   KLKNPATSEKYSIYVIGFDPGRPVMNLPEVEKNLDKLKIPDVVLFDRGSRPEFGPIAEK
FT                   FNGGETAQTIEIFPYSSLIGYRVRIGGLFTLGPSFGVDGNLLVSDSTFLRINPNTRPAD
FT                   MIDIGLISLKPGANAEKVLKNLQANLPSDVQVFTRQGFIDFEKNYWAVRTPIGFILNLM
FT                   LTMAAVVGVVIVYQILYSNIATQFVAYATLKAIGYANSYLLNVVFQQALILAILGYIPG
FT                   FITSVLLYSFAAEATKLPIVMTTNNAVIVLTSTVLMCITSGALAINKLRSADPGDIF"
FT   gene            78842..79846
FT                   /locus_tag="Npun_F0046"
FT   CDS_pept        78842..79846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0046"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="5.3.3.1"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: ava:Ava_2585 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78848"
FT                   /db_xref="GOA:B2J2F6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F6"
FT                   /protein_id="ACC78848.1"
FT                   /translation="MNLKDKTLLITGIDEFVGLRTAELAIAQGMKVRGLKSSTEQNKQL
FT                   QNLGVEIIIGSITDSTIAQKACQGVDIVLHTDQLAEEAGAIKNFRDVNVGGTVNMAKAA
FT                   KQAGVKTFVHLSSVMVYGFNYPNGVTESGPLSGENNPYCETKIEAETAVLELNNPPDFG
FT                   IIVIRAGDVYGPGSIPWIVRPVLMMRQKLFACANDGKGVINHVYIDNLIDGIFLAIEKE
FT                   TYGEIFNITDGQETSWKEYFMRLAAMEGLSAPLSLPKDEIKLFLKLRVQGQKLFRKKVD
FT                   ILPESIDFMTRPYACSIVKAQSMLNYKPTIHLEEGMQRTHEWLQKTDIQSLIK"
FT   gene            80060..81043
FT                   /locus_tag="Npun_F0047"
FT   CDS_pept        80060..81043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0047"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   gvi:gll2192 probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78849"
FT                   /db_xref="GOA:B2J2F7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F7"
FT                   /protein_id="ACC78849.1"
FT                   /translation="MSSNQPRLSIGLPVYNGEKFIKEAIDSLLAQTFEDFELIISDNAS
FT                   TDKTEEICRAYAEKDQRICYYRNDKNIGCARNFNRVFKLSSGEYFKWAAYDDLHAPDFI
FT                   KKCVEVLDQDPSIILCHSQTYFIDEQGNFLQNYDIKLKADALKPHERFHELLTKHLCYQ
FT                   CYGVIRASALRMIPPMGGYGNADGILLLRLGILGRFYEIPEYLFCARSHPQQSMSMYFP
FT                   NYLLFANNTKKTSLSMLPDFYAYAVWFDSAKKGQILLPHWRIIWEYLLSIWRSPLSFNE
FT                   RLCCYRSLHQQLKGAEYLLLKDLLRVLQVLWKGRQPAAIGKHQVIH"
FT   gene            81120..81587
FT                   /locus_tag="Npun_F0048"
FT   CDS_pept        81120..81587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78850"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F8"
FT                   /protein_id="ACC78850.1"
FT                   /translation="MLKRFHLSHVLLATLVSLSFGKTVNAEPTATLSVVVNGIQHKKGE
FT                   ICFRVYASEKGFPMSNSSGSQSGCAKITGNSVRKDFSGLKPGTYAVAVVDDQNGDYKLN
FT                   KDFFGIPTEGFGISKNPTVSIQTGTPKFRDASFVVNKNTTVNIIMKYSLDS"
FT   gene            81723..83009
FT                   /locus_tag="Npun_F0049"
FT   CDS_pept        81723..83009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0049"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ana:all5343 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78851"
FT                   /db_xref="GOA:B2J2F9"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2F9"
FT                   /protein_id="ACC78851.1"
FT                   /translation="MEDLAIFLSKSLMGWLVIQVCLTLVFIWYLRSSKKNLLPDDQLPK
FT                   TAVILCLRGADPFLPRCLRSLLNQNYPQYDLKLIVDSHEDPAWKIASESITEQEATNVQ
FT                   ISPLRIVRNNCSLKCSSLVQAVRELDDSYKVVALVDADTIVHVNWLRELVSPLGDAKIG
FT                   ATTGNRWYVPTGRYWGSLVRYIGNVSTVVQMFIFQIPWGGSLAVKTEVLRQTELLDKWG
FT                   QALGEDFMMHDILKKHGLQVKFVPSLLIVNREETDLSNLIDYLKRLILYSRLYHPRWLA
FT                   LVSEAVSSILFPTALIILVLESFLQAKWEAAVVLLGCYSVYTVGLLLIMLVLELEIQRV
FT                   VRSNDQAMSIDKPLHVYAKLSGATIIKMLIGIPLTQWVYGLAMLSSIWISTVTWRGVSY
FT                   RVQGPWNVRLVEYRPYQWLDQPIDSKVSL"
FT   gene            83420..84697
FT                   /locus_tag="Npun_F0050"
FT   CDS_pept        83420..84697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0050"
FT                   /product="glycosyl transferase, group 1"
FT                   /EC_number="2.4.1.345"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ana:all5341 probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78852"
FT                   /db_xref="GOA:B2J2G0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G0"
FT                   /protein_id="ACC78852.1"
FT                   /translation="MTKQKLRIALFTGLYAPFLTGVSVAVHQRVRWLLEQGHEVFLVHP
FT                   QISDRYPKNVGDRPMPGLDEIESFPNFSAYAFPTEPLLFYKSLPQPLNYRHWSDTKLLD
FT                   KFKPDIILVEEAAQMRGLYSFFLQGYGRPIGVEYAKRTGTPIISLFHTDIVAYIKYYFG
FT                   DKFFNLVRPIIPTLVKQFSESYDFNYFSSKEQLTKYEELKCQRAEYVPYQGIDCEKFHP
FT                   RNICYNPIPNDNRPTLLFVGRITPEKNVNQLLDIFPVIAAKIPDVHLVIVGSGPMDEEI
FT                   RERAKKFGSGITIWGESHGTELLGWFARADIFVNPSVTENFCTTNNEALASGTPLVAVV
FT                   APSTSEQVFPGRNGFLAQPNNPTDFAQKVITILENPDLKADMTRHARPSILEFDWSACM
FT                   QKLEDKLYQIVEGSQKVKVGTGSIRR"
FT   gene            complement(84760..85533)
FT                   /locus_tag="Npun_R0051"
FT   CDS_pept        complement(84760..85533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0051"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis; KEGG: ava:Ava_3372
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78853"
FT                   /db_xref="GOA:B2J2G1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J2G1"
FT                   /protein_id="ACC78853.1"
FT                   /translation="MDVIPAIDLLEGRCVRLYQGDYDRSQVFSENPVDVAKQWVDQGAN
FT                   RLHIVDLDGAKAGKVVNLGAIEAIAHAVSVPIEIGGGLRDRTSVQQLFNLGIQWAILGT
FT                   IAVEQPQLVQELCAEFPGQIIIGIDARNGRVATRGWLETSEVLATQLAVQMQELGAAAI
FT                   IYTDIHRDGTLIGPNLEALRELAAVISIPIIASGGVSSLTDLLSLLALEPQGVTGVIVG
FT                   RALYTGDILLKEALRAIGPGRIQDIPPNLGFSSFA"
FT   gene            complement(85588..85887)
FT                   /locus_tag="Npun_R0052"
FT   CDS_pept        complement(85588..85887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78854"
FT                   /db_xref="GOA:B2J2G2"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G2"
FT                   /protein_id="ACC78854.1"
FT                   /translation="MISKETLFALSLFPYLGFLWFISRSPQMPRLALYGFYGTLVFVAI
FT                   TIPAGIYAQLHYGESLANVDWLHGGAEVFLTLSNILLVLGFGHAVRQLQIKNQK"
FT   gene            complement(85884..86219)
FT                   /locus_tag="Npun_R0053"
FT   CDS_pept        complement(85884..86219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78855"
FT                   /db_xref="GOA:B2J2G3"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G3"
FT                   /protein_id="ACC78855.1"
FT                   /translation="MHTLSIPTWIIHISSVIEWIVAIWLIWTYGELTNNRNWWGLSLAM
FT                   LPALVSAMCACTWHYFDNAESLEWLVTLQATMTLVGNFTLWAAAFLIWRSTKSSNTVEP
FT                   EPIKLEQ"
FT   gene            86418..87464
FT                   /locus_tag="Npun_F0054"
FT   CDS_pept        86418..87464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0054"
FT                   /product="polysaccharide pyruvyl transferase"
FT                   /note="PFAM: polysaccharide pyruvyl transferase; KEGG:
FT                   ana:alr4509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78856"
FT                   /db_xref="GOA:B2J2G4"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR019896"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G4"
FT                   /protein_id="ACC78856.1"
FT                   /translation="MVKMRALLSGYYGKGNGGDEALLATLLQMLPSHVTPVVLSGNPEE
FT                   TRDRYNVETYDRMAPLAVLQALRSSDALIWGGGSIIQDVTSTISPFYYGGMMALAQKMG
FT                   LKTVAWAQGIGPLVRPQTRWLARQTFGNCTKVSVRDRASAALLSDWQIPCIIAPDPVWA
FT                   LESKPVPGLWDLPAPRVAVTLRSHPQLTETRLANLTRALVDFQKATQAFILLLPFQKSE
FT                   DLSIAEAIQPHLKDVSQILCLEDPQLLKGVFRGVEMAIGMRLHSLIMAAAEGCRCFALS
FT                   YDPKVNRLMEDLEMPGWDLASLPNDPNLISLTWMEHYANGDPLSPDQIQSLVDRALIHR
FT                   ELLSQAFI"
FT   gene            87614..89074
FT                   /locus_tag="Npun_F0055"
FT   CDS_pept        87614..89074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cef:CE2075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78857"
FT                   /db_xref="GOA:B2J2G5"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G5"
FT                   /protein_id="ACC78857.1"
FT                   /translation="MINFGFWNLIIVIVVALVLKNNWRLDDDEKAAWKNSLFLKSSAIQ
FT                   RLMQFLRQPIVNFIIQAVVVLVVTRFLCYTGWLVYFLNQPNPPLWDFKWFYVASKLAHQ
FT                   HLSPFNVEVFNQSFCSLTKTCGFIPPFVYPPNIIPLIWFLGYFSINTAFTIWIVMHILA
FT                   IGLALWGVNILLESKSPAFRTICTISAALIYGLVRDLQVGNLAIFVAVLILWMFILARK
FT                   YQDIPAGLCLGIAVCKPTLAALFILYFLLKRRFSLVFVSVITGTSLVFLGLALTGNSVT
FT                   QYLPDTARGFALWLNDPSNSPYLSITRLDLMVVGPRLLPNNPLFAKLLSDFIVLILVSF
FT                   VGWYWYLQQSLTAWSKEIYLAEIVLVSCLSIAINYSQQTSTVMLIPAVVFLLNDFLYQI
FT                   RYYKFSMSRMSVWLAGVCFLAVQTAVIHGWLIGSLANRWDVKAGKLPYFLKVTIFALPS
FT                   YAILGITLSILVLAISSLRQKQLLKFEP"
FT   gene            complement(89226..90005)
FT                   /locus_tag="Npun_R0056"
FT   CDS_pept        complement(89226..90005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0056"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   ava:Ava_1419 protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78858"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G6"
FT                   /protein_id="ACC78858.1"
FT                   /translation="MHTWHWRNWEGLPYLTCSILEHWHHGFFTQQFWPRSPQVITEVLQ
FT                   PEASVYRLKQVHGNTVLTPQEVESFLSTAEDDLASADGLMSEQPLQAVWVASADCTPVL
FT                   IGDVKTGRVAALHAGWRGTAKKIVPLAIARLQSQGSKLDDLRIAMGPAIAGEVYQVSIE
FT                   VAAEIGASIISHNDEEKILTALHELPNSPLLEDPDPGKVRLDVRRVNTLQLENMGISAE
FT                   QIAIAPYCTFQTPEHFFSYRREKEKKVQWSGIVSAKR"
FT   gene            90083..90901
FT                   /locus_tag="Npun_F0057"
FT   CDS_pept        90083..90901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0057"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; KEGG: ana:alr5256
FT                   biotin acetyl-CoA carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78859"
FT                   /db_xref="GOA:B2J2G7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G7"
FT                   /protein_id="ACC78859.1"
FT                   /translation="MGFNLQNLESALKAGRKYTYLPFSPHFFESVSSTNQTLWNLLHQG
FT                   AISGTVVIATQQSAGRGQWGREWISPIGGLYVSVAISFDRKIEATDSYQLTFATAWGIA
FT                   SQLRQCGIDVGIKWPNDLVLNSRKLGGILTETKVNKGQITQAVIGVGINWTNPVPDTGI
FT                   NLESWQASQDFRPISSLEILTSKVLLGIESGMECLQQEGVSILLSRYLDLLTNMGDRVY
FT                   VNNLLGTVVGVTPQGNLRVDLETHDTKELITPEIYIQPGTISLGYHKSSV"
FT   gene            90992..92569
FT                   /locus_tag="Npun_F0058"
FT   CDS_pept        90992..92569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0058"
FT                   /product="peptidase M23B"
FT                   /EC_number="3.4.24.75"
FT                   /note="PFAM: peptidase M23B; KEGG: ava:Ava_1417 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78860"
FT                   /db_xref="GOA:B2J2G8"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G8"
FT                   /protein_id="ACC78860.1"
FT                   /translation="MTQRNNSAHHRLHLWQQGLTKKRFASTLPAQSLCWLSSVSLLSGG
FT                   FVFAQTETQVDNIVPTVETSQPTVVPNPVNTERSQSVKKQAVAPEAVQAQPEFSQRRAR
FT                   LKQRLRKPEVAQSKEPIRQSTPKIEAAEPVVIIRQSKPKVETSQVTPARVRQEKPNTPV
FT                   RYAPEKLPEVAQPSNNSNSSVSATPGKTKDYNNAYIDPNSYDSGATGTYQAPNSVILTE
FT                   RSSGCRAILPSGQSVLGGVCAKVPQRNVADSNGKVAPNWLRRSQNAQLPVVPTARQVAT
FT                   TGNTSRWRATQNGYSGDTKTAYRPNRFIPSPSEFSPTRVSATPIAPSGGTLPPPMADGN
FT                   IAPRPSNVAYDFSLASVLPQIPYTGAVAYNGTGMMYPLSIPAPITSLFGWRVHPITGNQ
FT                   RFHAGTDLGAPTGTPVLAAAAGQVETANWMGGYGLTVILNHKSAEQTLYGHMSEILVQP
FT                   GQWVQPGTLIGRVGSTGASTGPHLHFEVRHLTPNGWVATDPGVELQSALSQLVRGLQTA
FT                   QVSQEPGS"
FT   gene            complement(92670..93350)
FT                   /locus_tag="Npun_R0059"
FT   CDS_pept        complement(92670..93350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0059"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: ava:Ava_1416 riboflavin
FT                   synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78861"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2G9"
FT                   /protein_id="ACC78861.1"
FT                   /translation="MFTGLIQALGTIEPLGGDSWQITCVSHSGEVIMQDLAYGDSVAVD
FT                   GVCLTVEKVLKDGFIATASPETLRRTTLGGEQTQQRYVNLEASLKVGSKVGGHFVMGHV
FT                   DGIGRLLVAEQTASSWEMTFIASDAIARYIVPKGSIAVNGISLTVAAYDSELSQFKVAV
FT                   IPLTYSETNLRYLVAGSLVNLEGDILGKYVEKFLYSGNPNTTVHDETSLDGITPAFLAE
FT                   HGYL"
FT   gene            93691..94188
FT                   /locus_tag="Npun_F0060"
FT   CDS_pept        93691..94188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0060"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   ana:alr5259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78862"
FT                   /db_xref="GOA:B2J2H0"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H0"
FT                   /protein_id="ACC78862.1"
FT                   /translation="MIEMKVAGIALDAITRSPIVLLKDSSDRRALPIYIGQEQARAIMG
FT                   ALENQKPPRPLTHDLIVNLLETWNMTLEKVIIHSLQKDTFYAALIVQQGEVKKEIDARP
FT                   SDAIAIALRTNTPIWVMEEVIADASIPVDRDADEAEQQAFREFISNLRPEDLIKRFGNG
FT                   DS"
FT   gene            94338..95468
FT                   /locus_tag="Npun_F0061"
FT   CDS_pept        94338..95468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0061"
FT                   /product="aldo/keto reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ava:Ava_1414
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78863"
FT                   /db_xref="GOA:B2J2H1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H1"
FT                   /protein_id="ACC78863.1"
FT                   /translation="MQYRRFGKTNLHLSVFSLGTMRYLASFENAHQIIEQALALGINHL
FT                   ETARGYGKSEEYLGRALKAGLSIPRTKLYITTKISATADADTMRRYIDESLERLQLDYL
FT                   DCLGVHGLNTWQHLEWVQAKNGCMKAVEEAVADGRVRHVGFSSHGSLELIQAAIKTNFF
FT                   EFVNLHYYYFFQRHAPAIQLAAEKDMGIFIISPADKGGKLYTPPQTLKDLCHPYSPLEL
FT                   SYRFLLGDNRINTLSIGPANPDELIEPLQVADHDGELKSAEISAFQRLENHQKLALGTD
FT                   KCSQCYACLPCPENINIPEVLRLRNLVVAYDMKDYGQYRYGMLENAGHWFPGMKSDRCT
FT                   ECGDCLPRCPEKLDIPELLEDTHQKLNGKAGRRLWG"
FT   gene            95679..97442
FT                   /locus_tag="Npun_F0062"
FT   CDS_pept        95679..97442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0062"
FT                   /product="ABC transporter related"
FT                   /EC_number="7.3.2.3"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ava:Ava_2224 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78864"
FT                   /db_xref="GOA:B2J2H2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H2"
FT                   /protein_id="ACC78864.1"
FT                   /translation="MNLVWTTSRTLTILLASLTLVAGLLPAAISYISKLIVDAVVFASQ
FT                   VNSHNNGFVNIYPSLFYVGLEAIAVILLAGSQRGILICQSLLRALMGQRVNVLILEKAL
FT                   TLDLRQFEDSEFYDKLTNARREASVRPLSLVNRTFGLVQNALSLITYGILLVNFSVWAV
FT                   VVLILAAMPVFIAETKFAGEGFRLFSWRAAETRQQHYLENLLAREDFVTEVKLYQLGEM
FT                   LLGRYRNLFHQLYGEDRDLTLRRGFWGYLLGLVSTSAFYLAYAWIVLETVRGKISLGDM
FT                   TMYLTVFRQGQSTFSNALTSIGGMYEDNLYLSNLYDFLEEEVPKSWGKATIGLNPQDGI
FT                   RFENVSFTYPGSSKPALTNISLHLKPREKLAIVGENGSGKTTLIKLLTRLYTPDSGRIF
FT                   LDGLDLQEWDVDVLRRRIGVIFQNFVRYQFSVGENIGVGDVEHLENKNRWETAAEKGMA
FT                   QSFIDQLPQSFQTQLGRWFKGGQELSGGQWQKIALSRAFMRSQADILVLDEPTSAIDAQ
FT                   AEFEIFNHFRAITQNQMVLLISHRFSTVRMADKIVVIENGEVIEQGTHEELLQLKGRYA
FT                   KLFLLQAAGYQ"
FT   gene            complement(97591..98013)
FT                   /locus_tag="Npun_R0063"
FT   CDS_pept        complement(97591..98013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0063"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   syf:Synpcc7942_0758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78865"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H3"
FT                   /protein_id="ACC78865.1"
FT                   /translation="MKIKDIAKTRCILTFGYGNRKDYDAFLEYLQKFDVGCVVDVRMVT
FT                   RAWSRKWYGDKIKIFCELNNIEYISKTALGNTSGKENWIPINQEEAKKALHEIAQIAQT
FT                   GNILLLCAEMNPNRCHRKEVADCLGNLVSIPVKHLE"
FT   gene            complement(98045..98828)
FT                   /pseudo
FT                   /locus_tag="Npun_R0064"
FT   gene            99008..102541
FT                   /locus_tag="Npun_F0065"
FT   CDS_pept        99008..102541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0065"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; homocysteine S-methyltransferase;
FT                   Methionine synthase, B12-binding module, cap domain
FT                   protein; Vitamin B12 dependent methionine synthase,
FT                   activation region; cobalamin B12-binding domain protein;
FT                   KEGG: ava:Ava_3052 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78866"
FT                   /db_xref="GOA:B2J2H4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H4"
FT                   /protein_id="ACC78866.1"
FT                   /translation="MTHSFLERLRSPDSPVLVFDGAMGTNLQTQNLTAEDFGGPQYEGC
FT                   NEYLVHTKPEAEAVAKVHRDFLAAGADVIETDTFGSTSLVLAEYDLADQAYYLSKTAAE
FT                   LAKRVAAEFSTPEKPRFVAGSIGPTTKLPTLGHIDFDTMKATFAEQAEALWDGGVDLFL
FT                   VETCQDVLQIKAALNGIEEVFAKKGDRRPLMVSVTMESMGTMLVGSEISAVLAILEPYP
FT                   IDILGLNCATGPDLMKPHIKYLSEHSPFIVSCIPNAGLPENVGGQAHYRLTPLELRMSL
FT                   MHFVEDLGVQVIGGCCGTRPEHIQQLAEVAKDLKPKVRQPSLEPAAASIYTTQPYDQDN
FT                   SFLIVGERLNASGSKKCRDLLNAEDWDGLVSMARAQVKEGAHILDINVDYVGRDGVRDM
FT                   HELVSRIVNNVTLPLMLDSTEWEKMEAGLKVAGGKCLLNSTNYEDGEPRFLKVLELAKK
FT                   YGAGVIIGTIDEDGMARTADKKFAIAGRAYRQAVEYGIPPTEIFFDTLALPISTGIEED
FT                   RENGKATIESIRRIRQELPGSHVILGVSNISFGLTPASRMVLNSVFLHEATTAGMDAAI
FT                   VSANKILPLSKIDARHQEICRQLIYDERKFEGDVCVYDPLGELTTVFAGVTTKRDRSLD
FT                   ESLPIPERLKRHIIDGERIGLEEHLKKALEEHPPLEIINTFLLDGMKVVGELFGSGQMQ
FT                   LPFVLQSAETMKAAVAFLEPFMEKSESGNNAKGTFIIATVKGDVHDIGKNLVDIILSNN
FT                   GYKVINLGIKQPVENIIKAYEQHKADCIAMSGLLVKSTAFMKENLEVFNEKGISVPVIL
FT                   GGAALTPKFVYEDCQNTYKGKVVYGKDAFSDLHFMDKLMPAKATGNWEDLQGFLNEVET
FT                   AEVSTNGHKEPKTKTAEETSAEPKVVDTRRSEAVAVDIERPTPPFWGTKLLQPSDIPIE
FT                   EIFWHLDLQALVAGQWQFRKPKEQSKEEYQAFLAEKVYPILETWKQRIIEENLLHPQVI
FT                   YGYFPCQSEGNSLHIYDSENQSQQITTFEFPRQKSLRRLCIADFFAPKESGIIDVFPMQ
FT                   AVTVGEIATEFAQKLFADNQYTDYLYFHGMAVQVAEAVAEWTHARIRRELGFTAEEPDN
FT                   IRDILAQRYRGSRYSFGYPACPNIQDQYKQLELLQTDRIKLYMDESEQLYPEQSTTAII
FT                   TYHPVAKYFSA"
FT   gene            103560..108260
FT                   /locus_tag="Npun_F0066"
FT   CDS_pept        103560..108260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78867"
FT                   /db_xref="GOA:B2J2H5"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H5"
FT                   /protein_id="ACC78867.1"
FT                   /translation="MPRKRQLVKAIQKTFKQISKQFLSAINKQIIWLLRAFFGNRRRHS
FT                   SANAGFVLPTVAMVILVVVLLTTAILFRSFERSKNASNVRVNEAVLNAANPAIDRARAK
FT                   IDALLQDPTLPRGTPSDSALYDVLKKDKYRLGDETRLKLAFDIDGNNSIDTSSALENDE
FT                   TLKSAWKFAVDTDNNGKKDTFTLYGIYFRTPPRNSSGEFSRERKTLEARTPPMDGSSNQ
FT                   NCGSASGFSSLVGNSSWYKLNSGNLGKSFFVYSVNVPITQIGGLDATQYETYKGNKSVV
FT                   ALEFQQDRTRIPLSNNAVWFENDLEVIVGSTTLLLNGRIHTNANLLVGVINSGGNITLR
FT                   QVSSKTSCFYNEENGQISVGGNVGNGSLAQNNTGTSVNVDLFQGFGNNTNTDYINNTNK
FT                   STSSTGGAEIGFNDAAFNKRIAAMKTTAIALCTTCNAAATTTGSALKAAVNASGYPSDV
FT                   KTNVTAKVLDTDDITTAKNILYDEIEVYLRNRTRRVPFAEVADATGGDQTVGYTAITAS
FT                   LDPQQTWREPVNASNQLTGATSITLTTSQLEETYPDLQKKEGVQTKLGDRVLVGNNLPA
FT                   LWQQGTQYVGTEANQLISSGGTVVNWTRPTGSDAQQRWRNTQIQAVTDLGLSDRNGFWE
FT                   ENATVNPVNDLDSVGGVRIVTGAGIYVDGSGSVPNTITGPFYPRGSSALGSFLTAPSTD
FT                   TTIVWPDTMPMSTPGNGRSGDLKMRATAVYHYKVDYGTDQEPIACVSSYYDPSTADTAK
FT                   NKVNQDGGYGVDTTNGRSNNGVVYNFPGRTSFTINKTRLQLQANLKFPNGRWVNQPLKD
FT                   ALTKIGTATTVPSTGLQLADYSAIDTALCAISIFSSPTSFVTPTNQPAHGAIREASFLD
FT                   AREAKQISPSNTSSTYDLDLEQRQPLEVRVTDIDLGSLATTAITANEYLLPYSGIIYAS
FT                   RDDALRDASEPYTEGNVSSTSNSELLSPTDFKLDPTRRPNGIRLINGGTLARTSTNAYN
FT                   AKEKGLILVTNLPVYIKGNFNLHRTSTSSTTEIEEFTVSASTDFYGRSTREDRFACRQG
FT                   RTGCPTTGGDFWRPATIIADSMTLLSGSFIDGVRSQGDYDLNNNTGIAVEGNLNTTNFP
FT                   SIPTLDARRRDRLKNGFWENDFLTSTNWQSTASGQINYPNLSLGSYALNGVTPIQRRIN
FT                   NSTATNNPGEYLMEVCTKLSVSDCGPDDWYVDPSTSLKASAAVGQTFSITTHKAGTTAV
FT                   FATSEYARYPRRVAFKRNASNQLEEQGSSNKYVPLGIDDSGIIQEFAYSSGGLPRAKQN
FT                   ALWFRTSTDASIANLGKVSYDFNNRLYYYLPIDADGDGSADSTGQPLLVPVLQIHDASS
FT                   TTGIRGDGTAQNEFRDNWIQQPSDNITVYNATFVLGNSPSRAAETSAGFQNFVRFLENW
FT                   NLKTAKISGSFIQLKRSSFSTGPISPIFAAKSTTGATNTANDTTANLSLFDYALDTYPT
FT                   PNGSGLLPFYNAPTNRSWGFDVGLLSEQPDLFAQRFTLTPSGRPNEYFREVGRDDTWVK
FT                   TLLCAGEASNQTGIPASGVTVTYANAVPNEYRPTSSCPSSIPDDSV"
FT   gene            108282..108962
FT                   /locus_tag="Npun_F0067"
FT   CDS_pept        108282..108962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78868"
FT                   /db_xref="GOA:B2J2H6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H6"
FT                   /protein_id="ACC78868.1"
FT                   /translation="MMIGKQAKNKRLQTARSYLRASEGGFTIIESLVAILVVSILLVAI
FT                   APVLSLSVATRVQSRRIELATQAAKSYIDAVKTKKIAAPTSTGTDTLTAYAAPTATGTL
FT                   TCAANSYCTVPTGTSLYCVDFDSSGACENTSVTDMIVEGFRYNLASTSAISGYALGVRV
FT                   YRADAFKDSTTLLKNTSTTKTTQATFTGGIGQRTTPLVEMTTDINDTVPKYSDLCARYT
FT                   GGCN"
FT   gene            109090..110058
FT                   /locus_tag="Npun_F0068"
FT   CDS_pept        109090..110058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78869"
FT                   /db_xref="GOA:B2J2H7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H7"
FT                   /protein_id="ACC78869.1"
FT                   /translation="MINSLKFILSTQLKRSGINKTISGFTLIELLVAMVMAILIITPLM
FT                   AFMINILDGDRKEQAKATSEQEIQAALDYINRDLQQAVYIYDADGVTRNADTTITNSGI
FT                   KNQIPPLKSATSCSDSTICKPILVFWKRQLIADSVGINASTETSAANTDDGFAYSLVAY
FT                   YLITNTDGANSTWSKEARIGRFELRGPVNATNANTTGSATDSGFNPPSLNKNGTLLKDK
FT                   MDQWQAASANYSNQVVTLVDYISTTAPSSTAPCSSPNLVGSQTSGFFACVDANDVLAQV
FT                   YIRGNALARVQNNNLAYANNTKTYFPSSSIRVQGRGFLFSK"
FT   gene            110087..110785
FT                   /locus_tag="Npun_F0069"
FT   CDS_pept        110087..110785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0069"
FT                   /product="conserved hypothetical protein, PilA"
FT                   /note="KEGG: ava:Ava_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78870"
FT                   /db_xref="GOA:B2J2H8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H8"
FT                   /protein_id="ACC78870.1"
FT                   /translation="MQGAALLRLNKIPKQFVVETPKQASLANRLRYVSAYFQKDAGFSL
FT                   IELIVVMLLVGILSAIAAPGWLAFVNRQQVNKVNDAVLAALQQAQREAKNKKLNYSVSF
FT                   QKNSTTQNVEVAIYRSDGSPTWKPLGADIGVSSNKFLIGTNLSSENTAGSSVSDTLSAS
FT                   TKITFDYMGTLPNANFGTITAPATEAPGLKIVVAVPNSANSTSASSTKRCVIVKTLLGS
FT                   MLTAKDDKCS"
FT   gene            110985..111950
FT                   /locus_tag="Npun_F0070"
FT   CDS_pept        110985..111950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0070"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ana:all1768 probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78871"
FT                   /db_xref="GOA:B2J2H9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2H9"
FT                   /protein_id="ACC78871.1"
FT                   /translation="MTENLDITIAIPTYNGESRLPELLERLQNQIHTDNLSWEIIVVDN
FT                   NSTDNTAKVVETYQQNWQCPYPLKYCFEAQQGAAYARKRAVAEAKGRLIGFLDDDNYPV
FT                   SNWVYAAYTFGEKYPKVGAYGSQIHPDWEIEPPENFQRIAPFLAITERGNLPLLYEPAK
FT                   KLLPPSAGLVVRKQAWLESVPDKPILTGRVQGNMLTSEDLEMLSYIQKSGWEIWYNPEM
FT                   EIFHKIPTSRLQKDYLIPFFRGIGLSRCVTRMVNIKEMYRPFFILAYMINDLRKIALHL
FT                   LKYNTLLKSDLVAACEMQLFLSSLFSPFYLLKNGYLTKKQ"
FT   gene            111963..112952
FT                   /locus_tag="Npun_F0071"
FT   CDS_pept        111963..112952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0071"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ava:Ava_0269 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78872"
FT                   /db_xref="GOA:B2J2I0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2I0"
FT                   /protein_id="ACC78872.1"
FT                   /translation="MDKHTLGSLDFTVSIPTYNGAKRLPKVLDLLLNQTGVENLNWEII
FT                   IIDNNSKDDTNKISEYYQNFSNKNFSVRYFLEKEQGIAFARMRAINEARGEFIAFIDDD
FT                   NLPANDWVLQSYLFGKEHPQAGAWSGQIHGDFEVNPPKDFARIQAFLAIREHGLKPYLF
FT                   DADNLRLPPGAALVVRKQAWCESVPEQLVFKGRLTKLMVAGDDTEALLYLHKEGWEIWY
FT                   NPAMHIDHQIPHWRLEKDYLLVLARGCGLCIFQLRLINAKNWQKPILFVKTILGNLHRL
FT                   LHHLIKYRGQLESNLIAVFEINFYLASMMSPFYSLRWKLDKIFKTRSI"
FT   gene            112954..114030
FT                   /locus_tag="Npun_F0072"
FT   CDS_pept        112954..114030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0072"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ana:all1766 probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78873"
FT                   /db_xref="GOA:B2J2I1"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2I1"
FT                   /protein_id="ACC78873.1"
FT                   /translation="MIKSTLNKTLISVIIPAYNSEKTIKKTIESVLNQTFHNFELIVIN
FT                   DGSQDSTLEVIRKIPDSRIQVFSYPNAGGNVSRNRGLNHAVGKFVSFLDADDVWTPDKL
FT                   QHQLKALQKNVTAKVAYSWTDYIDEKGEFILSGKRVTANGNVYESLLLNNFLENGSNPL
FT                   ICRKALITLGGFDESLGAAQDWDMWLRLAYKFNFICVPSVQILYRITPNSVSCNLVRQE
FT                   KSCLQVLERAYKERPSLRDANGTTLKDSWNLCLANLYKYLVCKALQKPLNRKKGIAAAI
FT                   FLCKYFIYDPSRLQNINFTLKLSLKIVIILILPTLLDIITNQRQVRRQETETLLNDWVV
FT                   EKRSENKNGYPGAFTVSS"
FT   gene            113996..114565
FT                   /locus_tag="Npun_F0073"
FT   CDS_pept        113996..114565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78874"
FT                   /db_xref="GOA:B2J2I2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2I2"
FT                   /protein_id="ACC78874.1"
FT                   /translation="MDIQVHLPSLVNAKKLLNKHSCSGFTLLEMLVVVVLIGILATLGI
FT                   ANWLAFVETRRLNTAQNEVQLAIHQARRQATKEKLTWQASFREQDGIIQWAVHPATINP
FT                   STANWNNIDSNVRLDSETTLQLSNNIRKVQFDYRGNAKSPNDLGRITLSSKSGGKVKRC
FT                   VIVSTILGAMRTAKEHTTTDDDKYCY"
FT   mobile_element  complement(114563..115565)
FT                   /mobile_element_type="transposon"
FT   gene            complement(114623..115516)
FT                   /locus_tag="Npun_R0074"
FT   CDS_pept        complement(114623..115516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0074"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ter:Tery_1717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78875"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B2IT26"
FT                   /protein_id="ACC78875.1"
FT                   /translation="MLNIEGALKQDRLLRALTGLNRKAFDALLPTFTTMYLDTQQAKPR
FT                   QRGLGGGRKARLLTAQDKLFFILFYFKCYPTFDVAGLLFDMHRSQAHEWMHRLQPILEA
FT                   ALGQKMALPERHLESIEAFLSRFPGVQRVMIDGTERPIARPQEREQQQQNYSGKKKRHT
FT                   RKHLAAVDETKRVLILSKAREGKLHDKRFHDEDDIAGSVPDEIPIEVDSGFQGLQKQYD
FT                   NLHLPHKKPKGGKLSDLQKTENRQLSQSRVVCENAFAGVKRYNAASVIYRNRIENFDDH
FT                   LMLTAAGLWNFYLMAA"
FT   gene            115604..116251
FT                   /locus_tag="Npun_F0075"
FT   CDS_pept        115604..116251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78876"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2I4"
FT                   /protein_id="ACC78876.1"
FT                   /translation="MLNLPANPKQHLIIFTRYPEPGKTKTRLIPALGNLGAANLQREMT
FT                   EYTIFQVQELQKAIAISVEVRFAGGDLQLMQDWLGLDLVYQSQGEGDLGSRMAQSLFDA
FT                   FQSGAEKVIIIGTDCPGVNSQILATAFEKLHTFDLVLGPAIDGGYYLIGLRQAIPELFV
FT                   NIEWGTAQVFQKTVDIAQKLYLSHVNLSPLADVDRPEDLPIWEQALVGEVKG"
FT   gene            116386..117705
FT                   /locus_tag="Npun_F0076"
FT   CDS_pept        116386..117705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0076"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ava:Ava_2576 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78877"
FT                   /db_xref="GOA:B2J2I5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B2J2I5"
FT                   /protein_id="ACC78877.1"
FT                   /translation="MARKRPARTGNPDLRQQKQVPMPPIEEIEQKIYSLLSPLNFKPLK
FT                   LYETEEKKPFRDRILTLSVMMALVVSLVYRQIPGLREVQRVLCEEGLLWAGRIEVSAQA
FT                   VSKRLRTLPIELFAQIFEQVMERMNVQPQNQAVPENWQPVCAKFTAIWIADGSTLEALR
FT                   RKLKVLQEQEKTLAGKIMMVVEAFSHHPVTTWYTQNSKANDKTWCEQLLERLPIGGLLI
FT                   FDLGFFKFPWFDAFTEADKFFLTRLREKTSYKVIRCLTNASFYRNEIISMGEYRSNPCQ
FT                   HQVRLVSVLWGSTWYYYLTNVLDPQMLSAHLVCELGSRRWRVEDAFLLTKRLLGLAYIW
FT                   VGDNNGVQIQIFATWIFYAVLNQLCIDIAIALNQPLDRISTEMVFRALYHFSQAVLRGD
FT                   AHEAVPYLVERQKLFGLVKARRKRHREIDAYTQQIWAKSS"
FT   gene            118028..118870
FT                   /locus_tag="Npun_F0077"
FT   CDS_pept        118028..118870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78878"
FT                   /db_xref="GOA:B2J3E8"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3E8"
FT                   /protein_id="ACC78878.1"
FT                   /translation="MVNRFTSVSTALTVKVVGIICILSFFVDFLILLLPFQPTDRVWQI
FT                   NLATALVDRGIVPLVGLGLLFAAYWIENADAGSDRPQGIDLRFPAVILSSILGLMFLLI
FT                   FPLHLNNVNQAKTQTLNRITQEADQAEAQLNTRLSQLQAQLNTEQGKAQLDQLRTQTKA
FT                   QFSEILKDDQKYKQALESSQIPPNIKELLKKAKTDPQALDKAIEQQTDIQTLRTQQLSQ
FT                   VRQRREEAEQQAKDTAWKSGLRIGISSLLLSIGYIIIGWTGLKGMGAVQGGKPKATAR"
FT   gene            118995..119903
FT                   /locus_tag="Npun_F0078"
FT   CDS_pept        118995..119903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0078"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ava:Ava_0274 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78879"
FT                   /db_xref="GOA:B2J3E9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3E9"
FT                   /protein_id="ACC78879.1"
FT                   /translation="MFSIYILTYNEELDIAACIESAMLSDDIIVVDSCSSDRTVEIASS
FT                   YPIRVVQHAFESHGRQRTWMLESIPPKHEWVYILEADERMTPELFAECEKVSQNLDYIG
FT                   YYVAERVMFMNRWIRYSTQYPRYQMRLFRHGKVWFTDYGHTEREVCDGATSFLKETYPH
FT                   YTCSKGLSRWIDKHNRYSTDEAQETLYQLEQGKVNWQDLFFGKSEVEKRRALKDLSLRL
FT                   PARPLLRFVYMYFMLGGCLDGHAGLAWCTLQAFYEYLILLKVWEMKYLPKPNLDVTAIL
FT                   AQESPQQIQCADSETTQADVV"
FT   gene            120434..121198
FT                   /locus_tag="Npun_F0079"
FT   CDS_pept        120434..121198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0079"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   ava:Ava_0275 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78880"
FT                   /db_xref="GOA:B2J3F0"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F0"
FT                   /protein_id="ACC78880.1"
FT                   /translation="MDTNNKSSSSLKQENRGLVIDRLKQDLKNDLIAGLLVVIPLATTI
FT                   WLTITIANWVINFLTQIPKQLNPFDGLNPIVVNLLNLLVGLAVPLLCILLMGLMARNIA
FT                   GRWLLDFGERLLQAIPLAGQVYKTLKQLLETILKDSNGKFRRVILVEYPRRGIWAIAFV
FT                   TGAISSDIQAQMSRPVLSVFIPTTPNPTTGWYAVVPEDEVVNLSMSIEDAFKIVVSGGI
FT                   VAPNTPLVFPKESNLEVKHDEANRQVISVEET"
FT   gene            121321..121962
FT                   /locus_tag="Npun_F0080"
FT   CDS_pept        121321..121962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0080"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: ava:Ava_0276 transcription
FT                   antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78881"
FT                   /db_xref="GOA:B2J3F1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3F1"
FT                   /protein_id="ACC78881.1"
FT                   /translation="MQPRKPQQIARELALLSLSQLPVNPKKLDTLLDDQLVSKLVLGAV
FT                   RTLTSEVQDTLNNAAGELQRSNDRLLSSQTRASDLNSARTMLQEAIACTQTAINQLGTA
FT                   VDFPELIQLANQDKGVRNYAKELVITVNENRHIIDELLSTALVDWQVTRLAQLDRDILQ
FT                   IAVAEMKFLGVPDSIAINEAVELAKRYSGDDGHRFINGVLRRVTEQKKTA"
FT   gene            122223..123866
FT                   /locus_tag="Npun_F0081"
FT   CDS_pept        122223..123866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0081"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: ava:Ava_0277 cell division transporter
FT                   substrate-binding protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54, G- domain; GTP-binding signal
FT                   recognition particle SRP54, helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78882"
FT                   /db_xref="GOA:B2J3F2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F2"
FT                   /protein_id="ACC78882.1"
FT                   /translation="MVFNWFRRQYNDSSETPSDKKQEETTPAQEPQPEPAETSTAETAP
FT                   DTTADLLAFAKAAYKNIQQKQQTEVVETPPDSENASAEPETVETAIAEITESELIDEPV
FT                   STTLETAQPEIIQTATEEENTEDSSVIAIAEEPDVESSEITTNEIEQTRTPEATQPTAP
FT                   ANLSFLERAAAERQAKLDQLIATAIEVPEPEVVQPVAATSEIGEEIPGLVFDDGFVWSA
FT                   KVLAAQGRNPEDVSIEEITWLKKLRQGLDKTRRSILNQLKAIVGQGPLNQAAVTEIEAL
FT                   LLQADVGVEATDFIINALQTKLREEVTAPEEAIAYLKKILRDMLDAPSIASHKTSFTPE
FT                   KETLNIWLITGVNGAGKTTTIGKIAHLGQKSGYKCLIGAADTFRAAAVEQVKVWGSRSG
FT                   VEVIANPGKNTDPAAVVFDAIAAAQSRQTELLLVDTAGRLQNKKNLMDELGKIRRIIDK
FT                   KAPNAKVESLLVLDATLGQNGLRQAEVFSQAAQLSGVVLTKLDGTAKGGVALAVVQQLG
FT                   LPIRFIGAGEGIEDLRPFSSYEFVEALLSS"
FT   gene            125296..126687
FT                   /locus_tag="Npun_F0082"
FT   CDS_pept        125296..126687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0082"
FT                   /product="serine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: ana:all1758
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78883"
FT                   /db_xref="GOA:B2J3F3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F3"
FT                   /protein_id="ACC78883.1"
FT                   /translation="MPVSQLPSQPTDNNSSAATDVTPVVALKELVARLHREQNKIQDLL
FT                   SSLGFALRSFNNLNQFLELIPLMATRVTDADGSALFLYKPNGQVRLEQLHWQDSGQRKN
FT                   IRKALEIASSQITLLPNAAPLANATGILDDQMHRYLGPDVQIFGTAILVKHTERGWLYV
FT                   LSRDPEYSWTETRQKLVRLVADQTAVAIENDELAVELRKKERLDQELEIGAEIQRRLLP
FT                   RQCPTIPGAVLAARCKPANRVGGDYYDFIATNQNKIRSKTKGDTETGRWGLVIGDVMGK
FT                   GVPAGLIMTMMRGMLRGEVLHGNSPAKILQNLNRVMYADLENSHRFVTLFYSEYNPHSR
FT                   ILSYSNAAHNPPLWWHAATKTVSRLDTLGMLIGLDANSQYEDAQVQLEPGDTIIYYTDG
FT                   LTDAAAAGGDRFDEDNFVAGFNTACKYCNGPEEIVDYLFDQVQQFIGDDKQNTDDMTLV
FT                   VLQIL"
FT   gene            complement(127265..128548)
FT                   /locus_tag="Npun_R0083"
FT   CDS_pept        complement(127265..128548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78884"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F4"
FT                   /protein_id="ACC78884.1"
FT                   /translation="MTENNDTLLLKAAKSGDIKGLCALLAVGARVDACDRQGTTALMFA
FT                   ANLGYTEIVRSLLDAGANINLPRKLYGLTALMLAASAKQLDILKLLVSKGADVNATNED
FT                   GSTALMAAVLKGHINVVRVLLAAGAEVNIADKDDDTALKLAIKQGNIEILQTILQTGVD
FT                   VNIPDQEGETLLTLAADLGHLEVVEALLAAGANVNVKNADGGTALLAAAAGGHSAIAAA
FT                   LLDRGAEINLQDQDGETALHLAVVEGYIDIVQVLLNRGGDVQIRNRLGDTPLLVAALQG
FT                   HSKIVEALLCSGGDINEKNLGEVPLTLAVSQGHTQTVKVLLDYGADANTLGNDGKTALI
FT                   KATERKHTEIIHLLLAKGADVNFQDSARATSLMWAASAGYGEIVQLLLQAGADVNLKNR
FT                   GGYTALMIAEFNGYKNVVRSLQKAGAQE"
FT   gene            128824..129294
FT                   /locus_tag="Npun_F0084"
FT   CDS_pept        128824..129294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78885"
FT                   /db_xref="GOA:B2J3F5"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F5"
FT                   /protein_id="ACC78885.1"
FT                   /translation="MSLELSASVKYWLNFFHPVLMWALLVLSIYAAYLGLQLQRTRNAQ
FT                   GEEKKELIKGRYNVRHYQIGSILLGLMVASAIGGMGVTYINNGKLFVGPHLLAGLGMTG
FT                   LIAFSAALSPYMQKGANWARATHILLNFTLLGLFAWQAVTGVQIVQRILTKA"
FT   gene            complement(129352..130023)
FT                   /locus_tag="Npun_R0085"
FT   CDS_pept        complement(129352..130023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78886"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F6"
FT                   /protein_id="ACC78886.1"
FT                   /translation="MLSRQGEYKSWEITEAVLPVASNQEEAKNILTDTNVATITKFYGR
FT                   YQDFMEMPAPAEKVAEYLNAHALWFSRCAEPMKVQLLGENGYALVIGRFGAFGYEVEPK
FT                   IGLELLPPEEGIYRIRTIPIPDYQSPGYDVDYRASLQLIENDACSSGEVTRVEWELDLI
FT                   VDLHFPRFIQRLPKSIIQSTGDRLLNQIVRQVSRRLTRKVQQDFQKSLEIPFSGNSKQK
FT                   R"
FT   gene            130204..130863
FT                   /locus_tag="Npun_F0086"
FT   CDS_pept        130204..130863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0086"
FT                   /product="NmrA family protein"
FT                   /EC_number="1.5.1.30"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; Male sterility C-terminal domain; KEGG:
FT                   ana:alr2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78887"
FT                   /db_xref="GOA:B2J3F7"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F7"
FT                   /protein_id="ACC78887.1"
FT                   /translation="MKAFVAGATGETGRRIVQELIARNIPVRALVRDIEKAKGILSPEA
FT                   ELVVGDVLQPESITAALGDSTVLLVATGAKPSFDPTGPYKVDFEGTKNLVDAAKAKGIE
FT                   HFVLVSSLCTSQFFHPLNLFWLILVWKKQAEEYIQKSGLTYTIVRPGGLKNEDNLDAIV
FT                   MQSADTLFDGSIPRQKVAQVAVEALFEADARNKIVEIVAKPEAASKSFGELFANVA"
FT   gene            131099..131749
FT                   /locus_tag="Npun_F0087"
FT   CDS_pept        131099..131749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0087"
FT                   /product="glycoside hydrolase, family 24"
FT                   /note="PFAM: glycoside hydrolase, family 24; KEGG:
FT                   ava:Ava_4318 glycoside hydrolase, family 24"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78888"
FT                   /db_xref="GOA:B2J3F8"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F8"
FT                   /protein_id="ACC78888.1"
FT                   /translation="MYLLQWYIGDLRSPSDPIFADKQPPLVMKQGDPYIRALMRTISAS
FT                   EASGNRPYSLLYGGQQVNDLSRHPEICVTIITGPNTGNCSTAAGRYQIINITWYRLAPR
FT                   YHPRPMQMMFWTGYSFEAEYQDIVVYRWLTDSKVWGTDLSQLLRQGKLNDVLRRLSPTW
FT                   TSLGYGIETNSVSSSLPKVYQKMLQEELTAANQPIAPNLTPSPTPSRKPVKKP"
FT   gene            complement(131764..132582)
FT                   /locus_tag="Npun_R0088"
FT   CDS_pept        complement(131764..132582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0088"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /EC_number="3.4.11.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ava:Ava_4319
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78889"
FT                   /db_xref="GOA:B2J3F9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3F9"
FT                   /protein_id="ACC78889.1"
FT                   /translation="MILKKYKFNYFLNGNTNKPLIIFLHGFIGNIHEFNEAIKLLSEDF
FT                   CYLTLDLPGHGKTEVLGGDEYYQMESIAQAIINLLDELRIDKCHLIGYSMGGRLALYLT
FT                   LHFPQRFIKVVLESACPGLATEVERLERIRRDAQIARKLSRSILQIDFAAFLSNWYNQP
FT                   IFGYIKNHPQYDRMIENRLQNNPQELDKSLRFMGTGCQPSLWEKLQENKIHILLLTGEY
FT                   DKKFISINTEIAQICEFAQLKIIKNAGHNIHFENTLAFVENIKDFLSTAN"
FT   gene            complement(132814..133215)
FT                   /locus_tag="Npun_R0089"
FT   CDS_pept        complement(132814..133215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0089"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   ana:all2756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78890"
FT                   /db_xref="GOA:B2J3G0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G0"
FT                   /protein_id="ACC78890.1"
FT                   /translation="MNGSNRLGKESLPISQQAEHSQHHDTEHEHTDHTHGTGEPAHPHV
FT                   HSEESLRRIANRLSRIEGHVRGIKTMVQQNSPCPDVLLQIAAVRGALDKVARIVLDEHL
FT                   TECIARAAHEGNIDVEIKELKAALDRFLP"
FT   gene            complement(133573..134778)
FT                   /locus_tag="Npun_R0090"
FT   CDS_pept        complement(133573..134778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0090"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   ava:Ava_2721 protein of unknown function DUF1239"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78891"
FT                   /db_xref="GOA:B2J3G1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G1"
FT                   /protein_id="ACC78891.1"
FT                   /translation="MAYQFHKRGRQGERKIQNYSPTPSFLFLPLIFFLIFGLVSCGGKS
FT                   PPASQENSAASSKQDSNLTFFDVTLEQADEVGRPIWKVRAKQAKYTKEKQIGQAESPYG
FT                   ELYQDGKIVYQIKADVADIEQDGKQLFLKGKIFATDPSNGIVLQGNELEWRPKEDLLIV
FT                   RNKINGTHKQLQAVAQEVRVKTREQRMEFSGKVVANSADPQLQVRTEHLVWNIKEEKLI
FT                   GDRPIQIDRYKDNKISDRGKGNYAEVNLKTKIATIQQNAQLDLLDPPVQIASNSMTWNM
FT                   NAETVTTNSPVRMFQRVENLTVTANQGEMKIPQKTVYLTGNVNAIGQRRQSLQSSTLTW
FT                   YLDNKLVEAQGNVVYRQVDPPLNFTGETAVGNLQTENIVVKGGSSSGRVVTEIIPQEKA
FT                   NR"
FT   gene            complement(134778..135410)
FT                   /locus_tag="Npun_R0091"
FT   CDS_pept        complement(134778..135410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0091"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   ava:Ava_2722 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78892"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G2"
FT                   /protein_id="ACC78892.1"
FT                   /translation="MMLNNFETDSIFTPEQVLENRGRVAIFIDGSNLFYAALQLGIEID
FT                   YTKLLCRLTGGSRLLRSFFYTGVDRTNEKQQGFLLWMRRNGYRVIAKDLVQLPDGSKKA
FT                   NLDVEIAVDMMALVDSYDTAVLVSGDGDLAYAVNSVSYRGVRVEVVSLRSMTSDSLINV
FT                   SDRYIDLEAIKEDIQKTPRQSYPYRPLSGIGFLEDPRTSDGHLEIQE"
FT   gene            complement(135578..137182)
FT                   /locus_tag="Npun_R0092"
FT   CDS_pept        complement(135578..137182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0092"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM:
FT                   methionyl-tRNA synthetase, class Ia; KEGG: ava:Ava_2723
FT                   methionine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78893"
FT                   /db_xref="GOA:B2J3G3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G3"
FT                   /protein_id="ACC78893.1"
FT                   /translation="MNLVNKTEKTFALTTPLYYVNDVPHIGSAYTTIAADVVARFHRLL
FT                   GHQVLLITGTDEHGQKIQRSAESLGKAPQEFCDEVVPSFISLWQLLDIKYDRFSRTTAP
FT                   RHEAIVKEFFERVWESGDIYQGQQQGWYCVSCEEFKEERDLLEGHRCPIHTNKEVEWRD
FT                   EQNYFFRLSKYQNKLTEFYQSKPNFIQPESRRNEVLSFVNQGLQDFSISRVNLDWGFPV
FT                   PVDPKHTLYVWFDALLGYVTALLEPDAEPTLANALETWWPINLHLIGKDILRFHAVYWP
FT                   AMLLSAGLPLPERVFGHGFLTKDGQKMGKSLGNTLDPVSLVQRYGSDAVRYYFLKEIEF
FT                   GKDGDFNEVRFINVLNADLANDLGNLLNRTLSMVKKYCVDNNVPSIGNEGISDENPLKT
FT                   IGLRLGEQVKEAYKELAFSQACGAILSLAQASNKFIDEQAPWSLYKQGQQESVEKVLYA
FT                   VLESVRLAAYLLSPIIPNISSDIYQQLGFGIDFNDQIQSSVTAPFATHATWGILSSKQQ
FT                   LGTFQPVFKRIEPPKND"
FT   gene            137562..138287
FT                   /locus_tag="Npun_F0093"
FT   CDS_pept        137562..138287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0093"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   ana:alr0234 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78894"
FT                   /db_xref="GOA:B2J3G4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G4"
FT                   /protein_id="ACC78894.1"
FT                   /translation="MSRNSPLEISRTLVAALSTQMFRYYEDRIPQDASVLVVSNHRSFM
FT                   DALILMAALSSPIRFACHHYMGQVPVMREIVTGQLGCFPLEETQNRQQSFFSQSQLLLQ
FT                   SKQMVGVFPEGTAPMVKSTQPNQVGEFQRGFAHLALRADVQDLAILPIAIASLEEVNTN
FT                   GFPLRLLSVFDPSEPLFNQAGWHPLVIYRRVAVLIGRPYWITPQHQKKYHGKQARTVVA
FT                   ELTEHCHGEISHLLRQGCY"
FT   gene            138401..139228
FT                   /locus_tag="Npun_F0094"
FT   CDS_pept        138401..139228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0094"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ava:Ava_2725
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78895"
FT                   /db_xref="GOA:B2J3G5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G5"
FT                   /protein_id="ACC78895.1"
FT                   /translation="MTISEVELKPCFLTPKRVQPEYPLLVYLPGMDGTGQLLRSQTAGL
FT                   ETGFDVRSLALPRKDLNTWDVLTKSVLDLIDAELEKSSHRSVYLCGESFGGCLAMKVAI
FT                   QAPHLFKRTILINPASSFRLRPWLSWASQLTYLVPSELYDVGALGLLPFLASLPRISRS
FT                   DRHELLKTMRSVPAETVLWRLSLLREFEVDEEKLSRLTQPVLLIAGGSDRLLPSVTEVK
FT                   RIGNILPNNKIVVLPECGHACLLEQDINLYEILKDNDFLENNADISTGLEVRG"
FT   gene            139339..139533
FT                   /locus_tag="Npun_F0095"
FT   CDS_pept        139339..139533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78896"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G6"
FT                   /protein_id="ACC78896.1"
FT                   /translation="MIPEVWFWEDGVLEVYYLRKEDKALHYERVSSSEEVKGIDLDLLL
FT                   CCILMVNHVDAIKTFQQAL"
FT   gene            139694..140860
FT                   /locus_tag="Npun_F0096"
FT   CDS_pept        139694..140860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78897"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3G7"
FT                   /protein_id="ACC78897.1"
FT                   /translation="MADKSQQEIVVNKSVNSPNETSEIKIQAQSSVENEPSELESFVQS
FT                   VAQTGKAVLDTALEVGEATAKQTHKLIEQTTQTSGQVVNRLSENWLIRKLSGVLNLNWL
FT                   IGTPDAVDLEKAEAAVNKLKQKYPNESPSQIAHRIMVEKATQAGTVGLATSILPGIAVA
FT                   LLAIDLTATTKLQSEMLYQIAFDYGLDLKDPARKGEVLAIFGLALGGGRLLKAAGLGLL
FT                   RNVPLAGAAIAASSNATMIYSLGYAACRFYEAKLDESTSLASPQTLATLKAESEKYLES
FT                   AIAQEAVMDQILVHMILASHPDKTLEEILPELQALKLSPTSLDAIAKNIKSPKSLDILL
FT                   NQLNRDFAIPLLVQCKKVAQLDHKTTPLEQEIIAAIARKFNIDTTIGA"
FT   gene            141455..142936
FT                   /locus_tag="Npun_F0097"
FT   CDS_pept        141455..142936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0097"
FT                   /product="peptidase M17, leucyl aminopeptidase domain
FT                   protein"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein; KEGG: ava:Ava_2727 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78898"
FT                   /db_xref="GOA:B2J3G8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3G8"
FT                   /protein_id="ACC78898.1"
FT                   /translation="MTIQPSDKPLLEWAGDSLAIGLFEDAVELTGELATLDQKFSGVLK
FT                   ELIAEEEFKGKANSTIFTRVNPGRPVRKLILVGLGKPDALKLDTLRRAAAAVARVAKKQ
FT                   KSKILGFSFPLWNNDPAASAQAIAEGVELALYQDIRFKSEPEDKGSQIETVDLLGFSGQ
FT                   EAAITLANQIVSGVNLARELVAAPANAVTPITLAETAQAIAKDYGLQVEILEKEDCEKL
FT                   GMGAFLGVAQASELPPKFIHLTYKPEGTPKKKLAIIGKGVTFDSGGLNIKGAGSGIETM
FT                   KMDMGGAAATLGAAKAIAQIKPDVEVHFISAVAENMISGRAMHPGDILTASNGKTIEVN
FT                   NTDAEGRLTLADALVYAEKLGLDAIVDLATLTGANVIALGDDIAGLYTPDDDVASQIEK
FT                   AAQTSGEKIWRMPMEEKYFEGLKSGIADMKNTGPRPGGAITAALFLKQFVKETPWAHLD
FT                   IAGPVWTDKENGYNGAGATGYGVRLLVNWVLGIGE"
FT   gene            143263..144285
FT                   /locus_tag="Npun_F0098"
FT   CDS_pept        143263..144285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0098"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG:
FT                   ana:alr0238 fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78899"
FT                   /db_xref="GOA:B2J3G9"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3G9"
FT                   /protein_id="ACC78899.1"
FT                   /translation="MGSTRVRIAIDAMGGDHAPGEIVAGALRAKEELGVEILLVGDPQQ
FT                   IEAALPPKTNLAQVEIVPAEEAIAMDEEPLNAVRRKRKASINVAMDLVKQQKADAVFSA
FT                   GHSGAAMASALLRLGRLPGIDRPAIGTVFPTIVAGKPVLVLDVGANVDCRPKFLEQFAV
FT                   MGSAYSQYVLGTTEPKVGLLNIGEEDSKGNDAAVRAHQLLRENSQINFIGNAEGRDVLS
FT                   GHFDVIVCDGFVGNVLLKFAEAVGEVILQILREELPQGLHGQIGSAFLKPNLKRVKQRM
FT                   DHAEHGGALLLGVAGVCFIGHGSSQAPSIFNAIRMAKEAVDNQVLQRIQSQYILERESG
FT                   "
FT   gene            144405..145397
FT                   /locus_tag="Npun_F0099"
FT   CDS_pept        144405..145397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0099"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: Chalcone and stilbene synthases domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal domain protein; 3-Oxoacyl-[acyl-carrier-protein
FT                   (ACP)] synthase III; KEGG: ava:Ava_2729 3-oxoacyl-(acyl
FT                   carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78900"
FT                   /db_xref="GOA:B2J3H0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H0"
FT                   /protein_id="ACC78900.1"
FT                   /translation="MENLGIAITGSGSAVPATSLHNQTLTELVETSDEWIATRTGIRQR
FT                   RLAVSSESLSGLATAAGSRAIAASGIRPEDLDLILLATSTPDDLFGSACQVQAQLGATN
FT                   AVAFDLTAACSGFVFGLVTAAQYIRTGVYKNVLLIGADILSRWVDWQDRRTCVLFGDGA
FT                   GAVVLQASKSDRLLGFALKSDGTQNHHLNLAYAGASQELLPGVNITKGTYQPITMNGKE
FT                   VYRFAVQKVPEIIDKALFQANLKVDQIDWLVLHQANQRIIDAVAQRLNIPEHKVISNLA
FT                   QYGNTSAASIPLALDEAVRQGKIKPHDIVATSGFGAGLTWGAAIFQWGK"
FT   gene            145662..146546
FT                   /locus_tag="Npun_F0100"
FT   CDS_pept        145662..146546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0100"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: acyl transferase domain protein; KEGG:
FT                   ana:alr0240 malonyl coenzyme A-acyl carrier protein
FT                   transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78901"
FT                   /db_xref="GOA:B2J3H1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H1"
FT                   /protein_id="ACC78901.1"
FT                   /translation="MTKTAWVFPGQGSQTLGMGIDLLDIPFAKDKFAQAEEILGWSVTK
FT                   ICQNEEAKLSQTLYTQPSLYVIESILADLLQERGQQPDLVAGHSLGEYSALYVAGVFEW
FT                   SAGLYLVKRRAELMDNAVGGMMAALMNFDREQLEKVIAHTPDVVLANDNSSAQVVISGT
FT                   TEAVQAVMTQVKAKRAIPLKVSGAFHSHLIAPAAAEFQNILESVEFQPATVPVLSNVEP
FT                   IPSIDAEILKQRLNKQMTGSVRWREISLQLPANGIQRVVEVGPGKVLTGLIKRSSPDLI
FT                   LENIQSGADLALG"
FT   gene            146984..147661
FT                   /locus_tag="Npun_F0101"
FT   CDS_pept        146984..147661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0101"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: ana:alr0241
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78902"
FT                   /db_xref="GOA:B2J3H2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H2"
FT                   /protein_id="ACC78902.1"
FT                   /translation="MRMLNSVLFALSSVDKNREPFISLALYHAFKWSVVSPILHTYFRG
FT                   QIYGAENVPQSGPLLVVSNHASYFDPPIVSNCVRRPVAYMAKEELFNIPVLAQAIKLYG
FT                   AYPVSRGSADRNAIRSALDYLNKGWAVGVFLEGTRTPDGRITDPKRGALLLAAKAKAPI
FT                   LPVSVCGTEKILQKGSSLPHAVPITVRIGNLIDAPTSTNKEELEALTQKCATVINKMHD
FT                   LGR"
FT   gene            148141..149178
FT                   /locus_tag="Npun_F0102"
FT   CDS_pept        148141..149178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0102"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   ava:Ava_2732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78903"
FT                   /db_xref="GOA:B2J3H3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H3"
FT                   /protein_id="ACC78903.1"
FT                   /translation="MSGFEAKNFWERLNNLALVRFLLLVASGWAIVQLLAYFEAVIVIF
FT                   TFAAILAFLLSYPVYGLRRFLPHGVAVGVVFLLSIVIIGGLIITVGLTVLSQGQQLIDS
FT                   ITAFLNSLVPLLEGLEGFLRTRNLQIDLSFIEEQLRNQAVSTLVTSLAILQGFMTNFVT
FT                   FILIAVVAFFMLLDGDKLWNFILKIVPKQRRNRFTNIIRRSFLGFFRGQLLLSGFLTSS
FT                   TFLVFLVLKVPFALILSIIIGIVDIIPGIGATLGVSTVTLFVLSQGVWLALKVLIACII
FT                   LQQIQDNLIAPRIMQGALNLNPVVIFFALLVGARVAGLLGVFISIPIAGVIVSLFEIDE
FT                   MKSEV"
FT   gene            149283..149582
FT                   /locus_tag="Npun_F0103"
FT   CDS_pept        149283..149582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78904"
FT                   /db_xref="InterPro:IPR018741"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H4"
FT                   /protein_id="ACC78904.1"
FT                   /translation="MMSDLKAELTEILDEAEWEWLIPHVQRDAVILVAPELNLVDVGVA
FT                   IASDNIPSVEQWIDEQLITKPTTVQVGEWNLERSKRFNTLIVQPYVLVKEIVAT"
FT   gene            149782..152199
FT                   /locus_tag="Npun_F0104"
FT   CDS_pept        149782..152199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0104"
FT                   /product="MutS2 family protein"
FT                   /note="KEGG: ava:Ava_2651 recombination and DNA strand
FT                   exchange inhibitor protein; TIGRFAM: MutS2 family protein;
FT                   PFAM: DNA mismatch repair protein MutS domain protein; Smr
FT                   protein/MutS2; SMART: MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78905"
FT                   /db_xref="GOA:B2J3H5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H5"
FT                   /protein_id="ACC78905.1"
FT                   /translation="MIQSETLELLEWHRLCQHLATFAATKLGATAARNLKIPDSQTQSE
FT                   QLLEQTKEVYQLESRLTTGLSFEGIQDIGDSLERAERSGVLAGDELLAIATTLAGARSL
FT                   RRVIDNQEDLPILTELVADLRTYPELEQEIHRCIDERAQVTDRASQKLGEIRTDLRRLR
FT                   SQITQKLQNILQAKSGAVQEQLITQRSDRFVIPVKAPQKDAIPGIVHDTSTSGATLYVE
FT                   PNSVVPLGNQLRQIIRKEQAEEEAIRRILTEQVAAVKPDLERLLAIATTLDLATARSRY
FT                   SYWLGANPPRFIQRQDSETITLRNLRHPLLVWQQQHEQGQPVVPVDLLINPLIRVVTIT
FT                   GPNTGGKTVTLKTLGLAALMAKVGLFVPAREPVEIPWFDKVLADIGDEQSLQQSLSTFS
FT                   GHIRRISRILEALGNGESGSEDGEKEMPNPQSLVLLDEVGAGTDPVEGSALAIALLQYL
FT                   ANHAQLTIATTHFGELKALKYEDERFENASVEFDESTLSPTYRLLWGIPGRSNALTIAL
FT                   RLGLKPEVVQQAKTQVGEATDEVNQVIAGLEAQRRRQETKAAEAQSLLQQAERLYKEVS
FT                   AKAASLEERESSLRASQEIAVQQAIVQAKGEIAQVIRRLQKGTPTAQEAQQATNALNQI
FT                   GQLYQPATPAKPKAGFMPKVGDRVRIPKLGQIADVIAAPDEDGELSVRFGLMKMTVKLQ
FT                   DVESLDGQKPEPIVKAKPAPAAVTPPAQSVPEIRTSKNTIDLRGKRVADAEYILDKAIS
FT                   EATGPIWIIHGYGTGKLRQGVHAFLQQHPRVNNYEPAEQADGGTGVTVAHIK"
FT   gene            complement(152293..152922)
FT                   /locus_tag="Npun_R0105"
FT   CDS_pept        complement(152293..152922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78906"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H6"
FT                   /protein_id="ACC78906.1"
FT                   /translation="MLKARFFTKQLIIALGLGLTTLCTATPSRAFVLTYQGDTTNQETW
FT                   RRTAPGEPPDLVSGQKDGTMGMIVPYSVFEFTVEQSSLYTFASTVPGATTSTDGAWDNF
FT                   LVLYQDSFNSTNQLTNVLIANTTPNNGSPAFSQELTAQRNYFLITTGRKVTDFGAFTNT
FT                   ISGSGKVVTVPESDSIFGLLVVSGFIYLRVSDFTNKFRYGNAHRRQ"
FT   gene            complement(153019..153837)
FT                   /locus_tag="Npun_R0106"
FT   CDS_pept        complement(153019..153837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78907"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H7"
FT                   /protein_id="ACC78907.1"
FT                   /translation="MKKVEIFPFFSQKISKFSLAVITGISSSILLANPIHAATLGQNLI
FT                   INGDAEQGQGDPIGNAVGTDIPFIPNWITTDSFSVLQYGATGFEFTNPLGNVVAVSGLP
FT                   DANSLGPSVRGKNLFFGGADRGSSSASQLIDITDLASVIDAGQGAYDLSAWLGGYDTDL
FT                   DNVKFSLNFLNQDGQSLDTTFINSPAPDKRNNTTGLLFKSTKGFVPVGARQINVVLNVN
FT                   YVRGRVNDGYADNLSLAITKVPEPSSSGLLLIVFSFFMLFKLPKSSKLLP"
FT   gene            complement(153901..154827)
FT                   /locus_tag="Npun_R0107"
FT   CDS_pept        complement(153901..154827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0107"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; KEGG: ava:Ava_4058 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78908"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H8"
FT                   /protein_id="ACC78908.1"
FT                   /translation="MKKHFFAFSLIACAVSVIPTKALAVNLYGAGSLRDSLTEVAESFS
FT                   EKYGIPVETRFGPSGLTREFIEQEFSKTGKSADVFASADVDNPQTLFQEGLSEPVVNFT
FT                   SNRMVAVVRSGLGITSNNLLNFLLKPEIKLGTSTPIADPSGNYAWQIFDKSDQITPGNS
FT                   QILKNKALQLVGGNPNAPIVPNGKNNLVYFLEETKQADIFLAYYTSGKTAQVTAGGENL
FT                   QIVELPDYLATKANYGLTTLKNADPDGEKLAEYILSPEGQEILTKYGFSSPSTSVPEHQ
FT                   GAGGVLLALGLALILNTKQRIKSESRS"
FT   gene            155553..156158
FT                   /locus_tag="Npun_F0108"
FT   CDS_pept        155553..156158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78909"
FT                   /db_xref="InterPro:IPR021399"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3H9"
FT                   /protein_id="ACC78909.1"
FT                   /translation="MLKVMHSAANSATPNSQWEDLIKLPAPNTVQWDNIKTQLDLVLLA
FT                   LETLTGIGSEAMLSAATDLNLESRVPDRVALWRLRQSNPLRKGQGGRKKLDVEEARSLV
FT                   LIICYLAKQHQELIRRAVGLLEQMAENNREPHQAALLGDYIDAFCNTYQERMEEDEKIS
FT                   TDLLTNLALKLLVDLLFYSAPGGHRRLWLALIDRSTKF"
FT   gene            156410..158080
FT                   /locus_tag="Npun_F0109"
FT   CDS_pept        156410..158080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78910"
FT                   /db_xref="InterPro:IPR025569"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I0"
FT                   /protein_id="ACC78910.1"
FT                   /translation="MPLSNSVIRRYTPPTCTLEVFAQSSPLSRWMGKSVLKHLSFELRF
FT                   DDPRLPEEQRVPIRGDREQLEALCDAVTNYVQQFLQQSPESFWVSFSGTHESSTAMGEP
FT                   ELKSSTKTLNSFSTQFPGANIRLEPSSYLTHNLFLGSLANHSSGPVIQLTLLQIFDLAS
FT                   ALDEYSTDVMALPTLNTTSSTLRFPAWAPVAAVLVLGIGFLPITWQYANSIREKEQQTA
FT                   KTSDPAAVKTALEPSTSLNFPTPEPGIIPPSDNLLGSTPPLSTSTLPQAPLTAPSSSFS
FT                   APQSLLPNNAVTTTQSKTATLPSNGVMPSLRDATGAASFSTRRSAIANAPSSKIPGQEI
FT                   AIVPNLGQNPTGPNPQAGNLPQLRNLPPRLSSNTSSLPTNISPVSPPSLSTIPNNGGNT
FT                   RTQTSPLTSQQLDERINSLQQPSPGEKPASQLSSSRTAENNPFIDQLGDGRKTPKSREV
FT                   ATGTLFDTPQVAEAREYLSKRWQPPTGLGQALEYSLIVSVDGTVERIFPLNKAAREFVD
FT                   NAGMPEVGKPFVSANKSGQNVRIRVVLSPDGKVQTFPDE"
FT   gene            158358..158642
FT                   /locus_tag="Npun_F0110"
FT   CDS_pept        158358..158642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0110"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   ava:Ava_2648 YiaAB two helix"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78911"
FT                   /db_xref="GOA:B2J3I1"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I1"
FT                   /protein_id="ACC78911.1"
FT                   /translation="MQTIGTQKDSAAWVIQTWAAFVISISMTTFGIVNLPVNGWVKGFM
FT                   GMGMAFSVGSTFTLAKTTRDLHENRRLTARLDEAKVEKLLSQHDPLNFK"
FT   gene            complement(158769..159230)
FT                   /locus_tag="Npun_R0111"
FT   CDS_pept        complement(158769..159230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0111"
FT                   /product="ferredoxin"
FT                   /note="KEGG: ava:Ava_2647 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78912"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I2"
FT                   /protein_id="ACC78912.1"
FT                   /translation="MADFLPSPEEQEDNRSGLEPELGGFLRDSPERSGLEPELGGLLRQ
FT                   NGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVVRQDGDAEEIIQEAIDTCPVDCIH
FT                   WVDYTELKKLEQERKYQVIPVVGYPVEQAVAASERRRKKQKLKTKKSRY"
FT   gene            complement(159230..159616)
FT                   /locus_tag="Npun_R0112"
FT   CDS_pept        complement(159230..159616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0112"
FT                   /product="protein of unknown function DUF1257"
FT                   /note="PFAM: protein of unknown function DUF1257; KEGG:
FT                   ava:Ava_2646 protein of unknown function DUF1257"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78913"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I3"
FT                   /protein_id="ACC78913.1"
FT                   /translation="MSHFSQIKTQIRNLDSLKDALTELGVDWKPGPREVRGYRGQTHPA
FT                   EVSIEQENGYDIGFRWNGKEYELVADLQYWQQDLSVDGFLRQVTQRYAYQTVVKETARV
FT                   GFQVSEQQKNEDGSIRLVVQRWSA"
FT   gene            complement(159656..159865)
FT                   /locus_tag="Npun_R0113"
FT   CDS_pept        complement(159656..159865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78914"
FT                   /db_xref="InterPro:IPR021375"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I4"
FT                   /protein_id="ACC78914.1"
FT                   /translation="METLEFIIYPDGRVQEKVTGIVGASCAEVTAAIEAQLGQVLNHEP
FT                   TSEYFAAKVQQSNVANTHTTYSDW"
FT   gene            161137..162141
FT                   /locus_tag="Npun_F0114"
FT   CDS_pept        161137..162141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78915"
FT                   /db_xref="GOA:B2J3I5"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I5"
FT                   /protein_id="ACC78915.1"
FT                   /translation="MSTANILSAIRIGVLGFGGLGQAAAKVLAAKQEMVLVAAADQKGY
FT                   AYAAEGLNTQECIAIYQSQGSVGYLEPVGTLTNQSVHDLIEIAQPVDGYFLALPNLPND
FT                   FIPSVAKEFIKSGWRGVLVDAIKRTTAVEQLLAMKEELQAAGITYMTGCGATPGLLTAA
FT                   AALAAQSYAEIHQVEITFGVGIANWEAYRATVREDIGHIPGYTVETARAMTDAEVEALL
FT                   DKTNGVLTLINMEHADDVMLEVAGICDRDRVTVGGVVDTRNPKKPLSTNVKVTGRTFEG
FT                   KISTHTFTLGDETSMAANVCGPAFGYLKAGKQLHQRGIYGIFTAAEIMPQFVR"
FT   gene            complement(162318..162878)
FT                   /locus_tag="Npun_R0115"
FT   CDS_pept        complement(162318..162878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78916"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I6"
FT                   /protein_id="ACC78916.1"
FT                   /translation="MTVQKSHYEASLAEYSNHLAAIALLKQYRPYLEMIPSLRRPDESV
FT                   ITIPLPIVRLRNTVTTTSQTICLPCDVAILMCDPEWKIKTGAEILVFIHRANEDFSDLL
FT                   GRWRQTQVLLDNDYEWLMPLRHSHILSEGANTIYPLFVVFNDTLERIQRGLVGAELPFI
FT                   IQTPDLLLEENFTDIFSSEIPPV"
FT   gene            complement(163000..164223)
FT                   /locus_tag="Npun_R0116"
FT   CDS_pept        complement(163000..164223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0116"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   ava:Ava_0374 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78917"
FT                   /db_xref="GOA:B2J3I7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I7"
FT                   /protein_id="ACC78917.1"
FT                   /translation="MPTFVARVRDSQGKSRTEKIVAESLVQARTNLRDQGFVIQELKQS
FT                   QGFQPDIALKKFQNSLVKVSVKDKAVFSRQFAVLMNAGVAIVRSLGVLSEQCSNTKLKQ
FT                   ALIEISNDVQSGMNLSESMRKHPDCFDGLYVSMIQAGEVGGVLDEVLNRLAKLLEDVAR
FT                   LQNQIKSALSYPTVVGFIAVSIFLGMTIFLIPVFAKIFTEIGTELPPLTQFLMDTSLFL
FT                   RSPKVFVLLAVIVGGKIAFTQYGKTPVGRITIDRLSLKMPLFGDLIQKSSVARFSRTFG
FT                   SLTRSGVPILTCLEIVRDTSGNQVIANAIDAARMEIQQGGMISLALQRDSVFPAMAIQM
FT                   ISIGEETGELDAMLMKVADFYEDEVEQAVKAMTSILEPVMIVVLGGMVGTILLAMYLPM
FT                   FKVFEKLG"
FT   gene            complement(164328..165455)
FT                   /locus_tag="Npun_R0117"
FT   CDS_pept        complement(164328..165455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0117"
FT                   /product="twitching motility protein PilT"
FT                   /note="KEGG: ava:Ava_0375 pilus retraction protein PilT;
FT                   TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78918"
FT                   /db_xref="GOA:B2J3I8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I8"
FT                   /protein_id="ACC78918.1"
FT                   /translation="MEMMIEDLMEQLIEMGGSDMHLSAGLPPYFRISGKLTPIGEHVLT
FT                   ADQCQRLIFSMLNNTQRKTLEQNWELDCSYGVKGLARFRVNVYKERGSYAACLRALSSK
FT                   IPNFEKLGLPDIVREMTDKPRGLILVTGPTGSGKTTTLAAMIDLINRTKAEHILTVEDP
FT                   IEFVYEPIKSLVHQRQLGEDTKSFANALKAALREDPDIVLVGEMRDLETISLAISAAET
FT                   GHLVFGTLHTSSAAQTVDRIIDVFPHERQTQVRVQLSNSLVAVFSQTLVSKKNPKPGEY
FT                   GRVMAQEILVVTPAISNLIREGKTSQIYSAIQTGGKLGMQTLEKVLADFYKAGTISFEA
FT                   AMSKTSKPDEIQRLIGNSTPQAAAGAKPGAAAKAH"
FT   gene            complement(165566..167572)
FT                   /locus_tag="Npun_R0118"
FT   CDS_pept        complement(165566..167572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0118"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II, protein E domain protein; KEGG:
FT                   ana:all2444 general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78919"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3I9"
FT                   /protein_id="ACC78919.1"
FT                   /translation="MTYSSPQRRSTALTTRTEFSPFGNKLVQSGYVNTEQMRQALIESR
FT                   KSGRPLTEVLESITGQQLSPELLRQYKKQQLFELKILYGVEFLDPEVNSIGNTMMGNLI
FT                   ETLIPVDICRRHRLVPLSKHEDQTPPSVLVAMVAPDNLEASDDLNRILRPQGLALQRMV
FT                   ITQEDYQQLINQYLDEMAVRQKHLEQEKFTDINQDLENLGNLDLADAPEEMEADLGAAM
FT                   KGAEDAPVINLVNRILAKALHEGVSDIHIEPQEENLRIRFRKDGVLREAFDPLPKKIIP
FT                   AVTARFKIISNLDIAERRLPQDGRIRRLFEGRKVDFRVNTLPSRYGEKVVLRILDNSST
FT                   QLGLDKLITDPDTLHIVQDMVSRPFGLILVTGPTGSGKTTSLYSALSEKNDPGINISTV
FT                   EDPIEYSLPGITQVQVIREKGLDFATALRAFLRQDPDVLLVGETRDKETAKTAIEAALT
FT                   GHLVLTTLHTNDAPGAIARLGEMGIEPFMVSSSLIGVLAQRLVRRVCSECRVPYTPTTE
FT                   ELGRYGLSASSDVGVTFYKANTLTLDAIAEAKGKNQLCSKCNGVGYKGRCGVYEVMRVT
FT                   ENLQTLINEDAPTERIKEVAIEEGMKTLLAYSLDLVREGSTTLEEVERVTFTDTGLEAE
FT                   LKAKRKTGLTCRSCDATLKQEWLDCPYCMTSRF"
FT   gene            167814..168059
FT                   /locus_tag="Npun_F0119"
FT   CDS_pept        167814..168059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78920"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J0"
FT                   /protein_id="ACC78920.1"
FT                   /translation="MKELKSSSSRLVRLFKQSRENWKETALERQQKLRALEIKIRDLSL
FT                   SRENWKKRAMKAEKELRIISTNSADAQKKGKKFPKK"
FT   gene            168306..168539
FT                   /pseudo
FT                   /locus_tag="Npun_F0120"
FT   gene            168961..169638
FT                   /locus_tag="Npun_F0121"
FT   CDS_pept        168961..169638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0121"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: ana:alr2445 heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78921"
FT                   /db_xref="GOA:B2J3J1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J1"
FT                   /protein_id="ACC78921.1"
FT                   /translation="MKSDSPAQINFNESGSEVTEQVSAQTNVSGDAATFNPETGVAATE
FT                   NTGVETAALAELTQQIESLKTQLEERSTQYMRIAADFENYRKRTSKEKEELETLMKRNT
FT                   ILELLPVVDNFERARSHLKPQSDGEMTMHKSYQGVYKQLVDSLKRLGVSPMRPEGQEFD
FT                   PNLHEAVMREPTDEHPEGTVLEELVRGYYLGERVLRHAMVKVAAPKEDTPSTEEDQSSP
FT                   ANS"
FT   gene            169865..171823
FT                   /locus_tag="Npun_F0122"
FT   CDS_pept        169865..171823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0122"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: ava:Ava_0378 molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78922"
FT                   /db_xref="GOA:B2J3J2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J2"
FT                   /protein_id="ACC78922.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVLEGGQPLVISNSEGGRTTPSIVGFGKS
FT                   GDRLVGQLAKRQAVTNAENTIYSIKRFIGRRWEDTDTERERVPYNCVKGRDDTVDVQIR
FT                   SKNYTPQELSAMILQKLKQDAENFLGEEVTQAVITVPAYFTDAQRQATKDAGTIAGLEV
FT                   LRIINEPTAAALAFGLEKQDQEQLILVFDLGGGTFDVSILQLGDGVFEVKATCGNNHLG
FT                   GDDFDNAIVRWLMERFQQQEKIDLSQDKMALQRLREAAEKAKIELSSMVNTSVNLPFIT
FT                   SDETGPKHLEMEFSRSKFEELAGKLIEGTIEPMIQALKDADLKPSAIDRIILVGGSTRI
FT                   PAVQNALIKFFNGKAPDRSINPDEAVALGAAIQAGVLGGEVDNLLLLDVTPLSLGIETL
FT                   GEVFTKIIERNTTIPTSKSQIFSTAVDGQTSVEIHILQGERAMSRDNKSLGKFLLAGIP
FT                   PSPRGVPQIEVSFEIDVNGILKVSAQDKGTGREQSIRITNTGGLSTNEVERMRQEAELF
FT                   SEEDRRRKELVELKNQADNLLFSYESTIKDNSNFIGEQMKTLASEKVSQLQAAMIDSSI
FT                   STVEFKQRLDEFQQTLFAIGADVYNRANSQTDEIEEASASLFTPEVDSPMNGTLIPQFN
FT                   FDFDEESTAQVDYEAID"
FT   gene            172500..173627
FT                   /locus_tag="Npun_F0123"
FT   CDS_pept        172500..173627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0123"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: ava:Ava_0379 heat
FT                   shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78923"
FT                   /db_xref="GOA:B2J3J3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3J3"
FT                   /protein_id="ACC78923.1"
FT                   /translation="MARDYYEILGVSRDTDKEELKQAYRRLARKYHPDVNKEPGAEDRF
FT                   KEINRAYEVLSEPETRARYDRFGPEGVSGAGAGFQDVGDMGGFADIFESIFSGFAGGMG
FT                   SPTQQRRRSGPARGDDLRLDLKLDFREAVFGGEKEIRISHLENCEVCSGSGAKPGTRPR
FT                   TCSTCSGSGQVRRVTRTPFGSFTQVSTCPTCNGTGMVIEDKCDACDGKGANQVTKKLKI
FT                   TIPAGVDNGTRLRISSEGDAGQRGGPSGDLYVYLFVNEDEEFQRDGINILSEIKISYLQ
FT                   AILGCRLEVDTVDGPVELIIPAGTQPNTVMKLENRGVPRLGNPVSRGDHMLNVLIDIPN
FT                   KVTPEERELLEKLAKIKGDRTGKGGLEGFLGNLFK"
FT   gene            173627..173884
FT                   /locus_tag="Npun_F0124"
FT   CDS_pept        173627..173884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0124"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ana:asr2448
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78924"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J4"
FT                   /protein_id="ACC78924.1"
FT                   /translation="MMPSSLLTPDAQLDLRGTPCPINFVRTKLRLEKMPLGGLLEVWLD
FT                   PGEPIEQVPDSLTMAGYVVEQITDCSNYFSLLVRRPVAVQ"
FT   gene            173881..174981
FT                   /locus_tag="Npun_F0125"
FT   CDS_pept        173881..174981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0125"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: ana:alr2449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78925"
FT                   /db_xref="GOA:B2J3J5"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J5"
FT                   /protein_id="ACC78925.1"
FT                   /translation="MTGENFAETGQLLGTVLAVQANFYRVQLDQEQGEMREMGDQDSHL
FT                   PYPPLLLCTRRTRLKKIGQQVMVGDRVVVEEPDWAGGRGAIADVLPRHSELDRPAIANV
FT                   NQILLVFAVADPPLEPYQLSRFLIKAESTGLDVLLCLNKSDLISESEQQKVSDRLLGWG
FT                   YQPIFISVKDGINTDQSGRYLSNKITVIAGPSGVGKSSLINTLIDSAKLRVGEVSGKLA
FT                   RGRHTTRHIELFELPSGGMLADTPGFNQPDMDCIPEELIHYFPEARKRLAVASCRFSDC
FT                   LHRDEPECVVRGDWERYEHYLEFLDAAIAHQTQLHQQADPESTMKLKSKGKGQSQYEPK
FT                   LESKKYRRISRKTQLQDLQELYRDEE"
FT   gene            175501..177090
FT                   /locus_tag="Npun_F0126"
FT   CDS_pept        175501..177090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0126"
FT                   /product="glycoside hydrolase, family 57"
FT                   /note="PFAM: glycoside hydrolase, family 57; KEGG:
FT                   ava:Ava_0382 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78926"
FT                   /db_xref="GOA:B2J3J6"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J6"
FT                   /protein_id="ACC78926.1"
FT                   /translation="MSIGYVALVLHAHLPFVRHPESDYVLEEEWLYEAITETYIPLLKV
FT                   FEGLKRDGIDFKITMSMTPPLVSMLRDPLLQERYEAHLAQLEELIALEAEHNVNNGHLR
FT                   YLAEHYATEFSEARQLWERYDGDLVTAFKGFQDSNNLEIITCGATHGYLPLMKMYPEAV
FT                   WAQIQVACEHYEQTFEQAPRGIWLPECAYYEGLERMLADAGLRYFLTDGHGILYARPRP
FT                   RFGTYAPIYTETGVAVFGRDHESSQQVWSSEVGYPGAAEYREFYKDLGWEAEYEYIKPY
FT                   IMPNGQRKNTGIKYHKITGRGLGLSDKALYDPYWAREKAAEHADNFMYNRERQSEHLYG
FT                   IMQRPPIIVSPYDAELFGHWWYEGPWFIDYLFRKSWYDQKTYQMTHLADYLRDQPTQQV
FT                   CRPSQSSWGFKGFHEYWLNETNAWIYPHLHKAAERMIEISHLEPEDELQWKALNQAARE
FT                   LLLAQSSDWAFIMRTGTMVPYAIRRTRSHLMRFNKLYEDVKIGKVDSGWLEKVELMDNI
FT                   FPEINYRVYRPL"
FT   gene            177336..177533
FT                   /locus_tag="Npun_F0127"
FT   CDS_pept        177336..177533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78927"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J7"
FT                   /protein_id="ACC78927.1"
FT                   /translation="MNPNYEQMSFTELRTYVVENREDIEALGFLMSKRDPNSKGYPMPV
FT                   TEADMQAQMEIIRRKINGEL"
FT   gene            complement(177587..178273)
FT                   /locus_tag="Npun_R0128"
FT   CDS_pept        complement(177587..178273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0128"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   gvi:glr1382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78928"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J8"
FT                   /protein_id="ACC78928.1"
FT                   /translation="MTASVEYIPVAPIEYPDEDGKPMAEGDIQCSYLTYARNVLRIYFQ
FT                   NHPDVYVAGNLFIYYEKGYPESVVAPDVFVVFGVENRDRRSYKTWEENNQTPDFVLEIT
FT                   SKATRSKDQGAKKGIYAFLGVREYFQYDPTGDYLNPQLQGLHLVDGNYFPVGTNTLADG
FT                   TVYLPSEVLGLELRLEAGKLRFYNPTTSQTLLTHEEEASARQATEEKAQRLAAKLRELN
FT                   IDPDSL"
FT   gene            complement(179180..179539)
FT                   /locus_tag="Npun_R0129"
FT   CDS_pept        complement(179180..179539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0129"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: bha:BH0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78929"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3J9"
FT                   /protein_id="ACC78929.1"
FT                   /translation="MINKETAEHNLWGNNCHGWHLVKQPELSVIQEMMPPKTSEVRHYH
FT                   QRCLRRATPTHQFFFILSRKATLEIDGSRQVLSQHEGVEVPPNVPHQMLNESDSDLEFL
FT                   VISQPPTHGDRVLVS"
FT   gene            complement(179594..179944)
FT                   /locus_tag="Npun_R0130"
FT   CDS_pept        complement(179594..179944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78930"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K0"
FT                   /protein_id="ACC78930.1"
FT                   /translation="MNSIMVIHPYKFGEMWVFDDDKVGLVQEPFVAGADEIIERMVAQI
FT                   PDAESGFSLVFSASPFPGYQIEFGWRREEYGGNWYYSADLDREGWLCPALFKYFDEAPK
FT                   EFYAQFKAKTKL"
FT   gene            complement(180054..181055)
FT                   /locus_tag="Npun_R0131"
FT   CDS_pept        complement(180054..181055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0131"
FT                   /product="cytochrome f"
FT                   /note="PFAM: cytochrome f; KEGG: ana:all2452 apocytochrome
FT                   f"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78931"
FT                   /db_xref="GOA:B2J3K1"
FT                   /db_xref="InterPro:IPR002325"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR024058"
FT                   /db_xref="InterPro:IPR024094"
FT                   /db_xref="InterPro:IPR036826"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3K1"
FT                   /protein_id="ACC78931.1"
FT                   /translation="MRNVFRTARLTRSARAIVKTLLIAIATVTFYFTSDLALPQSAAAY
FT                   PFWAQQTYPETPREPTGRIVCANCHLAAKVTEVEVPQSVLPDTVFKAIVKIPYDLSAQQ
FT                   VGADGSKVGLNVGAVLMLPEGFKIAPEDRISEELKEEIGDTAFQPYSEDKENVVIVGPL
FT                   PGEQYQEIIFPVLSPNPATDKNIHFGKYSVHVGGNRGRGQVYPTGEKSNNSVYNASATG
FT                   TITKIAKEEDADGNVKYLVNIQPESGDVVVDTVPLGPDLIVSEGQAVKTGDALTNNPNV
FT                   GGFGQIDAEIVLQDSSRVKWMIAFVALVMLAQVMLVLKKKQVEKVQAAEMNF"
FT   gene            complement(181162..181701)
FT                   /locus_tag="Npun_R0132"
FT   CDS_pept        complement(181162..181701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0132"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /EC_number="7.1.1.6"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ava:Ava_0385 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78932"
FT                   /db_xref="GOA:B2J3K2"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3K2"
FT                   /protein_id="ACC78932.1"
FT                   /translation="MAQFSESADVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPP
FT                   ATGGAGGGTTAKDELGNDVSVTKFLENRNAGDRNLVQGLKGDPTYIVVDSKEAIKDYGI
FT                   NAICTHLGCVVPWNVAENKFKCPCHGSQYDETGKVVRGPAPLSLALAHTNVSDDKIVLT
FT                   PWTETDFRTGDAPWWS"
FT   gene            181930..182238
FT                   /locus_tag="Npun_F0133"
FT   CDS_pept        181930..182238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78933"
FT                   /db_xref="InterPro:IPR021420"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K3"
FT                   /protein_id="ACC78933.1"
FT                   /translation="MTGQELRQMLLDKWGYSYDVQFRRAQGKIFLQVMWKYLEQASFPL
FT                   SEAEYQEHLDSIANYLHALGGSTQVQTFIAQTRDRPRLGKAVSIPLDLGERSSEWIL"
FT   gene            complement(182588..182917)
FT                   /locus_tag="Npun_R0134"
FT   CDS_pept        complement(182588..182917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78934"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K4"
FT                   /protein_id="ACC78934.1"
FT                   /translation="MATREIHLELLLGKQVLDSTGKSVGRIEEVRAQQRGEEWVIEEYL
FT                   IGTTAVLERLSAWTIGLRILHLFGAHKIHGGYTISWEQLDLTDPEKPRLLCSLDDLKAL
FT                   DTSKK"
FT   gene            complement(182904..183275)
FT                   /locus_tag="Npun_R0135"
FT   CDS_pept        complement(182904..183275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78935"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K5"
FT                   /protein_id="ACC78935.1"
FT                   /translation="MDIIRDVLDNQLVDSNQRKLGKVDGIVMELRDGEPPRLIYIETGM
FT                   ITLARRIHPRLGRWVAAIENSWGAKHSEPFRIPLSKVRDVGIDVEVEIEAEATPALAYE
FT                   KWLREQIIERIPGAEHGNS"
FT   gene            complement(183323..184537)
FT                   /locus_tag="Npun_R0136"
FT   CDS_pept        complement(183323..184537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0136"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: sus:Acid_6922 natural resistance-associated
FT                   macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78936"
FT                   /db_xref="GOA:B2J3K6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K6"
FT                   /protein_id="ACC78936.1"
FT                   /translation="MKKIFEIALGIVTSIGGFLDVGAIATAAEAGSIFGFQLIWAIILG
FT                   TICVIFLVEMSGRLAAVSKHTLAAAVRERFGFNFYIIPLIAEIIVDFLVLAAEIGGVCI
FT                   ALQLLTGISFQWYALPVAFAIWLLIWYGNFGIIENGISVLGLVTLVFVVATFKLHPSLT
FT                   QLGSGLLPTLPQQDTAHYLYLGVGILGALISPYLFYFYSSGAVEDKWDEGYIGVNRAVA
FT                   GLGMSFGSVVSLGVLIVSALVLKPKGIEVDSYEQAALMLTESFGYWGFVLFAVSLGIAC
FT                   FGAALEVTLDTAYIVAQSFGWNWGENLKPKDAARFSLVYTVFVFLASLLMVFGIDPLQL
FT                   TLFSMAITAVILPPVIIPFLVLMNDELYVGNYRNGWISNSVVIFTIVLTFVLAIVAIPL
FT                   EILGG"
FT   gene            complement(184534..184962)
FT                   /locus_tag="Npun_R0137"
FT   CDS_pept        complement(184534..184962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78937"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K7"
FT                   /protein_id="ACC78937.1"
FT                   /translation="MKSIFIGYLLALTLLTACSKAAPDRLTEELQTVKSWTATSKMVAD
FT                   AWVRGAVPKVYAKQTLNKAQQEFQTETDNIAQIESSTAIPQSYKLALLGHIKRLAKITE
FT                   QMSTAVEQENYSVVSQRLGDLSQEGQTLDSQLPQQNKP"
FT   gene            complement(185270..185602)
FT                   /locus_tag="Npun_R0138"
FT   CDS_pept        complement(185270..185602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0138"
FT                   /product="export-related chaperone CsaA"
FT                   /note="TIGRFAM: export-related chaperone CsaA; PFAM:
FT                   t-RNA-binding domain protein; KEGG: tte:TTE0009 EMAP
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78938"
FT                   /db_xref="GOA:B2J3K8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K8"
FT                   /protein_id="ACC78938.1"
FT                   /translation="MFISYSDFEKIEIHVGKVIKVEEFPQAKKPAYKLWIDFGDLGIKK
FT                   SSAQITKLYDQEKLINTLILAVTNFPPRQIANFVSEVLVLGVVLDDGEVVLIQPDRDVA
FT                   VGKRVF"
FT   gene            complement(185648..186442)
FT                   /locus_tag="Npun_R0139"
FT   CDS_pept        complement(185648..186442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0139"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ava:Ava_0387 sec-independent periplasmic
FT                   protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78939"
FT                   /db_xref="GOA:B2J3K9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3K9"
FT                   /protein_id="ACC78939.1"
FT                   /translation="MPPLQDVDTVNVPNIDPEGYGNSDTDPLNELPDEVEMSLFDHLEE
FT                   LRQRIFYSLIAVAIGIIGCFFAVKPIVQLLEVPAQGVKFLQLAPGEYFFVSLKVAAYTG
FT                   LVLSSPFILYQIIQFVLPGLTRRERRLLGPVVFGSSVLFGAGLVFAYLLLIPAALKFFI
FT                   SYGADVVEQLWSIDKYFEFVLLLLFSTGLAFQIPIIQLLLGNLNIVSSERMVSGWRYVI
FT                   MGAVVLGAVLTPSTDPLTQSLLAGAVLGLYFGGVGLVKLTGK"
FT   gene            187282..188199
FT                   /locus_tag="Npun_F0140"
FT   CDS_pept        187282..188199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0140"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.105"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   tth:TTC1745 corticosteroid 11-beta-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78940"
FT                   /db_xref="GOA:B2J3L0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L0"
FT                   /protein_id="ACC78940.1"
FT                   /translation="MQLKYGELVIGSPSYKKRKLMVVEHQRTVVVTGASTGIGQACALL
FT                   LDQLGFSVFAGVRQNIDAQTLKQKGSPRLIPIFLDVTDAESIADAVDKVTNEVGGTGIL
FT                   GLVNNAGIAIPGPLELLAIAEFQHQMQVNVTGQLAVTQAFLGLLRQSRGRIINMGSIAG
FT                   RSPTPFLGAYNASKFALEALTDVMRMELRPWGISVSIIEPGSIATPIWEKSLSQSEVAQ
FT                   YDLPQSAQNLYGQAMNIVRKKMQILASKGISADIVAQTVVHALTAKQPKTRYLVGSDAK
FT                   LGAVLKHILSDKLHDQIILYSMGL"
FT   gene            188993..190330
FT                   /locus_tag="Npun_F0141"
FT   CDS_pept        188993..190330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0479 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L1"
FT                   /protein_id="ACC78941.1"
FT                   /translation="MLLDLERFYQACNPSRPLIIGNASDRRYYIDFAAVRGGKIIEALQ
FT                   RTIARISPDEPTCQLFTGHLGCGKSTELLRLKAELEAQQFHVVYFESTHVLEMADVDVT
FT                   DILLAIAGQVSESLEAMKIRLKSTYFTKLFGEIVDFLQTPIDLGVEAELSVGIAKITAK
FT                   TKESPQLRRRLRDYLEPRTANILQSINQELLERATKELKTKGKKGLVVIVDNLDRVAIR
FT                   PLPSGRSLPEYLFIQRGEQLRKLNCHVVYTIPLALTFSNDSAELQHRLGGGVAPKMLPM
FT                   IPVRLRSGEIFPQGLAMLRQMVLARAFPDILPSDRLGLITEVFDSLETLDRLCLISGGH
FT                   VRDLLGLLFDCLREQDPPFERECVDLVIQRQRDYRANAIDPQEWELIFQVVQQQRVRGD
FT                   IEYHTLLRSLFVFEYRDHQGAWFAVNPVLAETEKFKSWLNDTHKQI"
FT   gene            190300..195450
FT                   /locus_tag="Npun_F0142"
FT   CDS_pept        190300..195450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0142"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ana:all0478 WD-40
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78942"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L2"
FT                   /protein_id="ACC78942.1"
FT                   /translation="MVERHPQADIRAANERALRSLGRAIALSSGQFSLVLVCCNYRVLQ
FT                   ELMLQRLEELSSGVHHIQKVILPHNARSLYTSIHLQLVTEENPPSALMILGLESVDGID
FT                   DLLRSINHIRDEFRKRHPFPMILWVNEEVLQKVVRLAPDFASWAATPIRFEMTTQSLRQ
FT                   FLQQETDSLFATVLPSDAGQHQPPQVAKHYFTVEQVWKNSYELHFAIGELHDRGITLEP
FT                   ELHASLEFVFGLDNYISDRINTALSHFQQSLQVWQKLEEIGGAGERGSGGAGEQGDERV
FT                   FSSSTPPNRPSPLLLRQGVLLFYIGLCYCRLAEQNQIENRRHWYTAKFYFQQCLNVLQV
FT                   AGRLDIVAGFISQLAEVLQYLQEWEELQTVAQKSLELHQTYGSQIQLACDYGFLAQVAV
FT                   QQSRWIQASILAHVSLLKLGEAQKHNDPYNCLFPLLLAQIYYLVLAKAQRNLGELVIAH
FT                   EYLEKATKELPAALESSAHQYDAHRYIRLLRTLRSLYFEEGRYLEAYYIRQKRRSVEQQ
FT                   YGFRAFIGAGRLQPQRQATNPALMAPSGSSSVALEIAASGRERDINNLIGRISRADQKL
FT                   TVIHGQSGVGKSSTVTAGLVPALQNRAIGDQIAVPVVLQVYTDWARELEKSLSQAMSSD
FT                   ASLAVYAEIKLEANIEAAEVLPYSPTPITIVRILQQLQQNADNHLITVLIFDQFEEFFF
FT                   GYSDRKQKQEFDKFISDCLNIPFVKVILSLREDYLHRLLDFKHLSALEAINNNILDKHI
FT                   RYQLNNFSPEYAKAIIQKLTERSQFNLEPALIDALIEDLSTEFGEVRPIELQVVGAQIQ
FT                   DERITTLEEYQPYRPNKLIERYLKELIKDCGPENERAALLVLYLLTDESNNRPFKTRAE
FT                   LAAQLAELEDASKLELVLDILVSSGLVVLFPDVPERYQLIHDYLVDLIRYLQQQESSLQ
FT                   VQLNQLRHKVEQSKAEIERLKSELSQKKQRSTLADSHPQQGLDLLTELRELHKREELSQ
FT                   LQIEQLRAELKEKELTAKLAESQKKQRLSEAQLNRSLKIALTASVLAILGLSVSIVTAV
FT                   DSEIKTLSASSEALFASQKGIDSLKEGLRAGRKLQQIVWVDSYTREQVQTALYQAVSGL
FT                   REYNRLEGHLSGVNNATFSPDRSLIASASADTTIKLWLPDGSLFKTLSGHEDVVNSVSF
FT                   SPDGQIIASASQDKTVKLWSREGVLLVTLLGHQGVVNSVSFSPDGQIIASASTDKTVKL
FT                   WSRDGKLLKTLPGHDGAVLSVAWSTDGQTIASGSADKTVKLWSRDGKLLKTLQGHEDAV
FT                   KSVAWSTDGQTIASASLDQTIKLWNLEGKLLRTLSGHSAGVTSVSFSRDGNTIASASTD
FT                   ETIKLWSFEGVLLGTLKGHNNWVNSVSFSPDGRTLASASRDKTIKLWHWDDVLLRKPKA
FT                   DNDDWITSISFSPDDRTLAAGSRDKTIKLFSREGKLLRILTGHQGQVWGVSFSPDGQAI
FT                   ASASKDQTVKLWGADGKLLNTLQGHNSTVLSVAWSPNSQIIASASKDQTVKLWSRDGKL
FT                   LNTLQGHKDAVNWVSFSPDGKLLASASDDKTVKIWSLDGKLLYTLIGHSRRVNGVSWSP
FT                   DSQVIASVSIDSTVQLWSRDGGLLNTLTGDGDSFISVSFSPDGKTLAASSDDKIRIWNR
FT                   EGTLLIALKGYEAELTSVSFSPDGKTLAAGSGNGTVIFQNLADIQLEKLLARGCYLLYD
FT                   YLQTNQKVMKGDRALCSSR"
FT   gene            complement(195565..196587)
FT                   /locus_tag="Npun_R0143"
FT   CDS_pept        complement(195565..196587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0143"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   pen:PSEEN5223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78943"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L3"
FT                   /protein_id="ACC78943.1"
FT                   /translation="MSKNGIATNKKVLDLFNMMKTGTLILAPSFQRKLVWNNAHKEKFI
FT                   ETILLKLPFPEIYLADGEIDLDIQTSKTLVVDGQQRLSTIYQYVTASPEFTIKNISKFE
FT                   KLSKQEKTDFFDYTVVVRDLGRIPESEIREVFKRINSVQYALNAIEISNSLYEGEFITT
FT                   AKNILENNALFTSLEVFSEGEFSRMKDLEYVLLIMSTIEEGGYFTSDKEVKTYVEKYNN
FT                   EYPNKELMSNNFNEASKLIIESNLPPDSLWIKKSSLFTLMVELIKIKNKYGYLPQEQTL
FT                   AHALKSLEEELHINKKEDVSKNMFAQYYYYTHQGTASRKGRNVRGQLISKILEESMNVN
FT                   "
FT   gene            complement(196589..197200)
FT                   /locus_tag="Npun_R0144"
FT   CDS_pept        complement(196589..197200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78944"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L4"
FT                   /protein_id="ACC78944.1"
FT                   /translation="MWQTLIIDQSHINQKIDMFKAALRDYSLTEKLIVQKYIIHGTPYV
FT                   FKDDEGKYFDLKHEIATYFEERPECVLMVGSAKLGFSIAPSKLWNLFSEESDIDIAIIS
FT                   REIFEKFWSELYDFDISLVSRTDKEEQRYKKFLKYFFKGWLRPDLFPFKYSRTNEWFEY
FT                   FKSISYKYTPQKIAGGIYYNSALFEKYHMQNIKKLRQEDV"
FT   gene            197584..198207
FT                   /locus_tag="Npun_F0145"
FT   CDS_pept        197584..198207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0145"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ava:Ava_1492 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78945"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L5"
FT                   /protein_id="ACC78945.1"
FT                   /translation="MYASVTQPLTFEEFLAWDDGSGREFELLDGIPVPLSEPNANHEDL
FT                   IQRLCAYLENHYQENDLSYVPRQSKQVRLKTALGEKEKSRKADIVIFARVEWQRMRTIS
FT                   SSAAAYIPPPGIIEVVSNNWKDDYLTKLAEYEDLGVFEYIIVDYAAFGDIRFIGFPKQP
FT                   TITIYQLEGAEYLPPKVFRGQDLIHSKLFPNIPLTAEQIFAMSR"
FT   gene            complement(198521..198847)
FT                   /locus_tag="Npun_R0146"
FT   CDS_pept        complement(198521..198847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1033 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78946"
FT                   /db_xref="GOA:B2J3L6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L6"
FT                   /protein_id="ACC78946.1"
FT                   /translation="MTQEPVFEESSGNVFADLGLEDASELFMRGKIGIQVLRLLSQRNL
FT                   KQREISELLGIPQPEVSHLMKGEFQRFSEGKLLIFLKRLDTEINLHLRPRHASGQSAET
FT                   VISL"
FT   gene            complement(198844..199218)
FT                   /locus_tag="Npun_R0147"
FT   CDS_pept        complement(198844..199218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0147"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   ava:Ava_3691 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78947"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L7"
FT                   /protein_id="ACC78947.1"
FT                   /translation="MDDDEDIIEIPLRPLVWMGDSLKNIRSFPEDVRASLGYSLQLVQA
FT                   GETPMDAKLFKGVGSSVYEIVKRYDTDTYRAVYAVKIGEKIYVLHVFQKKSKQGIKTPQ
FT                   ADVDLIKQRYKDAVAREKQQ"
FT   gene            199270..199464
FT                   /locus_tag="Npun_F0148"
FT   CDS_pept        199270..199464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78948"
FT                   /db_xref="GOA:B2J3L8"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L8"
FT                   /protein_id="ACC78948.1"
FT                   /translation="MCERCIALYILILEKLAAGETSEQILEAHPRLTDEGIKAALAFAA
FT                   QALRYDVVYPTIEKALISF"
FT   gene            complement(199702..199775)
FT                   /locus_tag="Npun_r001"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(199702..199775)
FT                   /locus_tag="Npun_r001"
FT                   /product="tRNA-Arg"
FT   gene            complement(199809..200906)
FT                   /locus_tag="Npun_R0149"
FT   CDS_pept        complement(199809..200906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78949"
FT                   /db_xref="GOA:B2J3L9"
FT                   /db_xref="InterPro:IPR025893"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3L9"
FT                   /protein_id="ACC78949.1"
FT                   /translation="MLTIPLNFLQSTQTPHSGYHWDGTSRRFFEGWYYRITLPEIEQTF
FT                   AFMYSIEDPIGGKPHSGGAAQILGPDDEYLCRTFPDVKKFWGSRDVLGLGHWGKTDLQI
FT                   APLYLLPAEFEHHVQEGYQATATLNQGIIRELATNNYCRWEYEIQPIYGWGNKNSIQQS
FT                   TAGWLSFSQIFEPGWQILMAHGLASGKIDWNGKIYEFTNVPAYGEKNWGGAFPQKWFWI
FT                   NCNCFEGEPDLALTAGGGRRGVLWWMESVAMIGLHYQDKFYEFVPWNSQVDWEIQPWAR
FT                   WQMKATNSNYEIELTGTTDLAGTPLRAPTAEGLRYCCRDTMQGKLTLELREINGRKSQI
FT                   ILKAESFLCGLEVGGGSWHNVWQSR"
FT   gene            200940..201569
FT                   /locus_tag="Npun_F0150"
FT   CDS_pept        200940..201569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0150"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; heat shock
FT                   protein DnaJ domain protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ana:alr0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78950"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M0"
FT                   /protein_id="ACC78950.1"
FT                   /translation="MSNDKPKRLRSDINHAYEILGLEPGASQAEVKRTYRKLVKIWHPD
FT                   RFFDQKQKQEAEEKIKLINVAYNKLKSENPSEPPTSENPSSSSPKNPTKISVNRWDAEA
FT                   FYTLGVENATVGRYDDAIADFTHAIRLNPNYVDAYKYRGLVCSQLGYEYRAASDLNKAA
FT                   QIEQGLKNPGAARRVRSPRYVSKPRPLVERFCQGIKKILRLNRRWR"
FT   gene            201679..203157
FT                   /locus_tag="Npun_F0151"
FT   CDS_pept        201679..203157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0151"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; heat shock
FT                   protein DnaJ domain protein; WD-40 repeat protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: gvi:gll4356
FT                   WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78951"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M1"
FT                   /protein_id="ACC78951.1"
FT                   /translation="MSDRFDINHVYNILGLKPGASVDEVKQAYRQMAKTWHPDCFFEPQ
FT                   QKLEAEEKIKEINQAYARLKSYQPDETNQSASTSIKIDFTPSNAESFYKLGIEKAQKEK
FT                   YTEAIEDFTQAIRLNPNYFEAYKYRGLACSKLGYENRAESDFRNSIQLELKQKKAAPKP
FT                   TSPPPKPATPPPPKPTSPPPKPATPPPPKSESQPSPWKCVHTLTHLNWVFTTAISPDGK
FT                   TLASGSSDNTIKIWHLDTGKLLHTLTSHTKWVRCLAFSPDSQTLVSGSDDSTLMIWQVS
FT                   TGKLLKTLKVHSTPVFSVIISPDGQTILSGGTDSTIKISHIEMGQLLQVLKGHSGLVYS
FT                   LAICPKQQIFVSGGADNTIKLWNLKSNKLLQTLNGHSGWVMCVAISPDGKILASSSYDQ
FT                   TIKLWNINTGKVINTLAGHCSYVCAIAFSPVGQYLASGSADHSVKLWDVNTGQELYTLN
FT                   NHSDWVNSVTFSPDSKTLASGSRDMTIKLWQCDI"
FT   gene            203453..204187
FT                   /locus_tag="Npun_F0152"
FT   CDS_pept        203453..204187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr0248 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78952"
FT                   /db_xref="GOA:B2J3M2"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M2"
FT                   /protein_id="ACC78952.1"
FT                   /translation="MSIPNEREIKNSEIKQESYTDTNGNIHTDLTRTTETVKNSTANPN
FT                   SYTNGYVQGRNTERSYQQADLAERDNENASRGLLLGIIVTSLVGLIVGGVWYFNQRNNA
FT                   AVDTTVPVLVPVPSNNSPTPSASPQPQTKIIERIREVPVPVPVPQQQVTPQSAPRQPDI
FT                   NITIPPQQSAAEKAPSVTQPAPKATQSPATSPTSNTATPGTKGDSTKTTSPQGVDQSNS
FT                   TSNNGSSTANDATTGGLLNNGF"
FT   gene            complement(204763..205617)
FT                   /locus_tag="Npun_R0153"
FT   CDS_pept        complement(204763..205617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0153"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ava:Ava_2738
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78953"
FT                   /db_xref="GOA:B2J3M3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M3"
FT                   /protein_id="ACC78953.1"
FT                   /translation="MRSIGCLMHWLFTGHLRVDKITVKIAELPASLQGTTLVQLSDFHY
FT                   DGLRLSEEMLEKAIALTNEAEPDLILLTGDYVTDDPTPIHQLVHRLKHLQSRCGIYAVL
FT                   GNHDIYYSHSKAEVTQALTSIGVHVLWNEIAYPLGKELPFVGLADYWSREFYPAPVMNQ
FT                   LDSVIPRIVLSHNPDTAKILQQWRVDLQLSGHTHGGHIVIPGIGPLVFHYKKLLKKIPK
FT                   KLRCWVTFLLGDCSKVVRYWEWAQGFHKVQENQLYVNRGLGTYKPGRLFCPPEVTVITL
FT                   VSH"
FT   gene            complement(205815..206645)
FT                   /locus_tag="Npun_R0154"
FT   CDS_pept        complement(205815..206645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0154"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ana:all0250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78954"
FT                   /db_xref="GOA:B2J3M4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M4"
FT                   /protein_id="ACC78954.1"
FT                   /translation="MHWLLSGPLSREELTVKIVGLPASLQGKKLVQLSDFHYDGLRLSE
FT                   EMLEKAIAVTNEAKPDLILLTGDYVTDDPTPIHQLILRLKHLQSPSGIYAILGNHDIHY
FT                   KNAKTEVTDALTSIGIHVLWNEIAYPLGKELPLVGLADYWSREFYPAPVMNQLNPDTPR
FT                   IVLSHNPDTAEILQAWRVDLQLSGHTHGGQIVIPGIGPAMFFYEKLAKKIPKKVQRRFP
FT                   FLEENVSVVSHWEWAQGFHHLGKNQLYVNRGLGTYLPGRLFCRPEVTIITLQGE"
FT   gene            complement(206834..207729)
FT                   /pseudo
FT                   /locus_tag="Npun_R0156"
FT   gene            complement(207903..209585)
FT                   /locus_tag="Npun_R0157"
FT   CDS_pept        complement(207903..209585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0157"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; protein of
FT                   unknown function DUF1524 RloF; KEGG: mxa:MXAN_0599
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78955"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M5"
FT                   /protein_id="ACC78955.1"
FT                   /translation="MSAVKLQANDYPISKIFSNDFIFTIPLYQRPYAWTTEQAGELLED
FT                   LVTALGDSDDKIDDINPYFLGNIVLIKGDKPDAQVVDGQQRLTTLTVLLAALRASVSKE
FT                   NIHILTKYLYQEDDFDPNDNVYRLTVRERDAQFFKEYIQDEGGIDKLKNLHTAKLSDSR
FT                   KNFKDNTLLFINRLQSFTNNQLLRLTQFIIKRCFLVVVATPDIDSAYRIFSVINNRGMD
FT                   LCHADILKAEIIGKISLEQQEKYSAKWEETEEKLGRDIFKSLFSHIRMIHIKSKPRESI
FT                   LKEFLNDVKPINAPQQLIDKILIPYAEAFYDINNLAYHSDILEEEVNQKFRWLHLIDNS
FT                   DWIPPAILYLSRNYSNPELLLRFFTDLDRLASGLMIQRNNINERIERYSKLLYAIEVGE
FT                   DLYAPYSPLQLKPEEQTRILKILNDDLYLIRKIRLYVLLRLDAALSEGKASYNFCNISV
FT                   EHVLPQNPTSDSMWVQSFPSQEERDKYVHRIGNLVLLSSSKNAQANNYDFDLKKQKYFT
FT                   TRAGICNFALTTQVLMEKEWTAEVLTKRQEQLIHHLKEVWRLQ"
FT   gene            complement(210207..210479)
FT                   /locus_tag="Npun_R0158"
FT   CDS_pept        complement(210207..210479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78956"
FT                   /db_xref="GOA:B2J3M6"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3M6"
FT                   /protein_id="ACC78956.1"
FT                   /translation="MNILAWIVLGLIAGAIAKAIYPGHQGGGILGTILLGIIGAFVGGS
FT                   LGVFFSTGTLSLAAPTLSIPGIAVAVLGAIVAVFLWNLLTNRSAV"
FT   gene            210896..211812
FT                   /locus_tag="Npun_F0159"
FT   CDS_pept        join(210896..211310,211310..211812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Npun_F0159"
FT                   /product="transposase"
FT                   /note="KEGG: eba:ebA5690 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78957"
FT                   /db_xref="GOA:B2ITY7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2ITY7"
FT                   /protein_id="ACC78957.1"
FT                   /translation="MAKKYIVDLNEDEVSQLQSIIKKGKHKARTISRANILLMASEGET
FT                   DQAIASIVRAHVATVQRIREKFVIGGLDFALKDEVHPPKHKKLDEKQEAFLIATACSNP
FT                   PEGRVRWTMQLLADHLVNVGIIDSISDETVRQTLKKNEIKPWLKEQWCIPEVNAEYVFR
FT                   MEDVLDLYNEPYDPKRPVVCFDERPYQLVEEVRLPLPPQPEQPERYDFEYKRNGTVNLF
FT                   ACFQPLAGWRHIEVTERRTKADFAKQMKNLVDVSYRDADVIRLVVDNLNIHTPNALYEV
FT                   FPPEEARRIIQKLEFHYTPKHASW"
FT   gene            211809..212063
FT                   /locus_tag="Npun_F0161"
FT   CDS_pept        211809..212063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_03210 transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78958"
FT                   /db_xref="UniProtKB/TrEMBL:B2IT42"
FT                   /protein_id="ACC78958.1"
FT                   /translation="MSQCVGRVPRLEATGEPEGLNQVEIELSVLSRQCLERRIPNAETL
FT                   TSEIAAWEKKRNQQKASVYWGFQTKDARRKMERLYPNLT"
FT   gene            212414..213817
FT                   /locus_tag="Npun_F0162"
FT   CDS_pept        212414..213817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0162"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   ava:Ava_3967 isopropylmalate isomerase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78959"
FT                   /db_xref="GOA:B2J3M9"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3M9"
FT                   /protein_id="ACC78959.1"
FT                   /translation="MSKGTLFDKVWDLHTVGTLPSGLTQLFIGLHLIHEVTSPQAFAML
FT                   RERGLKVLFPERTVATVDHIVPTENQARPFVDSLAEEMIQALENNCQENNITFYNIGSG
FT                   SQGIVHVIAPELGLTQPGMTIACGDSHTSSHGAFGAIAFGIGTSQVRDVLASQTLALSK
FT                   LKVRKIEVNGNLNPGVYAKDVILHIIRTLGVKGGVGYGYEFAGTTFEQMNMEERMTVCN
FT                   MAIEGGARCGYVNPDRVTYDYLKGRDFAPKGADWDKAVAWWDSIKSDVDAQYDDVVVFD
FT                   AAEISPTVTWGITPGQGIGVNQSVPQPEELLEEDRFIAEEAYRYMDLYPGQPIKGTKID
FT                   VCFIGSCTNGRISDLREAAKIAKGRHVAEGIKAFVVPGSERVKQEAETEGLDKIFQEAG
FT                   FEWREPGCSMCLAMNPDKLQGRQISASSSNRNFKGRQGSSSGRTLLMSPAMVATAAIKG
FT                   EVSDVRELL"
FT   gene            213899..214507
FT                   /locus_tag="Npun_F0163"
FT   CDS_pept        213899..214507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0163"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   ava:Ava_3966 isopropylmalate isomerase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78960"
FT                   /db_xref="GOA:B2J3N0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N0"
FT                   /protein_id="ACC78960.1"
FT                   /translation="MVSEVKTVSGRGIPLVGNDIDTDRIIPARYLKAVTFDGLGEGAFI
FT                   DDRTALKGEHPFDQPQYQGANILIVNRNFGCGSSREHAPQAIAKWGIQALIGESFAEIF
FT                   FGNCVAMGIPCLTADAATVKQLQKLVAANPQASVTVNLETLQVQIDNYTAPVAIGEGTR
FT                   STFISGTWDACGQLVANASQVRKTSAKLPYIGWGNIAAS"
FT   gene            complement(214617..216908)
FT                   /locus_tag="Npun_R0164"
FT   CDS_pept        complement(214617..216908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0164"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="KEGG: ana:all0713 1,4-alpha-glucan branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: glycoside
FT                   hydrolase, family 13 domain protein; alpha amylase,
FT                   catalytic region; alpha amylase, C-terminal all-beta;
FT                   SMART: alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78961"
FT                   /db_xref="GOA:B2J3N1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N1"
FT                   /protein_id="ACC78961.1"
FT                   /translation="MSMTTIAPEQVNSIVWNQHNDPFEILGSHPIEQDGKTVWAVRAYL
FT                   PNASAVWVVLPEQRKEYPMQTVHHPHFFECTIETAELANYQLRIKEGEHERVTYDPYAF
FT                   RSPNLTDFDLHLFSEGNHHRIYEKLGAHPTEIGGVKGVYFAVWAPNARNVSLLGDFNLW
FT                   DGRKHQMRKGPTGVWELFIPEIGMGEHYKYEIKNFEGHIYEKSDPYGFQQEPRPKTASI
FT                   VTDLDAYTWNDESWMEKRRHTDPLTQPVSVYEVHLGSWLHASSAEPAKLPNGETEPVVV
FT                   VSELKPGARFLTYRELADRLIPYVKELGYTHIEMLPIAEHPFDGSWGYQVTGYYAPTSR
FT                   FGSPEDFMYFVDKCHQNDIGVIVDWVPGHFPKDGHGLAFFDGSHLYEHADPRKGEHKGW
FT                   GTLVFNYGRHEVSNFLAANALFWFDKYHIDGIRVDAVASMLYNDYCREPGEWLPNQYGG
FT                   RENLEAADFLRQVNHIIFSYFPGILSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHD
FT                   MLDYFSMDPWFRQFHQNNITFSMWYNHSENFMLALSHDEVVHGKSNIIGKMPGDTWQKL
FT                   ANIRCLFTYMFAHPGKKTMFMSMEFGQWSEWNAWADLEWHLLQHEPHQQLKTFFQGLNH
FT                   LYRSEPVLYTQDFAEPGFEWIDCSDNRHSVVSFIRRDKDSDDFAIVVCNFTPQPHSHYR
FT                   IGVPQKGFYTELFNSDARQYGGSNMGNLGGKWTDDWSLHSRPYSLDLCLPPLGVLILKL
FT                   DKKKTAEVIG"
FT   gene            complement(217058..217393)
FT                   /locus_tag="Npun_R0165"
FT   CDS_pept        complement(217058..217393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78962"
FT                   /db_xref="GOA:B2J3N2"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N2"
FT                   /protein_id="ACC78962.1"
FT                   /translation="MGRVKAIKAVKFLSLFVISATFFVVSGYWTSSIVIALPPPEDTPE
FT                   EILRTKIIIEARSPIDGSFLTAAEYIQVQAQLQEAPPPKLDPKIREQIFLLRLRKTLLQ
FT                   FFPFLNF"
FT   gene            217920..218213
FT                   /locus_tag="Npun_F0166"
FT   CDS_pept        217920..218213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78963"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N3"
FT                   /protein_id="ACC78963.1"
FT                   /translation="MPYLGVAAGVVAGVAAGVGAGVVLVAGGASVGSPVAAGVLGVVPP
FT                   SPPPSPQAPRIVARLKITAKPKIFVFITPLSPIVARKIFRLLNTIPYLLLFF"
FT   gene            218640..219341
FT                   /locus_tag="Npun_F0167"
FT   CDS_pept        218640..219341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78964"
FT                   /db_xref="GOA:B2J3N4"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N4"
FT                   /protein_id="ACC78964.1"
FT                   /translation="MVVARKSAISGRGNWFWRDSMLSLGRRRSARIESLAQNASTPATK
FT                   ATPLSSQRQQRSSKNLAVSATNKAAMPKSVKELGRQKLPNLNEQSSATQKSSGVDFLGL
FT                   PTMPNSGAAPLWLLRLYTFHRYSAVLAFLVVASTLAVYGWTVYSQELWSKSYRRLQNLQ
FT                   RHERLLTTTNATLTNRMAKEAEQPTAGLISPTPQGMIFLSPAPHTPKPASSNNITPSSE
FT                   TQRQTLSPLGY"
FT   gene            219447..221285
FT                   /locus_tag="Npun_F0168"
FT   CDS_pept        219447..221285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0168"
FT                   /product="penicillin-binding protein, transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   ava:Ava_4620 penicillin-binding protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78965"
FT                   /db_xref="GOA:B2J3N5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N5"
FT                   /protein_id="ACC78965.1"
FT                   /translation="MQKLPSRTRLRKFRNPGFKKQQKGSKRGLLGTLASNIQNQTSNTN
FT                   SRLFVVWGVLMAAGLGLGIKLYNLQIVKGTKLTEQARNQQMVDLRPFMPRRPVVDRNSE
FT                   LLAIDRPVYTLYAHPKLFDKSNEEMAERLAPILAKDTAELVKTFQSKRSGIILAPALPE
FT                   EIIDRVTSLRLNGLELIQKYSRYYPPDDLVSDVVGYVNVDRRGQAGVEYSQEKLLERPV
FT                   QTVRLSRSGNGAVMPDHAPEGFLHFDDLRLQLTIDSRLQRIASLALKQQMEKFDAKRGA
FT                   VIVMDALDGSLLALVSQPTYNPNEYAKANISLFKNWTVADLYEPGSTFKPLNVAIALEN
FT                   SVIKPDDMFNDSGSIRVANYTIKNAMNNGNGRISIAQILQYSSNIGMVQIIQRLKPSIY
FT                   YNWLERLGLGQKVDTDLPFEVGGRLKSQEEFIASPIEPATTSFGQGFSMTPIQLVQMHG
FT                   ALANGGKLVTPHVVRGLIDTKGQMHDSPTRTVSRQIFSAATAQKVVEMMETVVNEGSGK
FT                   AAQIPGYRIAGKTGTAQKASPNGGYIKGARMTSFVAILPVESPRYVVFALVDEPKGESA
FT                   YGSTVAAPIVKSVIEALIPLEEIPPSKPIEQQPKAP"
FT   gene            221496..222602
FT                   /locus_tag="Npun_F0169"
FT   CDS_pept        221496..222602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0719 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78966"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N6"
FT                   /protein_id="ACC78966.1"
FT                   /translation="MQSNLVIFPNAGTAKKSTQTEERTITNYDRAEEQFIELLAMEDLD
FT                   RKLDVKPSIASEFEQALSTAIRGAYKNDRSNEQAHRFLQRILYRINRLKLFWYDDLRHY
FT                   TNERSLYLCSCRDQIEAAWQNWELAQIDLPALQQLDVKHALIERASADLNPPLSDSSRY
FT                   IREEMTEAGYRHLLAIGSFDGLVEGSRLCYVLGGAANEVQCTLVRVLLEEYGNGRLSRK
FT                   HSTFFAQMLAEFGMNTEPEGYFDLVPWEVLACANHNFLTTDRKRYFLRYCGALTYFEVA
FT                   GPAAYKNYLAAAQRLGLSEAAMGYWELHIREDERHGRWMLDDVALSLAEQYPKSAWELV
FT                   LGYDQEKLMGDRAASAVVRSIREAKQFV"
FT   gene            222811..223506
FT                   /locus_tag="Npun_F0170"
FT   CDS_pept        222811..223506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr0720 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78967"
FT                   /db_xref="GOA:B2J3N7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N7"
FT                   /protein_id="ACC78967.1"
FT                   /translation="MKDIFFCPEESNFYSNCLESFVIRNCKSSESIVEFGSGDGSPVIN
FT                   SLLRNNFNGVIQGFELNTSAWKVANSTIDEYNLTNKYIIHNSSLFNSSQPDAEYLVANP
FT                   PYLPAPDDDIYIPLLFGGVDGATVTNDLLSLDYENVLVLISSFSNPINTLNLAKENGYY
FT                   VQNFMVLPLQFGYYSSEPKVKNHIEELRKNKMAFYSGDYYFLAGVLFTKSENPGIDLSN
FT                   QLAQVMTSL"
FT   gene            complement(223590..224588)
FT                   /locus_tag="Npun_R0171"
FT   CDS_pept        complement(223590..224588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0171"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: ana:all1051 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78968"
FT                   /db_xref="GOA:B2J3N8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N8"
FT                   /protein_id="ACC78968.1"
FT                   /translation="MSVAISTTSPIIIAHRGASGYRPEHTLAAYELAIVLGADYIEPDL
FT                   VSTKDGVLIARHENEISETTDVARHVEFAHLQTTKIIDGESKTGWFTEDFTLAELKTLR
FT                   AKERIGQMRSQNTAYDGLFEIPTLQEIIDLVKRKSAEINRAIGIYPETKHPTYFKSIGL
FT                   ALEPFLLATLTANGYEGANAPIFIQSFEVSNLQDLSTKTDLPLVQLLNNSGKPNDFVVS
FT                   GDERTYADLVTASGLREIAKYAQAVGVHKNLLIPRDSSGKLQSPTSLVTDAHTAGLLVH
FT                   VWTFRNEDCFLPLDFQGNPQGEYELFFSLGVNGVFSDYPDMASTVKENLRL"
FT   gene            complement(224572..225522)
FT                   /locus_tag="Npun_R0172"
FT   CDS_pept        complement(224572..225522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2150 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78969"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3N9"
FT                   /protein_id="ACC78969.1"
FT                   /translation="MFIRSLTFTASSAALLATLVSSAFAAPINFANSVSNSETNTKVIA
FT                   QNVAQLQRIPDVRRQAIANGQDRYAAIWVKSGSGAWEARHGLTSAQYQATFDKLVGEGY
FT                   RLVDVSGYEVKGQGRYAAIWVKSGGPAWQARHGLTSAQYQATFDKLVGEGYRLVHVSGY
FT                   AVNGQDRYAAIWEKSDGPAWQARHGLTSAQYQATFDKLVGEGYRLVDVSGYGVNGQDRY
FT                   AAIWVKSGGPAWQARHGLTSAQYQATFDKLVGEGYRLVDVSGYDVNGQNRYAAIWEKSG
FT                   GSAWQARHGLTSAQYQATFDKLVGEGYRLVDVSGY"
FT   gene            226296..228332
FT                   /locus_tag="Npun_F0173"
FT   CDS_pept        226296..228332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0173"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: ana:all1717 DNA ligase; TIGRFAM: DNA ligase,
FT                   NAD-dependent; PFAM: BRCT domain protein; zinc-finger,
FT                   NAD-dependent DNA ligase C4-type; NAD-dependent DNA ligase,
FT                   OB-fold; NAD-dependent DNA ligase, adenylation; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1; NAD-dependent DNA
FT                   ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78970"
FT                   /db_xref="GOA:B2J3P0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J3P0"
FT                   /protein_id="ACC78970.1"
FT                   /translation="MTQIKPEVKRTEELRQLLQQASYAYYVLDTPIMEDSVYDQLYREL
FT                   QQLEIQYPELTAPDSPTQRVGERPATQFTSVRHNIPLYSLENAFNIDELQGWDQRWRRQ
FT                   VPKIDSVEYVTELKIDGSALALTYQDGILVRGTTRGDGVMGEDITQNVRTIRSIPLRLN
FT                   FEGLEILERVEVRGEAFLPLEVFKQINEERQKAGEQLFANPRNAAAGTLRQLDSRIVAK
FT                   RRLAFFGYTLHIPGRDDTSIANTQWEALELLEKMGFQVNPNHKLCASIAEVAKYYEYWD
FT                   TERLNLPYMTDGVVVKLNSFKLQEQLGFTQKFPRWAIALKYPAEEAPTRVENIAVNVGR
FT                   TGALTPLAEMRPVQLAGTTVSRATLHNSDRIAQLDIRIGDTVIVRKAGEIIPEVVRVLK
FT                   ELRPAETEPFVMPTHCPVCDQAVVRESGEAVTRCVNASCAAILKGSIEHWVSRDALDIK
FT                   GLGEKLVHQLVDKVLVHSVADLYELTAEKLCALERMGQKSAEKLVDAIAQSKNQPWSRV
FT                   LYGLGIRHVGSVNAQLLTQKYFTVEQLATAKQSDIEGIYGIGAEIAQSVYQWFRIDANQ
FT                   RLIERLQAEGLQLTAPEETKAFGDGNQIFAGKTFVVTGTLPTLKRDEAKALIQKAGGKV
FT                   TDSVSKKTDYLVVGEDAGSKLEKALSLGITQLSEAQLLEMLNE"
FT   gene            228722..230951
FT                   /pseudo
FT                   /locus_tag="Npun_F0174"
FT   gene            229182..230098
FT                   /locus_tag="Npun_F0175"
FT   CDS_pept        join(229182..229600,229600..230098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Npun_F0175"
FT                   /product="transposase"
FT                   /note="KEGG: eba:ebA5690 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78971"
FT                   /db_xref="GOA:B2J3P1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P1"
FT                   /protein_id="ACC78971.1"
FT                   /translation="MAKKYIVDLNEDEVSQLQSIIKKGKHKARNISRANILLMASEGET
FT                   DQAIASIVRAHVATVQRIREKFVIGGLDFALKDEVHPPKHKKLDEKQEAFLIATACSNP
FT                   PEGRVRWTMQLLADHLVNVGIIDSISDETVRQTLKKNEIKPWLKEQWCIPEVNAEYVFR
FT                   MEDVLDLYNEPYDPKRPVVCFDERPDQLVEEVRLPLPPQPEQPERYDFEYKRNGTVNLF
FT                   ACFQPLAGWRHIEVTERRTKADFAKQMKNLVDVSYRDADVIRLVVDNLNIHTPNALYEV
FT                   FPPEEARRIIQKLEFHYTPKHASW"
FT   gene            230095..230349
FT                   /locus_tag="Npun_F0176"
FT   CDS_pept        230095..230349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_03210 transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78972"
FT                   /db_xref="UniProtKB/TrEMBL:B2IT42"
FT                   /protein_id="ACC78972.1"
FT                   /translation="MSQCVGRVPRLEATGEPEGLNQVEIELSVLSRQCLERRIPNAETL
FT                   TSEIAAWEKKRNQQKASVYWGFQTKDARRKMERLYPNLT"
FT   gene            231213..231443
FT                   /locus_tag="Npun_F0178"
FT   CDS_pept        231213..231443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78973"
FT                   /db_xref="GOA:B2J3P3"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P3"
FT                   /protein_id="ACC78973.1"
FT                   /translation="MSEEKPISPWNYKPWWCQPWSIVLTGVTIISGSWLLFKTIWLTIL
FT                   VSIPIVMWMGFFVLFWPQLMIRSGILESYKD"
FT   gene            complement(231465..231818)
FT                   /locus_tag="Npun_R0179"
FT   CDS_pept        complement(231465..231818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78974"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P4"
FT                   /protein_id="ACC78974.1"
FT                   /translation="MITEEDLAQQFTLIMEQSHPTVWELLRHCYIKVLNSSLKGACTAH
FT                   AKYIRIYCPDRLIAAVVAEKNLLIEVAEYLGLVEVVCLNATNLLYDPKSQIKKAYPQLW
FT                   LDLMWIVTQKQEL"
FT   gene            232107..232430
FT                   /locus_tag="Npun_F0180"
FT   CDS_pept        232107..232430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78975"
FT                   /db_xref="GOA:B2J3P5"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P5"
FT                   /protein_id="ACC78975.1"
FT                   /translation="MNQSKNFAHRKKASDILILVKSTMAFEKLEIKANQSGQSSTQRSS
FT                   GLGCKIKRSHIFIFAVSLLNCLALSFAQPLAKNRPGGELRGLESNSRNFSASKQTISRV
FT                   VGK"
FT   mobile_element  complement(232412..233416)
FT                   /mobile_element_type="transposon"
FT   gene            complement(232472..233365)
FT                   /locus_tag="Npun_R0181"
FT   CDS_pept        complement(232472..233365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0181"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ter:Tery_1717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78976"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B2IT26"
FT                   /protein_id="ACC78976.1"
FT                   /translation="MLNIEGALKQDRLLRALTGLNRKAFDALLPTFTTMYLDTQQAKPR
FT                   QRGLGGGRKARLLTAQDKLFFILFYFKCYPTFDVAGLLFDMHRSQAHEWMHRLQPILEA
FT                   ALGQKMALPERHLESIEAFLSRFPGVQRVMIDGTERPIARPQEREQQQQNYSGKKKRHT
FT                   RKHLAAVDETKRVLILSKAREGKLHDKRFHDEDDIAGSVPDEIPIEVDSGFQGLQKQYD
FT                   NLHLPHKKPKGGKLSDLQKTENRQLSQSRVVCENAFAGVKRYNAASVIYRNRIENFDDH
FT                   LMLTAAGLWNFYLMAA"
FT   gene            233572..234792
FT                   /locus_tag="Npun_F0182"
FT   CDS_pept        233572..234792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0182"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: pfo:Pfl_2176
FT                   putative diguanylate cyclase (GGDEF domain) with GAF sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78977"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P7"
FT                   /protein_id="ACC78977.1"
FT                   /translation="MNNRANQRHEEHHAIQYFCIFNRMLIFVAEIFISRSLVAGELALR
FT                   LLQKFQRIGLSLLRRGHSSVKTPVAPLYKNEAERLKALADYNILDTLPEQAFDDLTAIA
FT                   AYICKTPIALISLVDADRQWFKSNIGLKVRETPRESAFCSHAILHPENILVIPNAMKDD
FT                   RFANNPLVKSNSKIRFYAGAPLVTPNGFPIGTLCVMDTVPRQLSYQQLDALRRLTRQAI
FT                   AQMELIQEIRNRKQSEIEGRQLSLTDDLTGLHNRRGFFVMAEQQLKIAHRMRLLCWVIF
FT                   IDLDGLKQINDTLGHDIGDALIVDAGRLLKQSFRNSDIVARLGGDEFIIFISSYFKDAD
FT                   SIQAYLQINIANFNQQQNRSYELSMSMGIERYSPGSNMSLEQLIARSDELMYAHKRLKR
FT                   QSIYQQE"
FT   gene            235093..237270
FT                   /locus_tag="Npun_F0183"
FT   CDS_pept        235093..237270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0183"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; FG-GAP
FT                   repeat protein; SMART: Integrin alpha beta-propellor repeat
FT                   protein; KEGG: syf:Synpcc7942_1337 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78978"
FT                   /db_xref="GOA:B2J3P8"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P8"
FT                   /protein_id="ACC78978.1"
FT                   /translation="MADTLLFNLSSLNGKNGFAINGIASDSSGNSVSNAGDINHDGIDD
FT                   LIIGAPGTGKSYVVFGSTNAFSTNLDLSSLDGSTGFTINGSASDSSGNSVSNAGDINGD
FT                   GIDDLIIGASGAALGAGKSYVVFGSTNAFSANLDLSSLDGSKGFAINGINGRNSDGISD
FT                   SSGTSVSNAGDINGDGIDDLIIGAPSALSGAGQSYVVFGSTKGFSANLDLSSLDGSNGF
FT                   AINGNGSDSSGNSVSNAGDVNRDGIADLIIGAQGTGKSYVVFGKTSAFSANFDLSSLNG
FT                   SNGFVINGNANDFFGASVSNAGDVNNDGIDDLIIGAYNAASVAGQSYVVFGNSSGFSPS
FT                   FNLSNLNGSNGFAIKGINENDISGFSVSAAGDVNGDHIADLIIGAPFALSAAGQSYVVF
FT                   GRSSGFDSTLDLSTLNPSKGFAINGIKDNDVSGISVSAAGDINGDKIDDLIVGALGASD
FT                   GAGQSYVIFGTKTPINNAPVAIHDTVTTAKNTAFCIKVNTLLANDSDIDGNSLKITSVS
FT                   GATNGTAVLKDNHTPNNSADDFILFTPIRGFSGAATFKYTITDGQLTSTAKVTVEVGAR
FT                   LFGGKGNDHINGTPGNDYINGGNGRDSLNGGNGDDTLLGGNGNDILVGGNGNDILDGGN
FT                   GNDRLSGGFGKDILTGGNGKDIFILAATQGGDKITDFTKGTDLIGLSGGLSFGQLSFSG
FT                   NKIIVTATDEVLATLTGINTTTLSTANFTIV"
FT   gene            complement(237583..237817)
FT                   /pseudo
FT                   /locus_tag="Npun_R0184"
FT   gene            237960..239147
FT                   /locus_tag="Npun_F0185"
FT   CDS_pept        237960..239147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0185"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ana:all4857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78979"
FT                   /db_xref="GOA:B2J3P9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3P9"
FT                   /protein_id="ACC78979.1"
FT                   /translation="MSLSLCMIVKNEAATLPKCLNSVRKVVDEMVVLDTGSIDRTPNIA
FT                   QQLGAKVHHFKWSNDFSAARNAALKYVTGDWVLVLDADETLTPGIVPQLREAIARDEYL
FT                   LINLVRQEVGAEQSPYSLVSRLFRNHPDIRFDRPYHALVDDSVSAIVNKEPHWQIGYLP
FT                   GVALVHTGYQKSAIAQNNKYAKAATAMEGFLATHPDDPYVCSKLGALYVETGKITEGME
FT                   LLRHGISVAEENYDILYELHYHLGIAYSRLQKSPQAISHYKAAIKLPIYPMLKLGAYNN
FT                   LGNLLKAAGDFNGAKTAYATTLKIDPNFVFGHYNLAMTFKALGLFTDAIVYYQHAITLN
FT                   PNYAEAYQNLGVVLLKVGNHQESLTAFRKAIALHERYNPEEAKRLRQGLQEMGLM"
FT   gene            239409..239867
FT                   /locus_tag="Npun_F0186"
FT   CDS_pept        239409..239867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_1116 probable membrane protein YmfA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78980"
FT                   /db_xref="GOA:B2J3Q0"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3Q0"
FT                   /protein_id="ACC78980.1"
FT                   /translation="MNEDTKFFRIFGSIFGGVGSIIAVTGIMIALNTRSFITSAIPAQG
FT                   TIIDLVQRSSTDKKGRSSYAYYPVIEFTARSGETTVFESNSGSNPPEFTKGQQVEILYS
FT                   PEKPNSAMIKSWLSLWFLPVMLTGLGSIFALVGGVVLIKSFPRLISSK"
FT   gene            complement(239983..241149)
FT                   /locus_tag="Npun_R0187"
FT   CDS_pept        complement(239983..241149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0187"
FT                   /product="aminotransferase, class I and II"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase, class I and II;
FT                   KEGG: ava:Ava_2127 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78981"
FT                   /db_xref="GOA:B2J3Q1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J3Q1"
FT                   /protein_id="ACC78981.1"
FT                   /translation="MKLAARVSQVTPSLTLAIAAKAKALKAEGIDVCSFSAGEPDFDTP
FT                   AHIKAAAVKALDEGKTKYGAAAGEPKLREAIAHKLKNDNGLDYKSENVIVTNGGKHSLY
FT                   NLIVALIDLGDEVIIPAPYWLSYPEMVTLVGGVAVIVPTDATTGYKITPEQLRKAITPK
FT                   TKLFILNSPSNPTGMVYTPDEIKALAQVVVDADIFVVSDEIYEKILYDGAEHISIGSLG
FT                   KEIFDRTLISNGFAKAYSMTGWRIGYLAGPVEIIKAASTIQGHSTSNVCTFAQYGAIAA
FT                   LQSSQDCVEEMRQAFAKRRQVMLDRLNAIPGLSTAKPDGAFYLFPDISKTGLKSLEFCD
FT                   ALLEKHQVAVIPGIAFGADDNIRLSYATDMATIEKGMDRLEKFVKSRI"
FT   mobile_element  241518..243160
FT                   /mobile_element_type="transposon"
FT   gene            241627..242936
FT                   /pseudo
FT                   /locus_tag="Npun_F0188"
FT   gene            243155..243742
FT                   /pseudo
FT                   /locus_tag="Npun_F0191"
FT   gene            complement(243825..244907)
FT                   /locus_tag="Npun_R0192"
FT   CDS_pept        complement(243825..244907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0192"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   ana:all3735 fructose-bisphosphate aldolase class I"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78982"
FT                   /db_xref="GOA:B2J4L0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L0"
FT                   /protein_id="ACC78982.1"
FT                   /translation="MTTTLIESSSIESLLGKEAEDLLTYKAKVSQNLLHLPGPDFVDRI
FT                   WINSDRNPQVLRNLQLLYSTGRLANTGYLSILPVDQGIEHSAGASFAPNPIYFDPENIV
FT                   RLAIAAGCNAVATTLGVLGIVSRKYAHKIPFIAKINHNELLTFPNQFDQVLFADVEQAW
FT                   NLGAAAVGATIYFGSDQSTRQIQEISKAFKRAHELGMATILWCYLRNNAFKQDKDYHLA
FT                   ADLTGQANHLGVTIEADIIKQKLPENNNGYGAVAKASGKSYGKTDERVYTELTTDHPID
FT                   LTRYQVLNCYSGRVGLINSGGATGKNDFAEAIRTAVINKRAGGSGLISGRKTFQRPFEE
FT                   GVKLFHTIQDVYLSPDVTIA"
FT   gene            245255..245572
FT                   /locus_tag="Npun_F0193"
FT   CDS_pept        245255..245572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78983"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L1"
FT                   /protein_id="ACC78983.1"
FT                   /translation="MSKFQIDIDFSNIDLASLETEEDFQREAKILLPKVLVKLGESVGE
FT                   KTWEELQQKMQASGAKLKSSPTEKRKFMQETGRTYQRNASNREKQELEEYIVDQLRQYK
FT                   L"
FT   gene            245970..246968
FT                   /locus_tag="Npun_F0194"
FT   CDS_pept        245970..246968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0194"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: ter:Tery_2409
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78984"
FT                   /db_xref="GOA:B2J4L2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L2"
FT                   /protein_id="ACC78984.1"
FT                   /translation="MLNWDRTLLTTSSLCLLLFTTMLPVRAKPVQPKKPAPTATTIYQQ
FT                   AKKELPEDFYTLYRVIDRVARANELDNRPWRVVAVPKYDVNAYASDVNLVAIYDGILDQ
FT                   LAGDSSALACVVAHEMGHHTKRHIAVGEAKKTELIAKIQEEATKEVLGEREAANQESTA
FT                   ANVGGAVVNRVVGGTFGGLLGSVLGNQGAQRQVESQQRINEIVEKKKKELEQRLAEQER
FT                   QQEFEADEIGYIASVKAGFEPEGCLRVMQVLAQTPGSEFDTTHPAVPKRIEAIKALIIK
FT                   YPPQTLAKEGEARISKTKPLTYNISKDKTSLRINSVRGGSQADDIERRFGK"
FT   gene            247225..247815
FT                   /locus_tag="Npun_F0195"
FT   CDS_pept        247225..247815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0195"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: ava:Ava_0338
FT                   thioredoxin-related"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78985"
FT                   /db_xref="GOA:B2J4L3"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L3"
FT                   /protein_id="ACC78985.1"
FT                   /translation="MSTDSPVNSSDKSESSLGKRLRNFLVVMVAIALSVALVLGLRTET
FT                   TSASLAKLSNSSTPLEVAVSNGKPSLVEFYADWCTVCQKMAPDITQLETEYADKMNFVM
FT                   LNVDNTKWLPEMLKYRVDGIPHFVFLSQQGETIAQAIGDQPRTIMASNLEALVTGSSLP
FT                   YAQASGKVSKFSAPVAPTASQDDPRSHGSQVVN"
FT   gene            complement(247955..248803)
FT                   /locus_tag="Npun_R0196"
FT   CDS_pept        complement(247955..248803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0196"
FT                   /product="cyanophycinase"
FT                   /note="TIGRFAM: cyanophycinase; PFAM: peptidase S51,
FT                   dipeptidase E; KEGG: ava:Ava_0337 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78986"
FT                   /db_xref="GOA:B2J4L4"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L4"
FT                   /protein_id="ACC78986.1"
FT                   /translation="MEVNSKQELIIIGGAEDKKEDCQILREFVRRAGGTKAKIVIMTAA
FT                   TELPRDVGENYIRVFEKLGAEDARIVDTETRDDAYSSTALEAVSKATGIFFTGGDQARI
FT                   TSILKDTELDTAIHKRFAEGAVIAGTSAGAAVMPDKMIVEGDSQTNPRMEIVEMGPGLG
FT                   FLPGVVIDQHFLQRGRLGRLISALVQEPADLGFGIDENTAMVVTDKQIEIIGEGSVTIV
FT                   DVQDTYNNMGEILKDEALAICGAKLHILPHGYKFDLKTRQPILNNGYIPDVPVLANSEK
FT                   I"
FT   gene            complement(249016..249465)
FT                   /locus_tag="Npun_R0197"
FT   CDS_pept        complement(249016..249465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78987"
FT                   /db_xref="InterPro:IPR009824"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L5"
FT                   /protein_id="ACC78987.1"
FT                   /translation="MINQITFLESCWHLSPPWGQTMPPLAVQILEEVFLSSSDLPGYCC
FT                   GVHWEGQEWVYAIFCLGEILYLSSKEFHPTNVFKNGVVPTSLFKLGDMVEVDFTPQPTR
FT                   RIIQGIFRLKSSWLYGVEWCTPIMEETALSQSQFIWLADVDLVKV"
FT   gene            250934..251506
FT                   /locus_tag="Npun_F0198"
FT   CDS_pept        250934..251506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0198"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: ava:Ava_C0143
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78988"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L6"
FT                   /protein_id="ACC78988.1"
FT                   /translation="MPLIRWEPFKEAEIMQRQINRLFDQMLSSQESDRLQGGVAHRGDI
FT                   IAFTPPAEIHETSDAFKLRIELPGLKPDDLDVKVSPEAVEISGERRFETTTEEKGIRRS
FT                   EFRYGSFGRIIPLSTRIQNDKVQAEFKDGVLCLTLPKAQSEQNRVVKVNLSDSTNGQSQ
FT                   QLGNGHSQPTNEKESLQAEETVASNPQ"
FT   gene            251672..253642
FT                   /locus_tag="Npun_F0199"
FT   CDS_pept        251672..253642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0199"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /EC_number="3.8.1.9"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mxa:MXAN_1405 oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78989"
FT                   /db_xref="GOA:B2J4L7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR019714"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L7"
FT                   /protein_id="ACC78989.1"
FT                   /translation="MNINYQNLPIFTLFIIGALLSSLLLDRWWRDRIYNLNGKTVLITG
FT                   GSRGLGLVMARQLIQAGARLAICARDPEELERSRIELEQRGGEVLAVPCDVTDKTQVEQ
FT                   MVQQVRDRFGAIDILINNAGVDFVGPMDLMTVEDYDDAMKLHFWAPLYASYAVLPQMRE
FT                   RHQGRIVNISSIGGKVVFPHMLPYCASKFALTGLSEGMRAELAQEGISVTTVCPGLIRT
FT                   GAPENVIFKGQHRKEYAWFSISDSLPLLSMSAEVVAYKTIAALKRGDAEIILSLPAQIA
FT                   TRFHGLFPGLNTNLLTWVNWLLPAASGGIGTERALGKDSHSFLSPSWLTYLSNRAARRN
FT                   NTITRNEENGDRADRQIVQPTPQTTTEQPKIQLIQPSQASPEIQACFNDIQDTLGIPWT
FT                   PANWRAYAMYPSVMQLFWQRLKPAMQTEAFLEDAIAISEHVYRDINDWYQPGYQIEVEQ
FT                   AQQHHIRQELNAFIFGNPQLLIQQIALSKTLAGEIVGQDGSIDSRHGPNAYRHHQIQLI
FT                   DEQSAQEISPEMPQVYQDIKQTLGVPIVNSDYQALARWPAFFLAAWSDIKVWRERPEYQ
FT                   LLVQDVVQKAEEAASRLSPAVWVGEREVEDILDNPDNFEQIQQMVQMFKDILPELIVQN
FT                   ALFHFGLRRVQSVKGIGSSQL"
FT   gene            253732..254196
FT                   /locus_tag="Npun_F0200"
FT   CDS_pept        253732..254196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0200"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: cya:CYA_2243
FT                   putative phosphatidylethanolamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78990"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L8"
FT                   /protein_id="ACC78990.1"
FT                   /translation="MEIRSPAFFIGNTIPFKYTCDGDNISPPIYWEAAPQETKSFALIV
FT                   DDIDAPNETFIHWVIYNIPADIRELPEGVAKQPKLPEGALQGKNNFGELGYGGPCPPKN
FT                   GAHRYFFTIYALDQMLDLAAGANKQQLLAAIKNHILDKAELMGRYAREIE"
FT   gene            complement(254286..254513)
FT                   /locus_tag="Npun_R0201"
FT   CDS_pept        complement(254286..254513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0201"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: dps:DP2646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78991"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4L9"
FT                   /protein_id="ACC78991.1"
FT                   /translation="MEQAILSHANIREADLSEANLEAADLSGADLAIADLHQANLHQAA
FT                   LERANLTGANLEDANLEGTILEGGNNNLAT"
FT   gene            complement(254535..254831)
FT                   /locus_tag="Npun_R0202"
FT   CDS_pept        complement(254535..254831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0202"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   cyb:CYB_0443 pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78992"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M0"
FT                   /protein_id="ACC78992.1"
FT                   /translation="MDVEKLRQLYAAGERDFSIVDLRGAVLENINLSGAILHGAMLDEA
FT                   NLQQANLSRADLSGATLNGADLRGANLSKADLSDAILDNAILEGAILDEAVLN"
FT   gene            255642..256520
FT                   /locus_tag="Npun_F0203"
FT   CDS_pept        255642..256520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0203"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ret:RHE_PE00299 putative oxidoreductase protein,
FT                   short-chain dehydrogenase reductase (SDR)family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78993"
FT                   /db_xref="GOA:B2J4M1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M1"
FT                   /protein_id="ACC78993.1"
FT                   /translation="MISQNLQEQQPKPPFPEQQQEVPGLESQMNPKPDYGENSYRGSGK
FT                   LQGKAAIITGGDSGIGRAVALAFAREGADVLIAYLNEEPDAEETVRIVEKEGRKCVAIA
FT                   GDIQQEAQCQQIVERAQSEFGKIDILVNNAAFQMTRESLDEISSEEFDRTFKTNIYAMF
FT                   YLCKAAVPHMQPGSAIINTASINAAEPKPKLLAYSATKAAIVNFTGGLAQLLAEKGIRV
FT                   NAVAPGPVWTPLIPATMPNEQVTQFGQQYPMKRPAQPAELAPVYVLLASSEASYVSGAV
FT                   IPVTGGQPVLP"
FT   gene            256931..257944
FT                   /locus_tag="Npun_F0204"
FT   CDS_pept        256931..257944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0204"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: bsu:BG14165 similar to glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78994"
FT                   /db_xref="GOA:B2J4M2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M2"
FT                   /protein_id="ACC78994.1"
FT                   /translation="MAISLKPLRNQVVVITGASSGIGLVTARMAAKQGAKLVLAARNED
FT                   ALRQLVDEIRAKGGQAIYVVADVGQEEDVNRIAERAIAEFGGFDTWVNNAGVSIFGRCM
FT                   DVSIPDMKRMFDTNFWGVVYGSRAAVNHFKQRKSGSGALINVGSFLGDRAVAVQSTYSA
FT                   SKHALHGWTDALRTELEAEGAPVSVTLIHPGRIDTPYNEHARSYMPKQPAHRGMIYPPE
FT                   AVTEAILYAAEHPKRDMFVGFQAKALAVLAGISPRLTDKLIELWAFPSQQSDRPSRDRE
FT                   DSALYRAGYGMHERGTHQGWIRSGSLYVKAEKHPVTTTIIVVGLGTLIWWFTSFAV"
FT   gene            258026..259102
FT                   /pseudo
FT                   /locus_tag="Npun_F0205"
FT   gene            259978..261834
FT                   /locus_tag="Npun_F0207"
FT   CDS_pept        259978..261834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0207"
FT                   /product="glycoside hydrolase family 2, sugar binding"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: glycoside hydrolase family 2, immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2,
FT                   TIM barrel; glycoside hydrolase family 2, sugar binding;
FT                   KEGG: nmu:Nmul_A1940 glycoside hydrolase family 2, sugar
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78995"
FT                   /db_xref="GOA:B2J4M3"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M3"
FT                   /protein_id="ACC78995.1"
FT                   /translation="MKLLDLDNPEVKLASKTDSNFVDLTATHPRPLLKRSRWQSLNGLW
FT                   KFSFDDQGKCVEPSDFSQWSNYIEVPYAPESTKSGINDRGFHPNCWYEREFETPPGDGR
FT                   LLLHFGAVDYRARVWVNDKYIAEHEGGHTSFTLDITHALNDSGTTKVTVWAQDDPHDLA
FT                   KPRGKQDWHLKPHSIWYPRTSGIWQTVWLERVGETYIGNLRWIPDCERWEIGFEAGLAG
FT                   NLLTSGVQIKIKLSAGGRVLASDTYEIFNGEITRRIVLSDPGIDDCRNELLWSPEKPTL
FT                   IDAQIQLWDKDCLLDEVQSYTAMRTVSIQRDRFMLNGRPYYLRLVLDQGYWPETLMTPP
FT                   SDEALRHDVELVKAMGFNGVRKHQKIEDPRFLYWADVLGLLVWEEMPSAYRFTPKAVER
FT                   MTHEWTEIIKRDVSHPCIVAWVPFNESWGVPNLVETAAHRNYVLAMYHLTKTLDPTRPV
FT                   IGNDGWESTDTDILAIHDYERQPERLAHRYRADIQISDLFERSRPGGRILTLDNYPHQG
FT                   QPVMLTEFGGIAYAPIDQPNADQAWGYEHCSNISELEMKYAALLKTVNDIELFSGFCYT
FT                   QLTDTFQEANGLLYGDRTPKFPIEAIRAATLSGQGLCTPTSC"
FT   gene            261813..262913
FT                   /locus_tag="Npun_F0208"
FT   CDS_pept        261813..262913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0208"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   PFAM: galactose-1-phosphate uridyl transferase domain
FT                   protein; KEGG: nmu:Nmul_A1939 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78996"
FT                   /db_xref="GOA:B2J4M4"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M4"
FT                   /protein_id="ACC78996.1"
FT                   /translation="MYSHKLLKPDGRKLKLYSRYPITSQLEATSPSNEPVQANPHLRWH
FT                   PLRGEWVAYASHRQGRTFMPPPEYNPLAPTTNPEFPTELPQGKYDVAVFDNRFPSMTPT
FT                   ANNPPDTIVETLPANGACEVVVFTQDARASLSSLELDHLDLLLEVWGDRTRELGLNPQI
FT                   QYVLPFENKGVEVGVTLHHPHGQIYAYPFIPPVPARMLSMQQEYYEKHRRGLLQDLIQK
FT                   EIADNRRIIYQDEYAIAFVPVCARYPYEVWIAPKEPVSTFMDLTPEQRWGLAKALKTVT
FT                   LKYDGLWNRPFPYLMAWFQAPTDGLAHPEAHLHAEFFPPYRTSERLKYLAGTELAAGMF
FT                   ANDALPEEKAKELQAVVVNIEEPISV"
FT   gene            263395..263607
FT                   /locus_tag="Npun_F0209"
FT   CDS_pept        263395..263607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr4048 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78997"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M5"
FT                   /protein_id="ACC78997.1"
FT                   /translation="MPGGHASHKGASNKPNINANGVIDDAADQSLNPDDLLSEEQTNTE
FT                   VHRVEESVKFPPATERPGEKSNTST"
FT   gene            complement(264010..266238)
FT                   /locus_tag="Npun_R0210"
FT   CDS_pept        complement(264010..266238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0210"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="TIGRFAM: photosystem I core protein PsaB; PFAM:
FT                   photosystem I psaA and psaB; KEGG: ana:alr5314 photosystem
FT                   I P700 chlorophyll a apoprotein A2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78998"
FT                   /db_xref="GOA:B2J4M6"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M6"
FT                   /protein_id="ACC78998.1"
FT                   /translation="MATKYPKFNQDLAQDPTTRRIWYAIATGNDFESHDGMTEENLYQK
FT                   IFATHFGHVAIIFLWASSLLFHVAWQGNFEQWIKDPLHIRPIAHAIWDPHFGKAAVQAF
FT                   TQGGAPYPVNIAYSGVYHWWYTIGMRTNNDLYQGSVFLLLLAALFLFAGWLHLQPKYRP
FT                   SLAWFKSAEPRLNHHLAGLFGVSSLAWAGHLIHVAIPESRGQHVGWNNFLTTLPHPAGL
FT                   APFWRGDWGVYAQNPDTAGHLFGTSQGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIA
FT                   VIFIVAGHMYRTNFGIGHSIKEMLNSKKFFGIQTEGQFNLPHQGLYDTYNNSLHFQLSL
FT                   HLAALGTALSLVAQHMYSMPPYAFIGKDYTTQAALYTHHQYIAGFLMIGAFAHAGIFWV
FT                   RDYDPEQNKGNVLERVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQIL
FT                   IEPVFAQFIQSAHGKLLYGMDTLLSNPDSIAYTAWPNYGNVWLPNWTAAINSGTNSLFL
FT                   TIGPGDFLVHHAIALGLHTTTLICVKGALDARGTKLMPDKKDFGFTFPCDGPGRGGTCQ
FT                   TSSWEQSFYLAIFWMLNLLGWVTFYWHWKHLGVWQGNVAQFNENSTYLMGWFRDYLWAN
FT                   SAQLINGYNPYGTNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTP
FT                   LANLVHWKDKPVALSIVQGWLVGLAHFTVGYILTYAAFLIASTAGKFG"
FT   gene            complement(266711..266986)
FT                   /locus_tag="Npun_R0211"
FT   CDS_pept        complement(266711..266986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0211"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACC78999"
FT                   /db_xref="GOA:B2J4M7"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M7"
FT                   /protein_id="ACC78999.1"
FT                   /translation="MQELQKNQKKPMKSQETQNKITENNVPLSDNTASDMNPQETGKSE
FT                   PITQVQRDSVITNQDLPNPLVRYGFTLVILATFLFVVAIYYGIINP"
FT   gene            267357..268445
FT                   /locus_tag="Npun_F0212"
FT   CDS_pept        267357..268445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0212"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: art:Arth_3332
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79000"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M8"
FT                   /protein_id="ACC79000.1"
FT                   /translation="MNEEVSKKLELIRQTLRESEVQGVRLRGTDWFAWATAGASNTVLL
FT                   TAETGVAEVLVTTEDAWVLTDEIEAQRLKDEELPANFKVHINPWADAAARESFVRDATS
FT                   GKIAISDRPISNLEKPLPPSLRKHKRVMMSSELERYRQVGQKASQAMTEVLKAAKPTWT
FT                   EYQLAGAGAEALWAKGLHPALTLVAGERRLPLYRHATPTGEQIGRQAMLVFCARGYGLY
FT                   ANLTRFVCFGELSGEQAELHSHVREIEAVVLNLCQPGTSLNAVYHALAQAYEQHGFPNA
FT                   IREHHQGGTTGYLAREIVANPTTTDTLTEGIAVAWNPSLPGAKVEDTFVILKDGKLENL
FT                   TFDPNFPSVEVEARLRPVPLYN"
FT   gene            268451..269533
FT                   /locus_tag="Npun_F0213"
FT   CDS_pept        268451..269533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0213"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase, C terminal domain protein; KEGG: nmu:Nmul_A1938
FT                   galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79001"
FT                   /db_xref="GOA:B2J4M9"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4M9"
FT                   /protein_id="ACC79001.1"
FT                   /translation="MDFQQVFGKPPETQASAPGRVNLLGEHTDYNDGFVLPTAIPQSTT
FT                   VQLGLSSDSHHHFYSENLNEQVSILDINHSPSGFASYIFGCIEVLQKAGYKIPSLCVYV
FT                   KSSVPMGSGLSSSAALEVATLRAVRQLLNFPIDDVEIAQFAQQAEIHYAGVQCGIMDQM
FT                   ASSLADTEHILFLDTRTLKRRVMPLPDNAEILVIDSGVPRTLATSGYNQRRAECEEAAR
FT                   SLGVKALRDITDVEVTEKLPEPLRRRARHVVTEDNRVLEVLQGVSSERFGELMNASHAS
FT                   LRDDYEVSVPALDTLVELLQKTPGVFGARLTGAGFGGASVALVVAGEARSIATHVLEQY
FT                   KQAGYNGQILVPSLELSDAA"
FT   gene            269523..269909
FT                   /locus_tag="Npun_F0214"
FT   CDS_pept        269523..269909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79002"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N0"
FT                   /protein_id="ACC79002.1"
FT                   /translation="MQPKVVYGNAAVEGVNRWGWFMGHFITPEDDPRSTEMLEVKWAVH
FT                   KAGDSRTEWAVNNQAATLSILIDGEFRLQFEDREILLSREGDYVLWCAGVPHWWVAESD
FT                   CTILTVRWPSKPGDSVALPEESKS"
FT   gene            270075..270908
FT                   /locus_tag="Npun_F0215"
FT   CDS_pept        270075..270908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0215"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: sme:SMb21341
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79003"
FT                   /db_xref="GOA:B2J4N1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N1"
FT                   /protein_id="ACC79003.1"
FT                   /translation="MVQSIGGIAKYSATDLDRFAQELNKDGICVIPGVFEQKLIDEWTQ
FT                   AFEKLFHERQNQPGGLAPREISRYYLTLPWIYPFANELVFANPVIMGVLERVFFQEYVM
FT                   VQMGVDVPFQGSDYQEIHRDFRPLFSDGLRPAVGDRIVTPLYALAVNFPLVEVTAENGP
FT                   FQMARGTHVLPREEGLKKVASGEIPMESFYMQPGDVMVRSPLALHRGSPNRTNQPRPMV
FT                   VMGYAMHWLHTPKVELTLQQDYYESLPVEMRQMLRCQVVEQLPKEKLETYVNFKY"
FT   gene            271228..271464
FT                   /locus_tag="Npun_F0216"
FT   CDS_pept        271228..271464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79004"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N2"
FT                   /protein_id="ACC79004.1"
FT                   /translation="MTSQTPPDSRQDEVKYDPQDNPGTQTTVPTTEEGDTPLDERYRMT
FT                   GQESGTDVHHGAESEAPGGAKSPGHPNQGTDSR"
FT   gene            271706..272884
FT                   /locus_tag="Npun_F0217"
FT   CDS_pept        271706..272884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0217"
FT                   /product="glycoside hydrolase, family 43"
FT                   /note="PFAM: glycoside hydrolase, family 43; KEGG:
FT                   dge:Dgeo_2722 glycoside hydrolase, family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79005"
FT                   /db_xref="GOA:B2J4N3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N3"
FT                   /protein_id="ACC79005.1"
FT                   /translation="MATVKYNAESPSKRNLLLSASLNSPFCCYLALVNFAALEFINFTF
FT                   GDRNIYRIEMQTYTNPVYKGYFADPFVWQHEGVYYAIGTGAAEAEGTVDEIPDAANINS
FT                   NNKSRVFPLLRSFDFVNWDYVGNALLRPDPALGDNFWAPEVAYCNRQFYLYYSVGHEDK
FT                   NHQLRVATSDTPLGPYQDIGESLVDPKSCPFAIDPHPFRDDDGQWYLFYARDFLDTSDR
FT                   ARAGTALVVDKLQSMTKLVGEGKVVLRARSDWQRFLANRLMYGEIYDWHTLEGPCVRKH
FT                   EGKYYCFYSGGRWETDNYGVDYGVADNVMGPYSDAGNETGPRVLKSVPNFVRGPGHNSI
FT                   VLGPDGKTEYVVYHAWTENMDMRQICLDMLIWKPEGPCCNGPTWTPQTISNY"
FT   gene            complement(272878..273360)
FT                   /locus_tag="Npun_R0218"
FT   CDS_pept        complement(272878..273360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1002 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79006"
FT                   /db_xref="GOA:B2J4N4"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N4"
FT                   /protein_id="ACC79006.1"
FT                   /translation="MENINQAKMIERYIALAIGITYLLLGLAGFVPALVSLPGTSESFV
FT                   PLDESAGAYSAGFGYIFGAIPTNFLHNIVRCAVGLLGITSYNNTTTARLFNRGFAVSYA
FT                   LLAIIGLLPLGKTFFGLMPLFGANVLLNALAAIAAGYYSVVIPAKVSGVNVSQNLQ"
FT   gene            complement(273661..273924)
FT                   /locus_tag="Npun_R0219"
FT   CDS_pept        complement(273661..273924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79007"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N5"
FT                   /protein_id="ACC79007.1"
FT                   /translation="MNAIVLSAPKFRSGQKVEFIGGEGIIKNYRPQSGSWVYLLEMPMG
FT                   LEPEMGRVGYETMIWLYEVDIYSPLNNFPQNKMLNHEQKYHL"
FT   gene            275060..277510
FT                   /locus_tag="Npun_F0220"
FT   CDS_pept        275060..277510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0220"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="PFAM: UDP-galactopyranose mutase; KEGG:
FT                   dge:Dgeo_2530 UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79008"
FT                   /db_xref="GOA:B2J4N6"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N6"
FT                   /protein_id="ACC79008.1"
FT                   /translation="MRRTMTSEKSQVKNNGVSNVISPKQRKTKRSQLAQTQSSSPSRLN
FT                   LTSSSKKVQSTETFKDTPDIVCLSHLRWNFVYQRPQHLLSRCAQGKRVFFIEEPIFSEE
FT                   PLASLDINEDSNGVVVVVPHLPQGLSEEAINADLKLLIDSLFAEHNINKYICWYYTPMA
FT                   IAFTRHLQPQAVVYDCMDELSAFQGASPTLKNYEAELFSRADLVFTGGQSLYESKVNQH
FT                   PNVYAFPSSVDVAHFGQARNVQEPEDQAHIPHPRLGFFGVIDERMDIELLAGIAEARPD
FT                   WHLVIIGPVVKIDPANLPQHENIHYLGGRDYKQLPAYLAGWDLAMLPFARNESTRFISP
FT                   TKTPEYLAAGRPVVSTSIRDVVRPYGESKLVRIADTVSEFVTAAELAMQEDTPASEWLS
FT                   RVDVFLEKISWDRTWASMMKLIDSAIAARDGEDKANSTGAAGKQAPNIITRDFVFDYLV
FT                   VGAGFSGSVIAERLATQSGKKVLVVDKRNHIGGNAYDHYDDHGVLVHKYGPHIFHTNSR
FT                   EVFEYLSRFTKWRSYEHRVLASVDGQLVPIPINLDTINKLYGMNLNSFEVEEFYKSLAE
FT                   PMEYIRTSEDVVVSKVGRELYEKFFRNYTRKQWGLDPSELDKSVIARIPTRTNRDDRYF
FT                   TDSYQAMPLHGFTRMFENMLNHPNIKVMLNTDYQEIQKAIPCREMVYSGPVDEYFDYRY
FT                   GKLPYRSLDFKHETHNTTVFQKAPVINYPNEQLYTRVTEFKYLTGQEHSKTSIVYEFPK
FT                   AEGDPYYPVPRSENQEIYKKYKVLADETPGIYFVGRLATYKYYNMDQCVAQALSVYKQI
FT                   AVKA"
FT   gene            277979..280186
FT                   /locus_tag="Npun_F0221"
FT   CDS_pept        277979..280186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0221"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="3.2.1.86"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: glycoside hydrolase, family 1; NAD-dependent
FT                   epimerase/dehydratase; short-chain dehydrogenase/reductase
FT                   SDR; 3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: dge:Dgeo_2008
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79009"
FT                   /db_xref="GOA:B2J4N7"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N7"
FT                   /protein_id="ACC79009.1"
FT                   /translation="MISAFNSTLKTNKAQLPLQVWAGVECTVNRVGEEYLDQLERNGHA
FT                   TRLDDLDLFAELGIHAIRYPILWERIAPNGLENADWSWADERLGRLRELGIRPIVGLVH
FT                   HGSGPRDTSLVDPEFPEKLAVFARAVAERYPWVTHYTPINEPLTTARFSGMYGHWYPHG
FT                   RDNLTFARALLVECKAIALSMQAIREVNPNAQLLQTEDLGKTHSTPKLAYQAEFENERR
FT                   WLSLDLLCGRINPTHPMWGYLRDCGVSESELEEFLQYTCPPGIIGINHYLTSERFLDEN
FT                   LENYPAWTHGGNGRDKYADVEAVRVCAEGLAGPRTLLKETWERYKLPFAVTEVHLSCTR
FT                   EEQLRWLNEVWNAAQELRDQGADVRAVTVWALLGSYDWNSLVTRSAGYYESGVFDLRSS
FT                   RPRQTAIAKMVRDLTTGHKPNHPLLDTPGWWHREERLLYPAVSCRVSPPSLPFSSPASN
FT                   RPLAIVGATGTLGNAFARLCQVRGISYCLLRRQDMDIANPASVNKALAELQPWAVVNAA
FT                   GYVRVDDAEREPDICLKVNAEGAAILAAACAQHNVALVTFSSDLVFDGAESNPYVETDT
FT                   VAPLNIYGCSKVLAEKLVLQAHPASLMIRTSAFFGPWDEYNFVTIALRQLAAGNTFVAA
FT                   EDAIVSPTYVPDLVHASLDLLIDGEKGLWHLANKSAVAWADLARLAAKKAGVSVSNLIA
FT                   RPTQELGFIAPRPAYSVLGSNRGELMPHLDSAISRYLEEKS"
FT   gene            280296..281282
FT                   /locus_tag="Npun_F0222"
FT   CDS_pept        280296..281282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0222"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain; KEGG: ava:Ava_1957 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79010"
FT                   /db_xref="GOA:B2J4N8"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N8"
FT                   /protein_id="ACC79010.1"
FT                   /translation="MSTILVTGGAGYIGSHAALALKNAGYEVIVLDNLSNGHRELVEEV
FT                   LQVKLIVGDMSDRSLLDDIFSTHNITAVMHFAAYIAVGESVTDPAKYYQNNVAGTLTLL
FT                   EAMLAASVNKFIFSSTCALYGVPKFVPLTEEHPQDPISPYAISKWMVERILSDFDTAYN
FT                   LKSVRFRYFNAAGADPNRLLGEDHEPETHLIPLVLLTAFGKRESILIFGTDYPTPDGTC
FT                   IRDYIHVTDLAQAHILGLEYLLKGGESEVFNLGNGSGFSVREVIETAKEITGKEIKIEE
FT                   RDRRPGDPPILVGSSDKATKILGWHPEYPNLNEIIAHAWKWHQQRHK"
FT   gene            281391..282347
FT                   /locus_tag="Npun_F0223"
FT   CDS_pept        281391..282347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0223"
FT                   /product="UV-endonuclease UvdE"
FT                   /note="PFAM: UV-endonuclease UvdE; KEGG: ana:alr1263
FT                   putative UV-endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79011"
FT                   /db_xref="GOA:B2J4N9"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4N9"
FT                   /protein_id="ACC79011.1"
FT                   /translation="MSVIEFQNLPNAQQCQKSTVPSLGLVCITSDKQVRFRTMTRTRYL
FT                   KLSLSDRESALSELYRHNLQRLHDALSFCQQNKIQLYRMSSNLFPLSDLEDEIGANILE
FT                   AMSADLATIGQRANALNIRMVLHPDQYVVLSSDSPEVVQASITNLAGHARILDLLGLPR
FT                   SPWSLMNIHGGKSQRAEQLVKIISELPENIKSRLTLENDEYAYSADEILAVCQQAGVPM
FT                   VFDAHHHICHENLDSYDHPSVASMFYAARETWKNPDWQLVHISNGEQAFNDRKHSDLIT
FT                   DMPNVYHQAPWIEVEAKRKEEAIALLRSWWLMNNNCT"
FT   gene            282605..284293
FT                   /locus_tag="Npun_F0224"
FT   CDS_pept        282605..284293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0224"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   ter:Tery_4208 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79012"
FT                   /db_xref="GOA:B2J4P0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P0"
FT                   /protein_id="ACC79012.1"
FT                   /translation="MQKIYGNVQGIKASQIKRLQQLYEQNQPADRFITPEFAQALATIS
FT                   QQIHHPICCYLNRRGQVIRIAVGTPIQTQIPPEELPRRSAERLSGIRCIATQVKSEPPD
FT                   EAALIAMMRQRLDALVMLTAIDGKVKEAFLSYLFPDSESPWVISPPLSLDDLTEQEFDE
FT                   LVHEWEREIVDAGDGIFLSQEIVSDQDRVLLVGVQTEDISVQRFEDGLAELVRLVESAG
FT                   GIVLDTMRQKRDRPHPQTVVGKGKIEEITLLAQKQRANLIVFDRDISASQARNLEQEIG
FT                   IRVVDRTEVILDIFAQRARTQEGKLQVELAQLEYMLPRLRGRGQEMSRLGAGIGTRGPG
FT                   ETKLETERRTIQRRINQLQQEVNDLQAHRARIRQQRQQQEIPVLALVGYTNAGKSTLLN
FT                   VLTNAEVFTADQLFATLDPTTRKVVITEPETQERRSILLTDTVGFIHELPPPLMDAFRA
FT                   TLEEVVEADAMIHVVDLSHPAWESHITSVLEILEEMPEIPEKSLIAFNKVDKVDSETLD
FT                   RVQQDYPEAVFISATQRLGLETLKMRSLQLIDEPVKAIAVPQNSY"
FT   gene            284308..285180
FT                   /locus_tag="Npun_F0225"
FT   CDS_pept        284308..285180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0225"
FT                   /product="peptidase T2, asparaginase 2"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: peptidase T2, asparaginase 2; KEGG:
FT                   aba:Acid345_0550 peptidase T2, asparaginase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79013"
FT                   /db_xref="GOA:B2J4P1"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P1"
FT                   /protein_id="ACC79013.1"
FT                   /translation="MIPTIIVHGGAKTITDDKVTANNAGCTAAAEAGWAVLISGGTAAE
FT                   AVEAATRVLEADPTFNAGLGATLNSDGEVELDAAIMEGSLSWGAIAAVQGVRHPISVAR
FT                   KIMDDKPRLLVARGGERFAIDCGAEMCKKEDLIAEEQWQQWKEDREVIDRPNTIGCVAL
FT                   DASGVLAAGTSTGGTTKQQQGRVGDTALVGCGLYADNKFGACSTTGDGESIIPVVLAKT
FT                   AIDFLSGDRHPDEAAQMAIDALVSKVKGEAGCILIDRQGRVGWAYNSSHMACAYMTAGQ
FT                   DKVAAFTKK"
FT   gene            286133..286861
FT                   /locus_tag="Npun_F0226"
FT   CDS_pept        286133..286861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0226"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   sus:Acid_2024 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79014"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P2"
FT                   /protein_id="ACC79014.1"
FT                   /translation="MNKLKIGTSGWVYKHWMDIFYPPNLPSDQQLSFYAQHFATVEINF
FT                   SFYRLPERSVFETWHKQTPSNFLFAVKGSRYLTHMKKLKDPIEPLSRIMERASGLQEKL
FT                   GPILFQFPHTWHINIERLQPFLELLQTYPKQKFTVEFRHSSWLIPQVYQLLETAGVGLC
FT                   LPVSPTVPLDICLTAPWTYIRMHSGQWNVGYTDEELSTWVERIRSFLMQEIDVYVYFNN
FT                   DPDGNAIRDAQRLYCLLGSC"
FT   gene            complement(286882..288345)
FT                   /locus_tag="Npun_R0227"
FT   CDS_pept        complement(286882..288345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0227"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ava:Ava_0184 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79015"
FT                   /db_xref="GOA:B2J4P3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P3"
FT                   /protein_id="ACC79015.1"
FT                   /translation="MVQPQEDDISVEASSLPPVPIQEISEDRTLTETVLFPTPKLFLKI
FT                   SKPEIRQSLRALTYESVFAAVLYSIIGGALLSNFLLELGAGPVEIGLLAAIPQMVNLLQ
FT                   PLGAYLVSRSTSFRWYFMCIFVPSRLLWLILLPAIWLVTSSRITGYQVVQLTLAILLVA
FT                   NIIEAFGRAPWLGWSAVLVPQRLRGRYFGFRNSILGLTNLVGVPLLGLAVSAWPSGTLQ
FT                   GYGTVLVLGIVLGVISVGCQFWMTDINPQLLKVGDSDTSHPQAQGIDFSIFKEANFLKF
FT                   VLYLSIWCFAVNISAPFFNLYMLDNLDIDISVVTIYHGLGTGANMLMLLLWGKLADRIG
FT                   NRPLLLLVGVLVAVTPLLWLFVGSDRISFWIWLPLLHILAGGTWAAIDLCTNNLMMGIA
FT                   PLRYQSSYFAIAGAIAGITGAMGITAGGFLATLLGAAGLLGLFVISGLLRMVALVPLVF
FT                   VQEQRSIPLGQLMRFLFPIKQPTDLIEVE"
FT   gene            289218..290993
FT                   /locus_tag="Npun_F0228"
FT   CDS_pept        289218..290993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0228"
FT                   /product="KAP P-loop domain protein"
FT                   /note="PFAM: KAP P-loop domain protein; KEGG: ana:all7133
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79016"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P4"
FT                   /protein_id="ACC79016.1"
FT                   /translation="MAQTTINDISVDSSLVDPEKDLLGHANFAKYLADSICKMTFPEGF
FT                   VIAVYGSWNSGKSTLLNFVVHYLQQKPDEEQPIIVPFNPWLLSGHQNITRRFFEQLQNV
FT                   LSQQSSVPKGLKERLADFAAIISDIPLPYAQTGKALAALLDEKDKEAAQLKEEVEDTLV
FT                   QQQRRIVVTIDDIDRLPAEDIKQLFRIFKAMRNFTNVVYLLVFDKQVVMKTIADPKEIS
FT                   GEEYLEKIIQVSFELPVPDKISLRRLLFEKLDNIFTESPKPEINQTRWGEIYFQGIDRF
FT                   INSVRDITRFVNTLTVTYPAVKDEVNPVDFIAIESLRVFSPNIYSIIHQNPHILVGEVN
FT                   PSIEELNSLLNTWIAQLPVEDKQPVKNLLMHLFPKLKSVFYNTCLHKKQELEWRKQLRV
FT                   CSLEIFPIYFRLSLSAVESSNSQIKTILGLVADVDKFRTHLIELAKQKLPNGTTQARVF
FT                   LEQLENCTEEEIPVNYIPLIVETLFDVSEQLLSQDYKAKGILDFGNEVIISRCISQLLC
FT                   QIDEISRFELLKKIILQGKALPIINHEIAILKEQQSQYDAEKSNYEEGLLVNAQHLKEL
FT                   EEITTRIQVKSDTIC"
FT   gene            291125..292816
FT                   /locus_tag="Npun_F0229"
FT   CDS_pept        291125..292816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0229"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ava:Ava_1581 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79017"
FT                   /db_xref="GOA:B2J4P5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P5"
FT                   /protein_id="ACC79017.1"
FT                   /translation="MESYDVVIIGAGHNGLVCAGYLLKAGYSVLLLEGRSLPGGGSTTE
FT                   ELMPNEAPGFKFSPCAINHLFIFLGPVIQELELHKYGLEYLSCDPVAFCPHPDGKNFLA
FT                   HKSVEKTCAEIARYSQRDAEKYAEYADFWQRFITGITPFFNAPPKSIVDIAGNYNLNSL
FT                   QDLFSLLGGSNTTLDLLRTLLSSATDNINEYFDSEFVKAPLARLSAELSSPPSQKAMSF
FT                   GAMMMMLRHNPGMARPRGGSGGLVEALVKMVKAEGGTILTDQKVEKVLVDGGKAVGVRV
FT                   AGGKEYRANKGVISSIDAKRLFLQLMDSSDVDENLRERLDRRIINNNETILKIDCALSE
FT                   PLRFVHHNHQDNYLMGSILIADSVNHVEQAHSLITLGKIPDEDPSMYVVMPTGLDPSMA
FT                   PEGKHTLWIEFFAPYQIAGGEGTGLKGTGWTDELKNKVADKVINKLAQYSPNLQHSIIA
FT                   RHVESPAELGERLGTYKGNYYHIDMTLEQMLCFRPLPELANYKTPIDNLYLTGAGTHPG
FT                   GSISGLPGRNCARVFLHNEQPIAQKIKEAGGSIKSAFTSVLRSESD"
FT   gene            293071..293277
FT                   /locus_tag="Npun_F0230"
FT   CDS_pept        293071..293277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0230"
FT                   /product="CAB/ELIP/HLIP superfamily protein"
FT                   /note="KEGG: ana:asr3042 CAB/ELIP/HLIP superfamily of
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79018"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P6"
FT                   /protein_id="ACC79018.1"
FT                   /translation="MATETNKVVKLSTEAKAYNGVDRNAWIFGWNPQQELWNGRLAMIG
FT                   FVSYLLWDLAGYSLLRDVLHLFR"
FT   gene            293516..293989
FT                   /locus_tag="Npun_F0231"
FT   CDS_pept        293516..293989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79019"
FT                   /db_xref="GOA:B2J4P7"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P7"
FT                   /protein_id="ACC79019.1"
FT                   /translation="MEKVSVIAKDVEQGENLGETQVIDRIGNQDVNTTGAVGDTLTATT
FT                   WGSALLGLSSLALPGLGAVLAAGSVGVALVSSVAGVAVGAAANQNLLKALGDLGIPEER
FT                   ARVYSDRLQQSYYLLILEGSEEEIHRVEPKLRDRGIEYWGVYDSANTQNGGVH"
FT   gene            295287..296288
FT                   /locus_tag="Npun_F0232"
FT   CDS_pept        295287..296288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0232"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ana:alr0430 probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79020"
FT                   /db_xref="GOA:B2J4P8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P8"
FT                   /protein_id="ACC79020.1"
FT                   /translation="MQLKPINQQVVSVVGASSGIGRITALEFARRGAKVVVSARSESKL
FT                   KSLVEEIRGFGGKATFCVADVEVFEQVKAIADKTVEIYGRLDTWVHVAAIGIFATFDKT
FT                   TPEEFKHVIDVNLMGQVHGAMAALPHLKREGRGALIHVSSMEGRRSLPYQSAYSSAKHG
FT                   IEGFLEAMRLELIHEKWPISVTSVKPAVINTPFWNNGLTKLGVKPSGIPPYYDPRIVSD
FT                   AILYAAEHPIRDLLVGDIAKLLDLAQKISPSLVDSLLLLLGFNSQHSDEPKSEDAPNNF
FT                   YQSVPEDNRIDGDYKNLVIPSISDLLGKLPLFQWGLAALLTVLAAQEFKQNK"
FT   gene            297058..297987
FT                   /locus_tag="Npun_F0233"
FT   CDS_pept        297058..297987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0233"
FT                   /product="manganese containing catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   ana:alr0998 putative catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79021"
FT                   /db_xref="GOA:B2J4P9"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4P9"
FT                   /protein_id="ACC79021.1"
FT                   /translation="MFYHTKRLQYYTRPQRPDPIYAKKVQELIGGVFGEMTVMMQYLFQ
FT                   GWNSRGPAKYRDMLLDTGTEEIGHIEILSTLIGHLLDKAPLKLQEQAAQDPVVGAVMGG
FT                   TNPRDVITDVIAAAMNPQHTIVTGLGAQPADSVGFPWNGRFIASSGNLLADFRSNLHAE
FT                   SQGRLQAVRLYEMSDDPGVKDTLSFLIARDTMHQNQWLAAIEDIESSGIETTPVPSSFP
FT                   LELEKREVSYQFWNHSEGTDSAEGRWAKGPSMDGKGEFEYVANPQPLGAEPQLSPADPR
FT                   LHGTPTPELTEGNGSSALPLVERTTISG"
FT   gene            complement(298142..298954)
FT                   /locus_tag="Npun_R0234"
FT   CDS_pept        complement(298142..298954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:slr0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79022"
FT                   /db_xref="GOA:B2J4Q0"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q0"
FT                   /protein_id="ACC79022.1"
FT                   /translation="MCRLIGYLGNAIPLDELLYKQEHSLYQQSYSPLELKSGVVCADGV
FT                   GVGWYDQVGKPFIYRNTIPMWNDPNLEELSNYVQSTCTVGYARLAGIGESLDISNCQPF
FT                   RSDQLLFVHNGEISNFQQTLYRPIRESLSDATYRLIKGTTDSEHIFALLVQMWQSSPDS
FT                   TLFWALGATLEKLTELASEYNTSFSANLIVSDGEAIAAIRYAYRTQAPTLYWSYDALKH
FT                   PNQVIVASEPLSNNQNWTAFDEQSMLFFQAQSLEPRISLLKKFSAIGV"
FT   gene            complement(299440..300144)
FT                   /pseudo
FT                   /locus_tag="Npun_R0236"
FT   gene            300778..301923
FT                   /locus_tag="Npun_F0237"
FT   CDS_pept        300778..301923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gka:GK2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79023"
FT                   /db_xref="InterPro:IPR019712"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q1"
FT                   /protein_id="ACC79023.1"
FT                   /translation="MLMFRNKYHNFNKNIKDNLQKSLLLQVPSNSGMLMLRIYCDVLPR
FT                   VRKHLEFWKKNAEQIPNPELRKQALLSIRTKTFHCEGGSIYGLLAKEEIEPIICFIVAY
FT                   QTISDYLDNLCDRSNSLDPKDFRTLHQACLDALTPSAKCINYYQFRQEQDDGGYLMKLV
FT                   KTCQNVLRQLPSYQLIAPSLYHLADYYCDLQVHKHVQVKERVPRLKAWFERHRNQIPQM
FT                   KWYEFSASTGSTLGIFCLVAYASDQDCSEELATKVKNSYFPWVQGLHILLDYFIDQEED
FT                   RIGGDLNFCAYYNNGQEISERFAYFLKQADKAVSRLPHDRFHRMINRALLGVYLADEKV
FT                   NQQENIKETAKKILSSCGGSSLFFMWNIMIMAQIRYRKILA"
FT   gene            302134..303249
FT                   /locus_tag="Npun_F0238"
FT   CDS_pept        302134..303249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0238"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   gvi:glr0393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79024"
FT                   /db_xref="GOA:B2J4Q2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q2"
FT                   /protein_id="ACC79024.1"
FT                   /translation="MSKIVVLGAGPAGCSAGYHLAKSGHKVMLIDKDCFPRDKTCGDGI
FT                   SLGSVQALSTMGIYPDDIKRLASEYAQIDGFLLGVSNEISHLCPTELKGYCIPRFVFDN
FT                   LLYQKAINAGCVARTQRISDIEGYHQELYSDFDYIIDARGVYAGEANAIAIRAYWSIKV
FT                   ADFPKIYLSKAQIYFDKAFGVNGYGWIFPVAVDSELVKLNVGVGVWLDEYQKNNTNIIR
FT                   LFNEFVQRNQATKQLLSLVVSQQKPKAYPLATAKRANTVSYGKVFKIGDAANLTDPLTG
FT                   EGIANAILSGLYVTQAINMSTSPELASENWQRLYQLYFEPDLDAGLQIKSFRKFSFINK
FT                   LLIWLMNRNKPFAEQVTYTFAGLIPYKKLLP"
FT   gene            complement(303493..304497)
FT                   /locus_tag="Npun_R0239"
FT   CDS_pept        complement(303493..304497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0239"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: O-methyltransferase, family 2;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   sus:Acid_2381 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79025"
FT                   /db_xref="GOA:B2J4Q3"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q3"
FT                   /protein_id="ACC79025.1"
FT                   /translation="MSTPSPALFFNTVNAYQRSAAIKAAVELNVFTAISQGIESSQSLA
FT                   QKCQTSERGMRMLCDYLVIIGFMTKQAEGYRLTSDSAMFLDRQSKFYVGDAIEFLLSPM
FT                   ITNGFNDLTAAVLKGGTAISSEGTLSPEHPVWVQFAKAMSPMMANPAQLIAQLVNENKI
FT                   EPLKVLDISASHGLFGIAVAQHNPNAEIFGVDWASVLEVAKENARIQGVASRYHTIAGS
FT                   AFEVDYGNDYDLVLLPNFLHHFDVATCEQLLRKIKTALAVEGKVIVFDFIPNSDRITPP
FT                   DAAAFSLVMLATTPNGDAYTFAEYESMFSNAGFSHSQLHSLPTTQQQVIVAYK"
FT   gene            complement(304749..305246)
FT                   /locus_tag="Npun_R0240"
FT   CDS_pept        complement(304749..305246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0240"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ana:all7116 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79026"
FT                   /db_xref="GOA:B2J4Q4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q4"
FT                   /protein_id="ACC79026.1"
FT                   /translation="MCLNDVLIDRASLSDVTGIIKLAQANDAEHGGMLLGHLEPEAVMM
FT                   TISQMPSVVARKNGQVIGFLLSWSKTTANLPIIKVMLQAYAGKKDAYLYGPICVDETMR
FT                   GQGIAAVMFAKLKDFLPEREGILFIKANNKASLQAHQKMGMCKMTEFIYEGTKFLVFAY
FT                   NS"
FT   gene            complement(305700..306758)
FT                   /locus_tag="Npun_R0241"
FT   CDS_pept        complement(305700..306758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0241"
FT                   /product="conserved hypothetical protein; putative signal
FT                   peptide"
FT                   /note="KEGG: fal:FRAAL5039 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79027"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q5"
FT                   /protein_id="ACC79027.1"
FT                   /translation="MKCKAISSFVLTKLFFACGISLLSAKLVAAAVTYSVWPSSTTVVT
FT                   ADGSNQFGGNLSGLFYDPAAGTQPSVLWAVQNSPSKLYNMVWNGSTFVKNTANNWSSGK
FT                   TLRYPNGTGAPDAEGVTKAEFSSTTIYVSTERDGSGSNRFSVLSYDSSSSATTLNATKE
FT                   WNLTSNLPTVSSTNLGLEAIAWVPDSYLQANGFIDESTNQLYNPANYPLHGTGLFFVGL
FT                   EANGQIYAYALNSDSTYTRIATIASGNTKIMDLSFDRDNETLWAYCDNNCSNRSTLLAI
FT                   DTTVGSSTKGKFIIRKGYERPSSMSNINNEGIAIAPNSECASNLKQFFWADDSETSGHA
FT                   IRRGTIPCGRLF"
FT   gene            307514..308026
FT                   /locus_tag="Npun_F0242"
FT   CDS_pept        307514..308026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0242"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ava:Ava_4568 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79028"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q6"
FT                   /protein_id="ACC79028.1"
FT                   /translation="MFHKILVAINNTEIGQQVFQEALSLATANNAELLLLHVISPVDDE
FT                   ELNFPSPQADSIYGSFHTHGVEYYVRQWEALKKHRIEFLTLLTNQAIAQNINARFIQEI
FT                   GTPSRLICEIAQTWKADLIIIGRRGLTGINELLLGSVSNYVLHHASCSVLTVQGKTPVT
FT                   QKTSQAA"
FT   gene            complement(308166..308591)
FT                   /locus_tag="Npun_R0243"
FT   CDS_pept        complement(308166..308591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79029"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q7"
FT                   /protein_id="ACC79029.1"
FT                   /translation="MNRIGLALAVLVTISPLTLALARSVQAVDVQIKQAQANQPEQSVQ
FT                   RTFLNLISAIEENNYTKFISQGNDAFKEAITKQIFTQVNGQLSPRLKKGYSAVFLGKLN
FT                   QQGYQVYLWKLSFKDGNDDVLARLSLKDGKVGGFWLN"
FT   gene            complement(308762..309826)
FT                   /locus_tag="Npun_R0244"
FT   CDS_pept        complement(308762..309826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0244"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: pfo:Pfl_1057 two component CheB
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79030"
FT                   /db_xref="GOA:B2J4Q8"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J4Q8"
FT                   /protein_id="ACC79030.1"
FT                   /translation="MRIAIVNDTAMAVEALKRVLLTVPGHEISWIARDGTEAVARCARD
FT                   TPDLILMDLFMPVMDGVEATRQIMKQSPCAIIIVTASVSKNAGKVFEAMGYGARDAVNV
FT                   PILGTQESSDSAQLLLTKIATIAKLIGKSSPTSTPKPQTAKLTSFSTHSTLLPPLVAIG
FT                   SSTGGPKALAAILSRLPANFGAAIAIVQHVDMQFSAGLVDWLNQQTALTVQLATVGDRF
FT                   EKGIVLVAGTNDHLSLHSDLTLHYTKEPIDYPYRPSVDVFFKSLAQYWNAKGTAVLLTG
FT                   MGQDGAQGLSLLRSRGWHTIAQDEKSSVVYGMPKAAVQLNAAVEILPPEAIATSLIQQI
FT                   MFRKSGVPKSDTRK"
FT   gene            complement(310079..312322)
FT                   /locus_tag="Npun_R0245"
FT   CDS_pept        complement(310079..312322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0245"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region, ATPase domain protein; Hpt
FT                   domain protein; KEGG: mlo:mll9511 chemotaxis histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79031"
FT                   /db_xref="GOA:B2J4Q9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4Q9"
FT                   /protein_id="ACC79031.1"
FT                   /translation="MTMSDDSMLELFRQEVETQVAILSQSLLILEAKSQSDEALEALMR
FT                   AAHSIKGAARIISLDVIINLAHWMEDCFVAAQNQIITLGSDQIDVLLQSVDLLQALSQV
FT                   AGGELVAWLAEKVGEFESSCLAIAALLPSDFSERRLSSLVTVDRNSALSQSVRQENVTF
FT                   EAIATPTDRVVRVTAENLNRIMGLAGESLVEANWLQPFADSFTALKSRQSELSRLLETI
FT                   HTTLANTPTSSESLQVLDTARRKAQECREILGDRLGELELYARRTTNLSDRLYREVIAS
FT                   HMRPFADGVQGFPRMLRDLCRRLNKQVKLEIVGQSTPVDRDILKKLEAPLTHMIRNAID
FT                   HGIEPLDERELAGKPIEGTVRLEAFHRGGMLAISVSDDGRGIDPDFIRQHIVECNLASP
FT                   ETAAQLTEAEIIEFLFLPGFSTTKQVTEISGRGVGLDIVKSMVQEVGGTIRATSQFRKG
FT                   TSFYFQLPLTLSVVRTLIVEISAEPYAFPLARVDQIVKLNKSDIYVVEGRQYFTKDGRN
FT                   IGLIAASHILDLPETPSATDALCVVVISDQSNAYGLLVDQFLGERDLVVRPLDPRLGKV
FT                   RDISASALMDDGSPVLIVDVSDLVRSIDNMLNSGQLRPVDVNKAKKVSSRKRLLVVDDS
FT                   ITVREMTRKLLQNRGYDVDVAVNGMDAWTAIRSNSYDLILSDIDMPRMNGIELVKQIKE
FT                   HPTLHSLPVIIVSYRDREDDRIQGMEAGADYYITKSSFHDDTLVNAIVDLIGQ"
FT   gene            complement(312403..313146)
FT                   /locus_tag="Npun_R0246"
FT   CDS_pept        complement(312403..313146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0246"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mlo:mll9513 CheW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79032"
FT                   /db_xref="GOA:B2J4R0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R0"
FT                   /protein_id="ACC79032.1"
FT                   /translation="MESYLNTVGVGDDSEFDHPTLNDCWNQIGVMGDRTCGELKTVIHC
FT                   RNCKVYSAAGRSLLERNAPPEYLQEWTDILSEASTQQVGVGEGTLVRATDTLSVIIFRL
FT                   GNERLALPVNILQEVTPPYAIHTVPHRSNSVFLGLINIRGETLLCISLRDLLGLEPVVE
FT                   STDFSNTINPQRMIVAGRNENKWVFPVDEVHGTYRFHINEFKDAPVVISKASEAYTKGI
FT                   VTWQDKKLNFLNSELLFYTLNHKVF"
FT   gene            complement(313379..315085)
FT                   /locus_tag="Npun_R0247"
FT   CDS_pept        complement(313379..315085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0247"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pau:PA14_16430
FT                   putative methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79033"
FT                   /db_xref="GOA:B2J4R1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R1"
FT                   /protein_id="ACC79033.1"
FT                   /translation="MFKNQSMQARLIFAFIFMGILVLIVALVGLSGSSRLSKHIDTLAN
FT                   NSVPSISGLWKINAGQTQIESSERGLLDVNLSKDGRQTEIDRMDNAWKQIQEGFQQYEA
FT                   TPKLNAEKQAYKDFLNKWDAWKDAHEEFLRRNLRFESLGVFNLFENTAGNANLAIAAHK
FT                   ELEKQVEANRQPFTAATVAFLEVLKMNEDLAAETEHVSAKDVSQVGFWAFVAILIGPGT
FT                   AILFGIFFSNTIARPLGAKIAGVVDIAQKISAGDLTSEISLADQQDEVGQLQNAFYTMN
FT                   KDLNALVNRIQQSGNQITNSADQITASGRNLEATVTEQVASTNEVTATAHQIAATSREL
FT                   VKTMEYVAAMAEQTTVAAGNSKDNLNHIDSVMHQLLAATQVISSKLEVMHVRANNISRV
FT                   VTTITVVADQTNLLSLNAALEAERAGEYGAGFAVVAREIRRLADQTAVATLEIEQMIKE
FT                   MQSAVSIGVTEMDKFTKSVVHSVEDVDRISEQIAQVIQQVQGLTPRFEQVSQSVDEQSQ
FT                   GAQQISEAMEHLSQASQQTAGSLRETNHALEQLDEATHSLKREIARFKVMA"
FT   gene            complement(315101..316381)
FT                   /locus_tag="Npun_R0248"
FT   CDS_pept        complement(315101..316381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0248"
FT                   /product="MCP methyltransferase, CheR-type with Tpr
FT                   repeats"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase, CheR-type; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   pae:PA3706 probable protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79034"
FT                   /db_xref="GOA:B2J4R2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R2"
FT                   /protein_id="ACC79034.1"
FT                   /translation="MVLSAIATLLNQAIGLDPDTLGSNRIARAVENRRLGCKLPDMESY
FT                   WVRLQTSTLELEELIELLIVPETWFFRDGKPFDYLKTYVTDQWRLLPNRNILQLLSVPC
FT                   STGEEPYSMAIALLEAGLHPKQFAIDAIDISHRSLAKAKRGVYTKNSFRGDAWTERERY
FT                   FQQTAEGYELCQSVRELVNFQQGNVMTSLALTQKQYDIIFCRNLLIYLQSEACSQVLAA
FT                   IDRLLRPGGLLFVGASETAKIVADQYTSTRKPFTFAYRKSEPPLPKLELLNITQFQSAT
FT                   LQNPVKQSLGVKNYSAIDTQQIKESNISASSNRSSSESTPSVDLQTVKKLADEGRSPEA
FT                   ITLCKSYLIHHPTSAAAYLILGALYQADQQNHQAEQCFQRAIYLEPTSYQALVHLALLK
FT                   EHQGDTVGAKIIQQRIQRLQSSLRTEA"
FT   gene            complement(316390..317985)
FT                   /locus_tag="Npun_R0249"
FT   CDS_pept        complement(316390..317985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0249"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: pau:PA14_16430
FT                   putative methyl-accepting chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79035"
FT                   /db_xref="GOA:B2J4R3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R3"
FT                   /protein_id="ACC79035.1"
FT                   /translation="MNKIINRLILGFSIPILFLIVLGAILYSSTAHLIKLQEHSKQIAE
FT                   NIRDTDEFAYDVSRIIASIRGYALYPKDQYYRGTYDKAKESMLQNKQDLANTVDPQAQE
FT                   AINEMIEIGNDYDRVAAGVYPLVDANKLDEAKQEILIPRVAKLEVARTRTLKILENRLN
FT                   ENLQQGDQAKNLATLIIILGTLLTLLTTVAVALWVALPIRRQLPKVVQAAEQIADGDLQ
FT                   QTIEPSNDGSEIGQLLTAFHYMSKNLNSLIFQMQQSGVQISTSATQIAAAGKELEATVA
FT                   EQLASTNEVSATSQQIAATSKGLVKVMDQVALMAQSTATSAGASQNDLNRMETVMRHLS
FT                   DATTSIATKLGVMNEKANNINSVVTTINKVADQTNLLSLNAAIEAEKAGEYGAGFAVVA
FT                   REIRRLADQTAVATLEIAQMIKEMQSAVSTGVMEMDKFNKSVVDSVADVSKISDQIAQV
FT                   IHQVQGLTPRFEQVSQSVEEQSQGAQQISEAMGQLSQASQQTVEALRETNSAVGQLDGA
FT                   ANGLRLEIARFKTA"
FT   gene            complement(318014..318592)
FT                   /locus_tag="Npun_R0250"
FT   CDS_pept        complement(318014..318592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0250"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: psp:PSPPH_3880 CheW
FT                   domain protein WspB"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79036"
FT                   /db_xref="GOA:B2J4R4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R4"
FT                   /protein_id="ACC79036.1"
FT                   /translation="MFYWPEQALKALKLKLRRRCSAKRCLFFVFVLFNENLSLKVLILL
FT                   FYAGKDLYAIESSHIVEIIPRVSLRKVHHVPEYVPGLFNYRGTILPAIDLCHLIQGTPS
FT                   RSHLSTRIIIVKHPHQNESLQYLGLMAERVTETLTISDSKIRDSSIRAEEAPYLSGTIV
FT                   DEQRIIQCVQLERLFSDERHTYLLMGEEV"
FT   gene            complement(318555..318962)
FT                   /locus_tag="Npun_R0251"
FT   CDS_pept        complement(318555..318962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0251"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: ana:alr3340 integral membrane protein
FT                   possibly involved in chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79037"
FT                   /db_xref="GOA:B2J4R5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R5"
FT                   /protein_id="ACC79037.1"
FT                   /translation="MNLLTGRYPLAVAIGAIFGALSRFYGTELAKAIFGKDFGFYGTFT
FT                   INVTGCLIIAYILTLATENLRIISPELRLMTTTGFCGAYTTFSTYGLESKGFLDKGDIT
FT                   TLLIYFVGSAIAGMIGIQIGVLLARASAQSS"
FT   gene            complement(319057..319446)
FT                   /locus_tag="Npun_R0252"
FT   CDS_pept        complement(319057..319446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0252"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: ava:Ava_3649 camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79038"
FT                   /db_xref="GOA:B2J4R6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R6"
FT                   /protein_id="ACC79038.1"
FT                   /translation="MSDLTNILSIATGAVPGALSRFYITEWTKAKLGAKFPYATFAINL
FT                   TGCLAMGFFFTISKGITGYPKELDLLIRTGFLGSYTTFSTYGFDTLTLWRSKQKTATVF
FT                   YWAGSAILGLGAVILGAAIAKLFVK"
FT   gene            complement(319779..320840)
FT                   /locus_tag="Npun_R0253"
FT   CDS_pept        complement(319779..320840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79039"
FT                   /db_xref="GOA:B2J4R7"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R7"
FT                   /protein_id="ACC79039.1"
FT                   /translation="MREDVYKLHHPAIRAVIKRVHLIGGLLLAAFSCWLFQTLPCQAEA
FT                   VTSPKTCQIGVYLTSLRDFNPAEKSFSANFWVWSLCPFETPKPLESLKVINSKEVSTNY
FT                   NSFSRSENLSDTFKASKYVFVSEQEIKATFYHNWDTKNYPFDRHKLEIPLEEAKLDASS
FT                   FVHVPDFASSDYQQDIDLEDWEITNFKIFQVNFPYKTHFGSPGIKGQPSYRSRLVVSIT
FT                   INRKSKVSFFKLSIGVYAAVALSILALLLDEDFGDRMGIFVGTLFAVLVNMQTATSDLG
FT                   SSNSVTLIDFIHIIAIIYIFITAILLVYTRFLSESEKEQSSRYLMRRIAVPILSGSFVV
FT                   LNIVVIAHAAIVG"
FT   gene            complement(320907..321581)
FT                   /locus_tag="Npun_R0254"
FT   CDS_pept        complement(320907..321581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79040"
FT                   /db_xref="GOA:B2J4R8"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R8"
FT                   /protein_id="ACC79040.1"
FT                   /translation="MNQNWDVQNYPFDRHTLKISLEEAIQDASGFVYTPDFKNSGYQRD
FT                   MKLGGWKITNFTLEEEKVAYQTTFGDPELVDQKGVYSRLIVSIPIQRVKYMSFFKLTTG
FT                   VYVAFAVAMLSFFYETGQPSLVSARTSLLVGCLFSALVNMRAPESVLGRTESLTLVDQI
FT                   HIVAIVYIFAAALATVSSRLTTEAGQAKQAMWLDRRLLFRAFTISFIVRNAIVISHAAI
FT                   AG"
FT   gene            complement(322048..323139)
FT                   /locus_tag="Npun_R0255"
FT   CDS_pept        complement(322048..323139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79041"
FT                   /db_xref="GOA:B2J4R9"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4R9"
FT                   /protein_id="ACC79041.1"
FT                   /translation="MLLKPISNHFMLVKFLSILLKSCRVFISLTLIIIVWLFVEVSEVS
FT                   AETVLSPQTCRTGVYVASLRDLNLAEKKFSTDFYLWSVCPFKDLQPLKSMKFLNVEDYK
FT                   YFKAAYDSTLQRKDLPKWFYPKENVYWSGRKIRATLYQSWNVSNFPFDRHTLTIALEET
FT                   TKNSSQFVYTPDFDNSGYQRNMDLDSWQITSFKIVEQKVPYETTFGDPDLVSPQDSYSR
FT                   LVISIGIKRVKFFSFLKLTIGVYIAFAVAMLSFFYDSDQTSLASPRRAIYIGALFATLL
FT                   NMRVQESVLGRTEDLTLVDQIHIATILYVFGTGVVSVYSRLTSESGKKKQAIWLDRRVF
FT                   FRLFTLSFIVFNVIAIAHAIIVG"
FT   gene            323606..323881
FT                   /pseudo
FT                   /locus_tag="Npun_F0256"
FT   gene            complement(324750..325601)
FT                   /locus_tag="Npun_R0257"
FT   CDS_pept        complement(324750..325601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0257"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: lca:LSEI_2107 predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79042"
FT                   /db_xref="GOA:B2J4S0"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S0"
FT                   /protein_id="ACC79042.1"
FT                   /translation="MLKILVTGATGNVGQEVLRLLQSHDCNVCAAVRNPNSAQHLLGSN
FT                   IQTIPFDFTNPDTFDYAFFQVNKLFLVRPPALANIRKQIAPALNAAKLAGVEHIVFLSI
FT                   LGAERNPFVPHSQIERYINQLGIKATFLRCSFFMQNLNTTHREDIKVRGELLLPAGNGK
FT                   TSFIDVRDIAAVAVRTLLEDEHQGRAYSLTGAEALTYYEVANIFTSILGKPIRYNPSLL
FT                   KFIRQMRLSGLPIDFILVMLVIYTTARLGLAGNITSDTEQLLNRSPLTIRQYVEDYRQF
FT                   WL"
FT   gene            326020..327693
FT                   /locus_tag="Npun_F0258"
FT   CDS_pept        326020..327693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0258"
FT                   /product="alpha amylase, catalytic region"
FT                   /EC_number="2.4.1.18"
FT                   /note="PFAM: glycoside hydrolase, family 13 domain protein;
FT                   alpha amylase, catalytic region; alpha amylase, C-terminal
FT                   all-beta; SMART: alpha amylase, catalytic sub domain; KEGG:
FT                   ava:Ava_4479 glycoside hydrolase, family 13-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79043"
FT                   /db_xref="GOA:B2J4S1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S1"
FT                   /protein_id="ACC79043.1"
FT                   /translation="MANLTDFKLFAPRNKGAALIGSFSDWKEIPMSKSEDGYFRTKIKL
FT                   EDGVYQYKFRIQTKSPNFAPDEWIDVIDPKATEVNETEKYGIVRIQDGQRIVDSYFWQH
FT                   DEMPLPDNRELVIYEMHVADFTGDEVDSNERGKYLGIIAKLDYLCELGINAIELMPVNE
FT                   YPGDYSWGYKVRHFFATESSYGSTEDLKRLIDECHGRGIRVFMDGIYNHTDEECPLILI
FT                   DRNYWYYEHKHYPEDPANYWGPEFNYDFYDKNLNIQPAWEYIGDVVRFWIQEYHIDGIR
FT                   FDAVRQLANFEFLNWLTKQAKNHAAPKQFYNIAEHIPDTNTVVKPDGPLDACWHESFRY
FT                   FLVPYICGKSFELEQLKQILDPKQQGYAIATNVINYLATHDRERLLRELGNCGIFDAAA
FT                   FERAKLAAVLLMTAMGIPMLWMAEEFGEYQQKSEDVTKPQKITWSLLLDDQNYDLFEYY
FT                   QKLITLRQQTPALQSDNIKFFYENADDKVLAYSRWDEQNSHVVVVVNFSDRSLNQYKIS
FT                   DFPTTEDWRDWVGNREVKSGEDGLVTDLPSYTAKIFVLQT"
FT   gene            328034..329308
FT                   /locus_tag="Npun_F0259"
FT   CDS_pept        328034..329308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0259"
FT                   /product="CemA family protein"
FT                   /note="PFAM: CemA family protein; KEGG: ava:Ava_1182 proton
FT                   extrusion protein PcxA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79044"
FT                   /db_xref="GOA:B2J4S2"
FT                   /db_xref="InterPro:IPR004282"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S2"
FT                   /protein_id="ACC79044.1"
FT                   /translation="MKNSFTKTAGLLRQNLQKYLRSLNNWFFDTPERALLEAQQAAQRI
FT                   KNIEIEHFEGKKISSESVKYTETAMSYWQVYLDKNLTIIKFRLAEFQLSRGIVNISNSV
FT                   LLEKLKVIDEVVEKYAIKDELISNSELLSNNEPLKINQSEINKQPDSSNIKRLPPNQKT
FT                   RVLPGSIGRTINRIKGDFSPQGEEEFVRNYRISKNRTRIGLRFLLTLIIVPLLTQILSK
FT                   QFLVIPILETTRSEKTYQIFINSDMEKEALHEFSNFQQNLRFESLLNHAPELSSEVIRE
FT                   KIKDKAIEIAEEFHLKTNSSVSNVFADLISLISFSIIIAFSKKEIVIVKSFIDTIVYGL
FT                   SDSAKAFIIILFTDIFVGFHSPDGWEVLLEGFAEHLGLPASRNAIFLFIATFPVILNTI
FT                   FKYWIFRYLSRLSPSALATLKEMDE"
FT   gene            329364..329870
FT                   /locus_tag="Npun_F0260"
FT   CDS_pept        329364..329870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79045"
FT                   /db_xref="GOA:B2J4S3"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S3"
FT                   /protein_id="ACC79045.1"
FT                   /translation="MYILVLLKRTMDFESKANAPTSTDNIEFAQQTTSRKPLQLLRDTE
FT                   ALLRRPTVATLSPILPPKLSNKFQATSSLADDSFKELAEIDLDTISDFELRPVRIRVGL
FT                   SFVGFGALMILVLLLYLNTLHPELSTGEQIRQYWYQYVWFVSLGVAGMFMLGREAMRPM
FT                   PKRRK"
FT   gene            330146..331051
FT                   /locus_tag="Npun_F0261"
FT   CDS_pept        330146..331051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0261"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ana:all2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79046"
FT                   /db_xref="GOA:B2J4S4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S4"
FT                   /protein_id="ACC79046.1"
FT                   /translation="MNYDAFIVPPGSKISLKKNYDPAYKTDFDQKADAANKLQTDIERL
FT                   ANYQNILYAQNTYSLLIIFQAMDAAGKDSTIKHVTSGVNPQGFQVFSFKAPSAEELDHD
FT                   YLWRTMKALPERGRIGIFNRSYYEETLVVRVHPEMLRKQQLPYFPNGNKIWKQRFEEIN
FT                   NFEKYLVDNGVIVLKFFLNVSKSEQKKRFLERIEYPEKNWKFSDSDVKERAFWDDYMNA
FT                   YEEVFNKTSTKSAPWYIIPADRKWFTRLVVANIICTKLEELNLQYPIVSDEHRQQLLEA
FT                   KRILEQEDEQTSLTDKGKKK"
FT   gene            331162..331788
FT                   /locus_tag="Npun_F0262"
FT   CDS_pept        331162..331788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0262"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; KEGG: lbl:LBL_1298
FT                   chemotaxis protein, methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79047"
FT                   /db_xref="GOA:B2J4S5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S5"
FT                   /protein_id="ACC79047.1"
FT                   /translation="MIQMAEDAKNNPPHFTNAGFDIVAIAASAGGLTAQIKVLSTLPAE
FT                   FPAAIAIVQHISPEHPSFMAEILSRRTDITVKQAQEGDDLSPGTAYIAPPNRHLLVNDD
FT                   GTLSLSQSKLVHFLRPSADLLFESVAATYKERAIAIVLTGTGSDGAMGVEAIKKMGGTV
FT                   IVQDLKTAEFSGMPSAAIQTGNVDFILPLDEISRVLVSLVMGKCN"
FT   gene            331923..333818
FT                   /locus_tag="Npun_F0263"
FT   CDS_pept        331923..333818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0263"
FT                   /product="MCP methyltransferase, CheR-type with PAS/PAC
FT                   sensor"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: mpa:MAP3233c hypothetical protein; TIGRFAM:
FT                   PAS sensor protein; PFAM: MCP methyltransferase, CheR-type;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79048"
FT                   /db_xref="GOA:B2J4S6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S6"
FT                   /protein_id="ACC79048.1"
FT                   /translation="MTSADRDPKFENLLIYLRQSRGFDFTGYKRSTLMRRVCKRMQSLT
FT                   IENFEEYLDYLEVYPEEFNYLFNTILINVTAFFRDSSAWEYLAEKILPNLISNKKTSDQ
FT                   IRIWSAGCASGEEAYTLAMLMAEILGAEEFRQRVKIYATDVDEEALNQARQATYSAKDV
FT                   QAVSDELRQKYFEIVGNRYVFRQDLRRSVIFGRHDLLQDAPISRLDLLVSRNTLMYFNS
FT                   ETQGRILARFHFALNDNGYLFLGKAEMLLMHSSLFTPIDLKNRIFSKVSSVSIRDRLLV
FT                   MANTVDDESSSRVSRHLRLRDMGFDTSPIAQIVIDINGTLVMVNEQARTLFALSPKDLA
FT                   RPFQDLELSYRPIELRSLIERAYTERRPITLTNVERYLSNTETQYLDVRITPLQETDTS
FT                   FLGVSISFHNVTRYIKLQDALQRSQQELETTNEELQSTNEELETTNEELQSTNEELETT
FT                   NEELQSTNEELETMNEELQSTNEELQTINNELSQRTTELNHANIFLISILRSLQTGIVV
FT                   IDGSFNISIWNYMVEDLWGLRTDEVLGKSIFSLDIGLPVEQLRSPIRDSLSGKKQFQEM
FT                   IFDATNRRGRQIKCYLAITPLLGMDIQGAVLMMADVERVHSMISSQDMEERRQQE"
FT   gene            complement(333982..335064)
FT                   /locus_tag="Npun_R0264"
FT   CDS_pept        complement(333982..335064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ter:Tery_3205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79049"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S7"
FT                   /protein_id="ACC79049.1"
FT                   /translation="MNNIPKYTAEFEQFINAKNHNFIGREFVFSAIKNFINQYDRGYFT
FT                   IIGDPGIGKSAIIAHYVSQNSGIVYYNVEIAGKNHVEEFFTSICTQLIEIAKNQGSTNI
FT                   IANFPDFTTEGSGFLSLLLQKISDRLHPDQRLIITIDGCDRIDINNQPRGSNIFYLPRY
FT                   LPEKVYFILARRPFLTDKSGLLIETPAQYLDLSNYQEKNRADIQEYIKNHLNKLSHSER
FT                   RFSEDKNTKDVSLKLAEKGFDDGETNFMYVSEILAAINEDIYPENLQIYYQTHLDKINL
FT                   VTSKQQRMGLLVLNILVQEQSTSIEAIAERLDIDEYEIKVILDEWREFLHLDSIATEIY
FT                   YSLYHASFCDWLSQKIESKF"
FT   gene            complement(335068..336813)
FT                   /locus_tag="Npun_R0265"
FT   CDS_pept        complement(335068..336813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0265"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ter:Tery_3206
FT                   WD-40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79050"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S8"
FT                   /protein_id="ACC79050.1"
FT                   /translation="MGGIAAKLASKSAEFQNLFLGQFPEQQLKVGNSKKYYETLTDFDF
FT                   ISLKIQYPQFGVETLIRDYYLIDDPEILDRLEEDERVDYGQVKTLKLIERTLQLSAHIL
FT                   NQDPNQLVGQLWGRLQSFPEPEIQKILVDAVQSKSENPRFYPITATLTTPGGNLLRTLT
FT                   GHKASVNVVAITSDGQTAVSTSDDNTLKVWDLQTGKETFTLSGHQASVNAVAITPDGQT
FT                   IISVSNNLKLWSLKTGKEISTLTGHNNSINSVAITPDGQTAVSASSDNTLKLWTLKLWT
FT                   LKLWNVETRRETFTLRGHRGLVNAVAITPDGKKAVSVSNNLKLWNLKTGWQISTLTGHK
FT                   DSINAVAITPDGQKAVSASSDTNLKLWDLETGKAISTLRGHTDSVNAVAIIPDRQTAVS
FT                   GSADTTLKLWDLQTGNVISTLSGHKDSVTAVAITPDGKKAVSGSADTTLKLWDLQTGKA
FT                   ISTLSGHKDSVTAVAITPDGKKAVSGSADTTLKLWDLQTEKAISTLSGHKDSVTAVAIT
FT                   PDGQKAVSSSTDTTLKLWDLETGKVISTFTGESSIYCCTVSPDGLTFLIGEHSGRVHFL
FT                   HLEGG"
FT   gene            complement(336815..338380)
FT                   /locus_tag="Npun_R0266"
FT   CDS_pept        complement(336815..338380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ter:Tery_3205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79051"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4S9"
FT                   /protein_id="ACC79051.1"
FT                   /translation="MIEFAAITSVISKYAPQASQLIIKQAQKNEAVINILHELKLNPTQ
FT                   ISDDIDTVYIYALIRYGVFKHEAILNLFREKEIKGCFWDAYSSNTPFKFVENAKKLLNQ
FT                   NSELKMQLINAKINFLAEIEEFGEAFIAVAKQTKSSKYQPYPDWNLDVYSKEFKALIFE
FT                   KTRLFCGRDFVFKAIQKFFTTQAKGYFSIVGDAGMGKSAIAAKYVLAYKFPCYFNIFAE
FT                   GRNKPEKFLASIRQQLIKRYSLQNADNTDLRTLLQKASEELKGQKLVIVVDALDEVEQE
FT                   GNGNLLDLPQNLPNGVYFLLTRRLYNQETKRLTLSPDTPVYELDLTQGDYTALSQEDVK
FT                   EYIELYLNNDSDLKNWINERHISEDSFTQEIAVKSENNFIYLRYLLPGISEGKYNDLNL
FT                   KGLPQGLQDYYTTHWNRMGMDKESNEKKVKILYILVERGEPISINMITEILDEEEYEVK
FT                   SVLNEWVEYVTPKVNVDEHKTYYSIYHRSFLEFLKSQDKLGKGRKLFREVNKSMANYML
FT                   KEMA"
FT   gene            338693..339289
FT                   /locus_tag="Npun_F0267"
FT   CDS_pept        338693..339289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0267"
FT                   /product="tRNA--hydroxylase"
FT                   /note="PFAM: tRNA--hydroxylase; KEGG: ava:Ava_0979
FT                   tRNA--hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79052"
FT                   /db_xref="GOA:B2J4T0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T0"
FT                   /protein_id="ACC79052.1"
FT                   /translation="MLTQLPTINVLKQPTSSAWVEQAIANLDIILLDHSHCERKAAGVA
FT                   LNMMFRYPSNTKMVRELTAIAREELEHFELVNQWLERRNISLAPLPPPPYGAGLKAQVR
FT                   PKEPERFLDSLLVTGLIEARSHERLGLLAAHCPEPELAKFYRGLMASEARHYGIYWVLA
FT                   ATYFDREIVMQRLDELAIVESELLATLHPEPRIHS"
FT   gene            339308..339712
FT                   /locus_tag="Npun_F0268"
FT   CDS_pept        339308..339712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0268"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ava:Ava_0978
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79053"
FT                   /db_xref="GOA:B2J4T1"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T1"
FT                   /protein_id="ACC79053.1"
FT                   /translation="MKLQLTHLRLLVSNYKDSFLFYRDLLKFDVDWGDEESGYAELNTG
FT                   YLKLGLFKKELMAEVVPRIEQPSYIVNRDKTVLIFAVDNLDEVYEQVKNHNAIVVTEPQ
FT                   DRPDWGIRTAHFRDPDGNLIEIYSNLGIVS"
FT   gene            complement(339965..341476)
FT                   /locus_tag="Npun_R0269"
FT   CDS_pept        complement(339965..341476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0269"
FT                   /product="CHU large protein"
FT                   /note="KEGG: chu:CHU_3119 CHU large protein; possible
FT                   phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79054"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T2"
FT                   /protein_id="ACC79054.1"
FT                   /translation="MFKSRLRITSLPIKNLVCLAGGFVLASVGSIAIANTITSPSSSQS
FT                   PYIVRSVPGVVTKAILTVGDSVNNKPDGTPYRMVGIPDGLGAFDNGDGTFTLLMNHELG
FT                   NTSGIVRAHGAKGAFVSQWTIHKDDLTVVSGEDLIKRVFTWNTITQQSNNSASIIAFNR
FT                   FCSGDLPSPTAFYNPATGLGSQERIFMHGEEGGATGYQLATIATGSNKGSTYVLGKFNL
FT                   STNGSGLTGVGAWENALANPFPQDKTIVIGNNDGGLNIMNGALAVYVGTKTNIGSEIDK
FT                   AGLTNGTLKFVNVVGNAVEITNTTTRATNITNGTRFTLNSTASTTFSRPEDGAWDPLNP
FT                   NQYYFVTTDRFDQVSAGTGTQIGRSRLWRLTFDDITDPNKGGTIELLLDGTEGQQMMDN
FT                   LTINKRGQIFIQEDPGNQGYVAKLWRYDIARDQFTQIAQHDLNRFAPGAPAFLTQDEES
FT                   SGIIDASDILGEGWFLLDVQAHYPISGELVEGGQLLALHFPPGKK"
FT   gene            342156..342734
FT                   /locus_tag="Npun_F0270"
FT   CDS_pept        342156..342734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0270"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ava:Ava_0977 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79055"
FT                   /db_xref="GOA:B2J4T3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T3"
FT                   /protein_id="ACC79055.1"
FT                   /translation="MDSARIAICWVNWDIEPENFLCKLDQQMVMKNYYQDFLIRDWVQS
FT                   DRTRAAEVISYVLSEYGLGWEPKGADRDVLRVEECYLATGGEFWVIEHQSQLVGTGAYY
FT                   PIQRGEKAVEIRKMYLLPSIRGLGLGKYLLQQLEAAIAERGFEQIWIETASVLVEAVKL
FT                   YESNGYTPATGVETIRCDRVYFKSLVNGH"
FT   gene            342807..343484
FT                   /locus_tag="Npun_F0271"
FT   CDS_pept        342807..343484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79056"
FT                   /db_xref="GOA:B2J4T4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T4"
FT                   /protein_id="ACC79056.1"
FT                   /translation="MHTWIKNLTGLLNLFLQSHCPLCQRATSQEFCHNCTRQLQKCQRK
FT                   NPMSLWKEPIPVFGWGEYGGPVKRAIAVMKYENQPQIARPLGQWLGEAWLLNSPKRDSQ
FT                   PVVVPIPLHPSKQKQRKYNQAALIAQSFCEITGLKLKLNGLARVRETEAQFGLSVSKRE
FT                   KNLAQAFAVGQEFRDRPPNVPVLLVDDIYTTGATARSAVQTLRHYGIVVLGLVAVATAV
FT                   KDG"
FT   gene            343571..344026
FT                   /locus_tag="Npun_F0272"
FT   CDS_pept        343571..344026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0272"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: ava:Ava_0975
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79057"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T5"
FT                   /protein_id="ACC79057.1"
FT                   /translation="MNKVFAAGLKQLIIIPATLLAIGVSTSAAFAQNKLYSPIPLSNST
FT                   ELSDSLSDKDIPTGQGGFARDYTVKLQKGDNLAVDLSSENFDSIITLLAPDGSTLAEND
FT                   DGPDGSSNSLLFTRIVETGNYVIRVRSFGETGVGAFKLKVTKLQPIK"
FT   gene            complement(344128..344901)
FT                   /locus_tag="Npun_R0273"
FT   CDS_pept        complement(344128..344901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0273"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: ana:alr0379
FT                   hypothetical cobalamin (5'-phosphate) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79058"
FT                   /db_xref="GOA:B2J4T6"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T6"
FT                   /protein_id="ACC79058.1"
FT                   /translation="MTKQQQWWKRLLLKLAASIIFYTSIPLPYLNGLDFQGVARLASHV
FT                   GLIIGGILGLLDTGIDYLGMPVLTRSALVVSIWIGITGGLHLDGAMDTADGLAVGDPKR
FT                   RLEVMVDSATGAFGAMTAIALVLLKITALTDLPENRCLLLMAACGWGRWGQQLAIARYP
FT                   YLKPTGKGAFHKQAIRSYKDLLPGLLLLLSLSGLLVLIDKQQLFLALAMIIAGSAIATL
FT                   TGAWFNHKLGGHTGDTYGAVVEWTEALFLCVLTVF"
FT   gene            345280..345732
FT                   /locus_tag="Npun_F0274"
FT   CDS_pept        345280..345732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79059"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T7"
FT                   /protein_id="ACC79059.1"
FT                   /translation="MSHHLPDTRIPAPCIINTGIIVNKLDIRRLLADLGRVHYIYTQED
FT                   KVLSEGEGDVMEVFANPQRSTLVANHALYLNVCSFDYLELKQSSQQETYFDLMQEGVCL
FT                   RLIPRSTPIQERRERTFNVSAIEAMMEQVLSARWDAEIDDDCSDSF"
FT   gene            345863..347002
FT                   /locus_tag="Npun_F0275"
FT   CDS_pept        345863..347002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0275"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylases, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase; KEGG: ava:Ava_3755
FT                   queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79060"
FT                   /db_xref="GOA:B2J4T8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4T8"
FT                   /protein_id="ACC79060.1"
FT                   /translation="MSANFSFECLACCSQTKARAGVFFTPHGVVETPRFMPVGTLANVK
FT                   TITPAQLRDTGAQMILSNTYHLHLQPGEAIVAGGGGLHKFMGWNGPMLTDSGGFQVFSL
FT                   SEMRKITEEGVTFRSPHDGRIINLTPERSIEIQNTLGADVIMAFDECPPYPATRQEVET
FT                   ATERTYRWLERCITAHQRSEQALFGIVQGGVYLDLRCRAAETLAKLDLPGYAIGGVSVG
FT                   EPPELMAEIVKVTAPLLPPEKPRYLMGVGTYREMAIAIASGIDLFDCVIPTRWARHGTA
FT                   IVQGGRWNLKNAKFREDFTPLDETCPCYTCQNFSRAYVSHLVRSQEILAYTLLSIHNIT
FT                   ELIRFTQKIREAILSDRFTTEFGHWLNEESGDEEWRIEE"
FT   gene            347092..347229
FT                   /locus_tag="Npun_F0276"
FT   CDS_pept        347092..347229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0276"
FT                   /product="photosystem II protein PsbK"
FT                   /note="PFAM: photosystem II protein PsbK"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79061"
FT                   /db_xref="GOA:B2J4T9"
FT                   /db_xref="InterPro:IPR003687"
FT                   /db_xref="InterPro:IPR037270"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J4T9"
FT                   /protein_id="ACC79061.1"
FT                   /translation="MEAALLLAKLPEAYQIFDPLVDVLPVIPVFFLLLAFVWQAAVGFR
FT                   "
FT   gene            347416..347712
FT                   /locus_tag="Npun_F0277"
FT   CDS_pept        347416..347712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0277"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: ava:Ava_4487 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79062"
FT                   /db_xref="GOA:B2J4U0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U0"
FT                   /protein_id="ACC79062.1"
FT                   /translation="MGNIKFVKENKEVVAADGANLRLKAMQNDIDIYTFIGKMTNCGGN
FT                   GQCGTCIVEIVEGLENLSPRTDVENRKFKKKPENYRLACQTLVNGSVSVVTKP"
FT   gene            347830..347946
FT                   /locus_tag="Npun_F0278"
FT   CDS_pept        347830..347946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0278"
FT                   /product="photosystem II protein PsbM"
FT                   /note="PFAM: photosystem II protein PsbM; KEGG:
FT                   ava:Ava_4486a photosystem II reaction center protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79063"
FT                   /db_xref="GOA:B2J4U1"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J4U1"
FT                   /protein_id="ACC79063.1"
FT                   /translation="MQVNDLGFVASILFVLVPTVFLLILYIQTASRQGGKDS"
FT   gene            complement(348169..349020)
FT                   /locus_tag="Npun_R0279"
FT   CDS_pept        complement(348169..349020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0279"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ana:alr0882
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79064"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U2"
FT                   /protein_id="ACC79064.1"
FT                   /translation="MINKILLTVSGLGHAEEMLKTLREIPSIESAKVTILHVVQAQNTA
FT                   ATMTAKWENGGKILANAIQTLNLDPSQVSSILREGDPKDVVCQVADEIDADLIVMGSRG
FT                   LKRLQSILSNSVSQYVFQLSSRPMLLVKDDIYVKRIKRIMVAIDNSDSAKNCLKLALFL
FT                   LRDIQGGQLILANISTDLGGKKSEITEVNSDKNPVLAAAVAEAQKQGIQSRAYISSGKP
FT                   GEEICRLAEELNIDLLLLGSPDRRPSIAKSFVDIDRLIGSSLSDYVRVNATCPVLLART
FT                   IA"
FT   gene            complement(349554..351122)
FT                   /locus_tag="Npun_R0280"
FT   CDS_pept        complement(349554..351122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0280"
FT                   /product="Alkaline phosphatase"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: ana:alr4976
FT                   phosphodiesterase/alkaline phosphatase D"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79065"
FT                   /db_xref="GOA:B2J4U3"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U3"
FT                   /protein_id="ACC79065.1"
FT                   /translation="MELMDGGLLANRCRRRSFLLGAGFLTGLTIASQWHPVLASSRFSS
FT                   YPFNLGVASGDPLPDGVVIWTRLAPNPLSGGGMPVVNVPVRWQIALDENMKRVVRRGTV
FT                   LATPELAHSVHVDVRGLDPDRWYWYQFQAGREVSPIGRTRTAPAFYSYTQQLNFAFVSC
FT                   QDWQNGYYTAYRHLAEENLDLVVHLGDYIYEYGPQSGGPRQHNSPEIITLADYRDRYAL
FT                   YRTDQSLQAAHAAFPWIVTWDDHEVDNNYANLIPEDNQSEETFRKRRASAYQAYYEHMP
FT                   LRQSSLPKGPDALLYRRLTFGNLAEFNVLDTRQYRTNQPCNDGLKPRCPEAFDPNATMT
FT                   GSEQEQWLRKGLDQSRSRWNVIAQQTMLGQYNFNSSPGSGVFNVDQWDGYVAARNRLLS
FT                   FLNQRQPSNPVVITGDIHSSWVHDLKLDFNNPNSATVGTEFVGTSITSDFPTAFIAPVQ
FT                   AALPNNPHTKFFDGAYRGYVRCNLTPQRWQTDYRVVSSIVDLNASVKTLASFVVQNGQP
FT                   GAQLS"
FT   gene            complement(351383..352648)
FT                   /locus_tag="Npun_R0281"
FT   CDS_pept        complement(351383..352648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0281"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: ava:Ava_1702 gamma-glutamyl phosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79066"
FT                   /db_xref="GOA:B2J4U4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U4"
FT                   /protein_id="ACC79066.1"
FT                   /translation="MSVEVLDDHPEPITSAQRAYQASLKLGITKGADRSRAVLAMAQAL
FT                   ERSFDDILEANTLDLEASREMAVPELILDWLKLTPTRLEMTVDVLQRLGELSDPLRRVR
FT                   TADYQLEDSQSYTQLMPLGVIGFIYEAFPDLGAIAAGFCIKTGNSIILKGSTEASHSNA
FT                   AIAEALQNAIAEVGLPLGCVELITAEHGASIRDLVTQDQYVNLVIPYGRSSLVQQVVRQ
FT                   STCPVLKSAMGNCYLYWSLNSSLEMVRWMILDSHQSEPDQVNAIEKVLIHRQALPSSLA
FT                   VLWNSLMEKGFEIRGDAELVQAFPQLQLVKEGEWGNPYLTKTVAFKLVDSLESAIAWIN
FT                   EHSSGHADSIVTESYQESRQFALGVNSASTYINTSPRFSRNPSRGDSVFLGMSNQKGHR
FT                   RGFISLETLTTVKHIVQGNGRF"
FT   gene            complement(352653..353126)
FT                   /locus_tag="Npun_R0282"
FT   CDS_pept        complement(352653..353126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79067"
FT                   /db_xref="GOA:B2J4U5"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U5"
FT                   /protein_id="ACC79067.1"
FT                   /translation="MHLPKDYIVVVRVKHAQVTRTLVQSQKPEKIDFNAEYPCPCRRRG
FT                   QLIPITLTEAFGCDRCQQIFVVEDNGHVLEQLSTTYPYKRAWRWMGNSWHVVHPRLGES
FT                   YLPIALGIIFVLVIIWLPLALRLANGSSIIAWAMVAVLLAILPALMVWLTYRR"
FT   gene            complement(353751..353822)
FT                   /locus_tag="Npun_r002"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(353751..353822)
FT                   /locus_tag="Npun_r002"
FT                   /product="tRNA-Gly"
FT   gene            complement(353970..354548)
FT                   /locus_tag="Npun_R0283"
FT   CDS_pept        complement(353970..354548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0283"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   ana:alr3993 6,7-dimethyl-8-ribityllumazine synthase;
FT                   riboflavin synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79068"
FT                   /db_xref="GOA:B2J4U6"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U6"
FT                   /protein_id="ACC79068.1"
FT                   /translation="MAVFEGTFTQTEPLRFAVVIGRFNDLVTGKLLEGCQDCLKRHGVD
FT                   PNPQGNQVDYVWVPGSFEVPLVARQLALSHRYDAVICLGAVIRGQTPHFDYVSAEVSKG
FT                   IAAASFQTGVPVIFGILTVDTMQQALERAGIKGNHGWDYALNALEMASLMRQLRSNLAE
FT                   PYSRNSQALPASFQSASIGNLTAESEELG"
FT   gene            complement(354738..354926)
FT                   /locus_tag="Npun_R0284"
FT   CDS_pept        complement(354738..354926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0284"
FT                   /product="photosystem II protein PsbZ"
FT                   /note="PFAM: photosystem II protein PsbZ; KEGG: ana:asr3992
FT                   putative photosystem II PsbZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79069"
FT                   /db_xref="GOA:B2J4U7"
FT                   /db_xref="InterPro:IPR002644"
FT                   /db_xref="InterPro:IPR036512"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J4U7"
FT                   /protein_id="ACC79069.1"
FT                   /translation="MTIIFQFALIGLVLLSFVLVVGVPVAYATPQNWVESKKLLWVGSA
FT                   VWIALVFLVGLLNFFVV"
FT   gene            355077..357773
FT                   /locus_tag="Npun_F0285"
FT   CDS_pept        355077..357773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0285"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /EC_number="1.1.1.205"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: CBS domain containing protein;
FT                   phosphoesterase, RecJ domain protein; Polynucleotide
FT                   adenylyltransferase region; KEGG: ava:Ava_1708
FT                   phosphoesterase, RecJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79070"
FT                   /db_xref="GOA:B2J4U8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U8"
FT                   /protein_id="ACC79070.1"
FT                   /translation="MDLILCHTTADFDALGAAVGLTRLLPGSKIVLTGGSHPPVRDFLA
FT                   LHRDEYSLIERRSVNPEKIRSLTVVDTQQRDRLGKAAEWLDLPHLGEIIVYDHHLGQES
FT                   DIPATRSHISSVGAATTLIVEQLQQQEISLTSAEATVMALGIHVDTGSLTFEQSTPRDA
FT                   LALAWLMQQGASLSVISTYRDPGLSLQLQQLLTEALENLEYLCLHGYTVAWVTLKTDSF
FT                   VPGLSSLASELVELTEIDAILLANEYPLSENDSRLTIIGRSQIPKTNLNLLFQLLGGGG
FT                   HSKAASLNLRGVDSQAILKQLLDGVKAQIPHPLTARDLMSSPVRTILPETTIAEAQRIL
FT                   LRYGHSGLSVVDAQGQLVGIISRRDLDIALHHGFSHAPVKGYMTTNLKTITPDTTLPQI
FT                   ESLMVTYDIGRLPVLENGQLVGLVTRTDVLRELHQERDEDGGGEEVQRGKSNINLPQLQ
FT                   NKLAPQLWQLLTIASQEAEKRGWHLYLVGGAVRDLLLAKTAGSLMIKDIDLVVDGFHKS
FT                   ADVGAGVELAKALQQLYPAARLEIHGAFQTAALLWHKDPELDSLWVDIATARTEFYPYP
FT                   AANPEVEASSIRQDLYRRDFTINAIALRLTSPRSGELLDFFGGLLDLQAKQIRVLYANS
FT                   FIEDPTRIYRGVRFAVRFGFEIEPQTEEFIRYAINSGVYDRTSQENTKTPALQTRLKTE
FT                   LKHILEAPYWKSALQLLDNLGALQCIHPTLKLDGSLLRQLRLLERCLRRFDAEQTLIHW
FT                   QMRLEALIAHLAPEYRVKVAKNLQLQEDSILRLKNLVQSFSQVIECLPTLQRPSQIVQL
FT                   LRQYDLPILILIALQSPRSLRHQIWEYLTVWANVQPLLNGNDLKKLGYKPGPLYRQILD
FT                   DVVAATLDGVIKDRTEAEEFLAQHYPN"
FT   gene            complement(357786..358508)
FT                   /locus_tag="Npun_R0286"
FT   CDS_pept        complement(357786..358508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0286"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ana:all4679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79071"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4U9"
FT                   /protein_id="ACC79071.1"
FT                   /translation="MTIAQELDDQKGIRQDVIFPPGDLYSDEPPLESELHLRQIILLLT
FT                   CLEWLWRDRNDFYAAGNLTIYYSPRQRKSEYFRGPDFFVVLGTERKTRKSWVVWEEDGK
FT                   YPNVILEILSNSTTNTDKGLKKTIYQDTFRTPDYFWFDPYTQEFAGFHLVDGEYQPLQA
FT                   SEQGHLWSHQLGLYLGVYEGLLRFFTRDGQLVATPEETAEQAEQKAEQSQQQAEQAEQK
FT                   AERLAAKLRELNIDPDTI"
FT   gene            359033..360667
FT                   /locus_tag="Npun_F0287"
FT   CDS_pept        359033..360667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0287"
FT                   /product="ABC transporter related"
FT                   /EC_number="7.6.2.5"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: chu:CHU_0218 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79072"
FT                   /db_xref="GOA:B2J4V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V0"
FT                   /protein_id="ACC79072.1"
FT                   /translation="MQKKSILLAENLAYELSLAQTLFQKIQVSIEAGDRIALVGRNGVG
FT                   KSTLLKILADQIKPSVGSVWSNGVVYCLPQISAIRQEITADTVLDFLISISDEWWKIEE
FT                   ILQTQFDTNINLYLPITNLSGGELTKLFIAIGLSQQPNLLLLDEPTNHMDLQALENLRQ
FT                   FLQNFTGAFVIVSHKPFFLDQVTDVTWELTPDALKVYGGNFSQYREQKQIELEAALRSH
FT                   EIARKELKRTQTTAIQEQQRAAQSSCNGRAKFLNGSIDRMAAGLIKSKAEVSTGTAKKK
FT                   HEAAVAKANEKVAETKIKTTKVTSIQLEEKNQKRRNLINIQGANLRVSERLLIQNIQLH
FT                   VSSSDRIAIVGANGSGKSSLVKAILGMENQTIVLDSGEVLLAPAMKAVYLDQTYELVNR
FT                   QYTILENMQAANPSLSYQLLRQQLGHFLFKYDDVQKSASVLSGGELARLALAMIGISEI
FT                   DLLILDEPTNNLDIETVEQMVVGINDYQGAIWVISHDFDFLSQINITQSFNLKEQALQI
FT                   TTYLPNTPEQYYQELVKCHDICYSRSV"
FT   gene            360808..361134
FT                   /locus_tag="Npun_F0288"
FT   CDS_pept        360808..361134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79073"
FT                   /db_xref="InterPro:IPR040003"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V1"
FT                   /protein_id="ACC79073.1"
FT                   /translation="MSNPLVQAFFVGRAVAEVVNERLEVALTDALSDLGKFDAEAREQL
FT                   RQFTEEVLERANRSAEAANSGQATTGSGQTNSDSGDLQADIDELRAEIALLRTELQHYR
FT                   RTSA"
FT   gene            361251..362972
FT                   /locus_tag="Npun_F0289"
FT   CDS_pept        361251..362972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0289"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: ana:alr4515
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79074"
FT                   /db_xref="GOA:B2J4V2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V2"
FT                   /protein_id="ACC79074.1"
FT                   /translation="MIRLQTNGTQKDMEQGYSDKAYRWNREKYSSRRRFVDIWSFVLTL
FT                   LFKLWLYNKSWSYPGGVTEVKQTARRKTQAVWIRNTLLDLGPTFIKVGQLFSTRADIFP
FT                   GEYVEELAKLQDKVPAFSYEQVEATIEKELGKKIPELFDNFEPIPLAAASLGQVHKAVL
FT                   HSGESVVVKVQRPGLKKLFEIDLQILKGITRYFQNHPKWGRGRDWLGIYEECCRILWEE
FT                   IDYLNEGRNADTFRRNFRGYDWVNVPRVYWRYASSRVLTLEYLPGIKISQYEALEAAGL
FT                   DRKAIARQGAQAYLLQLLNSGFFHADPHPGNIAISASGALIFYDFGMMGRIKSNVREGL
FT                   MQTLFGIAQKDGDRVVQSLIDLGAIAPTDDMGPVRRSVQYMLDHFMDKPFENQSVAAIS
FT                   DDLYEIAYNQPFRFPATFTFVMRAFSTLEGVGKGLDPEFNFMEVAKPYAMQLMTDMNGS
FT                   EGNTFINELSRQAAQVSSTAFGLPRRLEDTLEKLERGDMRLRVRSIETERLLRRQSSIQ
FT                   LSMSYALLITGFTLSATILVVSNYVLWALVPGLIALGISVILIRLLLRLDRYDRMY"
FT   gene            362990..363715
FT                   /locus_tag="Npun_F0290"
FT   CDS_pept        362990..363715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0290"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: protein phosphatase 2C domain protein; Stage
FT                   II sporulation E family protein; KEGG: ana:alr4516 probable
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79075"
FT                   /db_xref="GOA:B2J4V3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V3"
FT                   /protein_id="ACC79075.1"
FT                   /translation="MKLNFTGFSDPGLIRSNNQDAYYVDPEGRFFVVADGMGGHAGGEE
FT                   ASRIATEEIQAYLLANWESSKSSQELLEQALWGANEAILQDQQNHPERADMGTTVVAVI
FT                   FRAPESPWCAHVGDSRLYRFRESHLEQVTEDHTWVARAIKIGDITLDEARSHPFRHVLS
FT                   RCLGREDLHQIDVQPLDVKAGDRLLLCSDGLTEELVEQKITSCLQNAPWLDKAAISLIE
FT                   AAKEHGGHDNITVVIVSLE"
FT   gene            364301..364585
FT                   /locus_tag="Npun_F0291"
FT   CDS_pept        364301..364585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3383 phycobilisome degradation
FT                   protein; NblA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79076"
FT                   /db_xref="InterPro:IPR007574"
FT                   /db_xref="InterPro:IPR036904"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V4"
FT                   /protein_id="ACC79076.1"
FT                   /translation="MVDTYKSNYYPIWTSASDITFMRFFSELTMNQPMKLSLEQQFSIC
FT                   SFATQVQNMSHDQAKDFLVKLYEQMVVREATYQELLKHQWGLDSGSTMA"
FT   gene            complement(365060..366613)
FT                   /locus_tag="Npun_R0292"
FT   CDS_pept        complement(365060..366613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0292"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG: ana:all4518
FT                   serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79077"
FT                   /db_xref="GOA:B2J4V5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V5"
FT                   /protein_id="ACC79077.1"
FT                   /translation="MSDPNIGRLLSKRYQLQELIGTGAMGRVYRAKDTLLGGVPVAVKF
FT                   LALSIQNEKMRLQDRFEREAKTCALLGQKSIHIVRVMDYGVDDNNTPFYVMEYLQGQSL
FT                   NNIIRKQRLPLPRFLSMARQLSLGLQCAHDGIPVEGTICPIIHRDVKPSNMLVIQDPSF
FT                   GELVKVLDFGIAKLLQSDGDHTKFYLGTLAYSSPEQMEGKELDNRADIYSLGVMMFEML
FT                   TGKMPLVAQTHSFGAWYKTHHYQKPRSFTEVAPGLELPKEIENLVMSCLAKLARDRPQS
FT                   ITEILRVLASLEKPEHTRKVKQDSHALIPATTASPELEQKTKADLRASLSNDEIARAIS
FT                   WPQNKPIADIVFPQSIHSNGEVLPALWVMLPQEEIQKRLLCTRYNQFLFISIPHPMLLW
FT                   ITVIYNRKHGAKWLPYYLDLKTSLGQEITRLLQHTGYYRLLFFARETPNRCTHILPSSV
FT                   ASAQRQRLQEWVAMSNTLMSTADPQMSKSLLKSEYEKIKPQILAKLESIDTDSPYDLSS
FT                   "
FT   gene            complement(367482..368495)
FT                   /locus_tag="Npun_R0293"
FT   CDS_pept        complement(367482..368495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0293"
FT                   /product="glycosyl transferase, family 2"
FT                   /EC_number="2.4.1.83"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ava:Ava_4840 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79078"
FT                   /db_xref="GOA:B2J4V6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V6"
FT                   /protein_id="ACC79078.1"
FT                   /translation="MNPKVSVIIPAYNTEAYIAKAIQSALEQTLSDIEVIIVDDGSSDK
FT                   TVEVAKSFTDQRLKVIVNQQNLGVSAARNRAIKAAQGEWVAVLDSDDWYTPERLEKLLL
FT                   QAEKTNADMIADDLYLIHDGATSPWSTFIQESGECIDETLQIDLISLVKSGVYGEPVLP
FT                   FGLSKPIFRREFLVKHGILYDETVSIAEDFWLDVKCLINGARFFIVPEPYYFYRSRPIS
FT                   LVRQSILSRLNQYCIATNSFMQQEVVKNNPDLMLALSYNLASYKKHLAYFKVVVPVKQR
FT                   QWLTALREIRENPHFFAFLISRLNNIIKRRMQYYVMGNKLVFDMSYNLQKKRKPVN"
FT   gene            complement(368985..369431)
FT                   /locus_tag="Npun_R0294"
FT   CDS_pept        complement(368985..369431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79079"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V7"
FT                   /protein_id="ACC79079.1"
FT                   /translation="MAHTFLLEPGRWAMQGNWLERNGMPISVKGMTLVAWNRDNWFTMA
FT                   TKLIFPGSDRSEISLQYKGRLHEGERQYTFLLQHNILGQVEGEGWIGLDTIVQRYWVIG
FT                   DRQRRSGFETLHRISEDRYYLSSGILAGHFLTNTMEVSLERQST"
FT   gene            complement(369594..370823)
FT                   /locus_tag="Npun_R0295"
FT   CDS_pept        complement(369594..370823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0295"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   ava:Ava_3386 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79080"
FT                   /db_xref="GOA:B2J4V8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V8"
FT                   /protein_id="ACC79080.1"
FT                   /translation="MHPTEKAAVSTRVIGLISGTSVDGIDAVLIEISGTELDLKVELLA
FT                   GKTYPYPSELREKILAVGAGVAISMEELAEIDDAIAQVFAQAAQNIQIGHQPATLIGSH
FT                   GQTVYHRPPKEGAGEQRSRGREMLTPHSALSTRLGYSLQLGRGELIAYLTGITTVSNFR
FT                   VADIAIGGHGAPLVPRVDAYLLSHPEEGRCIQNIGGIGNVAYIPPRHGDWLSKIRAWDT
FT                   GPGNSLLDLAVEHLSAGAKTYDENGNWAASGTPCHPLVEQWLNQDYFHLPPPKSTGREL
FT                   FGVTYLHQSLKDAQEYQLNAADILATLTELTAASIVHSYRTFLPEMPQRVLLCGGGSRN
FT                   LYLKRRLELLLTSIPVLATDEVGLNADFKEAIAFAVLGYWRHLGIPGNLPTATGAPREV
FT                   LLGEIHQSQS"
FT   gene            371536..372339
FT                   /locus_tag="Npun_F0296"
FT   CDS_pept        371536..372339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr4521 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79081"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4V9"
FT                   /protein_id="ACC79081.1"
FT                   /translation="MKNLLIKSAIASGVVLSLATVSRPVMAASFAVSIENAGVQNAQLS
FT                   NLVNAHVDTFDSETQGYSATGFQWNDGTKNIGSYQNTLVMNAEQYGGAGGTGKYFDVDT
FT                   NRSGNGQKVSTLNLATPQSYFGFWWSAGDSSNVLTFLSQGQVVYSMTTADVVNYIAKLP
FT                   NKTSYYGNPNSTFKNQDSGEPFAFINFYDVGGTFDQVQFTNIGGTGFESDNHTVATGYN
FT                   SINGNIVTTAVPESSSLLGVFAIGFVGAASVMTRRVKKKSVLQLS"
FT   gene            372822..374237
FT                   /locus_tag="Npun_F0297"
FT   CDS_pept        372822..374237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0297"
FT                   /product="folate/biopterin transporter"
FT                   /note="TIGRFAM: folate/biopterin transporter; PFAM:
FT                   Biopterin transport-related protein BT1; major facilitator
FT                   superfamily MFS_1; KEGG: ava:Ava_1237 biopterin
FT                   transport-related protein BT1"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79082"
FT                   /db_xref="GOA:B2J4W0"
FT                   /db_xref="InterPro:IPR004324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039309"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4W0"
FT                   /protein_id="ACC79082.1"
FT                   /translation="MAFQSSGLSKVKDSFTQKIFLGNEPNAELIAILTVYFVQGILGLS
FT                   RLAVSFFLKDELLLSPVQVSALLGIVFLPWMIKPVFGFISDGLPIFGYRRRPYLILSGI
FT                   LGTASWMSLATIVHTSWAATLAIAIGSLSVAMSDVIVDSLVVERARGESQAKAGSLQSV
FT                   CWGASAIGGLITAYFSGLLLQYFTTRTVFGITALFPLIVSGVAWLIAESPVSKGTNESN
FT                   QTNPLPIKHQLKQLRQAITQKTIWLPTAFVFIWQATPNAESAFFYFSTNELHFEPEFLG
FT                   RVNLVTSFASLAGVWIFQRFLKSIPFRVIFAWSTVLSSMLGMTMLLLVTHTNRLLGIDD
FT                   HWFSLGDSLILTVMGKIAFMQVMVLAARLCPSGVEATLFALLMSVFNSAGTVSQALGAL
FT                   ITYWLGITATNFESLWLLVIITNLSTLLPLPFINWLPAAEEQAETSKDGEQAFLPDLMS
FT                   ELVLTEPESEIVE"
FT   gene            374354..375850
FT                   /locus_tag="Npun_F0298"
FT   CDS_pept        374354..375850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0298"
FT                   /product="Carotenoid oxygenase"
FT                   /EC_number="1.13.11.63"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: ava:Ava_1236
FT                   retinal pigment epithelial membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79083"
FT                   /db_xref="GOA:B2J4W1"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4W1"
FT                   /protein_id="ACC79083.1"
FT                   /translation="MHLKSQESPVTEKSYTRADWQGGYQSLTQEFDYWIDDIEGQIPRE
FT                   LEGTLFRNGPGLLDVNGQFLHHPFDGDGMISKITFTNGRAHFRNRFVRTTGYLAEQKAG
FT                   KILYRGTFGTQKPGGWRVNIFDFKLKNIANTNVIYWGGKLLALWEASEAYCLDPYTLET
FT                   LGNEYFNGALSAGEAFAAHPRLQRNCEQDGGEPRLVNFSIKPGLSTTITIFELNLAGEI
FT                   VRQQAHKVPDFCFIHDFVITPNYCIFFQNPVTFNPIPFALGIRAAGECIKFQPNQPTKI
FT                   IIIPRFPKEGQEEIKFLETQSGFVFHHVNAFEVGEEVLIDSICYQDLPEVEPKSDFRQV
FT                   DFEASSPGQLWRFYLNLKNGTVQRELIDSRCCEFPSIDPANVGHPYRYLYIGAAHAESG
FT                   NAPLQALLKIDLHSGEKQFWSAAPRGFVGEPIFVPRPDSEKEDDGWVLALVYNAAHHRS
FT                   DLVILDASDFSKGTIARLHLKHHIPYGLHGSFTSEVFGEI"
FT   gene            complement(375855..377009)
FT                   /locus_tag="Npun_R0299"
FT   CDS_pept        complement(375855..377009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0299"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase, sensor domain protein"
FT                   /note="PFAM: Osmosensitive K+ channel His kinase sensor;
FT                   UspA domain protein; KEGG: ana:all4242 potassium-dependent
FT                   ATPase subunit D'"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79084"
FT                   /db_xref="GOA:B2J4W2"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4W2"
FT                   /protein_id="ACC79084.1"
FT                   /translation="MSDNNTGSNGTAPLNSGSYSLYPVRRRGKHKIFIGMAPGVGKTYR
FT                   MLEEGHALKQEGIDVIVGLLETHGRKDTEEKAEGLEILPRKQYPRGELMLTDMDTDAIL
FT                   KRSPQLALIDELAHTNVPGSPREKRYEDVEVVLAAGIDVYSTMNVQHLESLNDLVARIT
FT                   GVVVRERVPDRILDEADEIVVVDVTPETLQERLLEGKIYAPQKIQQSLDNFFQRRNLIA
FT                   LRELALREVADNVEENAIATTPNGQSCNIHERVLVCISTYPNSVQLLRRGARLASYMNA
FT                   PLYTLFVADPERFLTKEESLHIHTCEKLCNEFEGTFLRVTNSNVANAIAEVAEKYRITQ
FT                   IVIGESQRSRWQMLLKGSLTQKLVRLLKNIDLHIIASEKMVLSK"
FT   gene            complement(377185..377787)
FT                   /locus_tag="Npun_R0300"
FT   CDS_pept        complement(377185..377787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0300"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="7.2.2.6"
FT                   /note="TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K+ transporting ATPase, KdpC subunit; KEGG:
FT                   ana:all4243 potassium-dependent ATPase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79085"
FT                   /db_xref="GOA:B2J4W3"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B2J4W3"
FT                   /protein_id="ACC79085.1"
FT                   /translation="MAIIRETIRAIFITLMLWLLTAIIYPLIILVVGQVFLPYQANGSI
FT                   MLNLNNEPIGSALIGQLFTSERYFHPRPSTVRYSQGKKAKPTGISGASNLAASNPELLK
FT                   RILEEANQLRDENLQPIADMIYTSGSGLDPHISFKAARQQLTRVAGARGVKEDEILRLI
FT                   NKYTDGRFLWIFGEPGVNVLRLNYALDLQDINRQQNQ"
FT   gene            complement(378132..380237)
FT                   /locus_tag="Npun_R0301"
FT   CDS_pept        complement(378132..380237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0301"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="7.2.2.9"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   ana:all4245 potassium-dependent ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79086"
FT                   /db_xref="GOA:B2J5S0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S0"
FT                   /protein_id="ACC79086.1"
FT                   /translation="MNQVATNFRARRPNPRSGDHRQGRKKARTSKKWLYLRAIRDAFVK
FT                   LNPKYVIKNPVIFVVWVGTIIILLLTIDPNLFGPALQKKPQLFNGLLSGILFFTVWFAN
FT                   FAEALAEGRGKAQADALRLTKSEAIAKKLAPDGTISEVSSTNLKKGDNIYVVAGDIIPG
FT                   DGEVIMGVASVDESAITGESAPVLKESGSDVSSSVTGGTRIISDELIIRITTDPGKGFI
FT                   DRMIGLVEGAERSKTPNEIALTVLLAVLSLVFLLVVVTLPALAYYVNSPVSVPTLIALL
FT                   VALIPTTIGGLLSTIGIAGMDRVAQFNVIATSGKAVEACGDVNTLVLDKTGTITLGNRL
FT                   AEEFIPINGHSMSEIANVAWAASFFDNTPEGKSIIRLAEKLGARFDFDSNQAEGVDFSA
FT                   KTRMSGTNLPGGYEARKGAVEAIKGFVRSRNGRDTPELDAAYERVSRLGGTPLAVSLDN
FT                   EIYGVIYLKDIVKPGIRDRFEQLRRMGVRTIMLTGDNQITASVIAKEAGVDDFIAEATP
FT                   EDKISVIKKEQAAGKLVAMTGDGTNDAPALAQANVGVAMNTGTQAAKEAANMVDLDSDP
FT                   TKLIDIISIGKQLLITRGALMTFSIANDIAKYFAIIPVIFVAANLQSLNIMNLTSSKSA
FT                   VLSALIYNALIIPALIPLALKGVRFRPLTANQLLQRNILIYGLGGVIAPFIAIKLIDIL
FT                   ITIVGLA"
FT   gene            complement(380583..382268)
FT                   /locus_tag="Npun_R0302"
FT   CDS_pept        complement(380583..382268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0302"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="7.2.2.6"
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K+ transporting ATPase, A subunit; KEGG: ava:Ava_1195
FT                   potassium-transporting ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79087"
FT                   /db_xref="GOA:B2J5S1"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S1"
FT                   /protein_id="ACC79087.1"
FT                   /translation="MGQGFLQIGLTLCIVIAITPLLGRYIAHVFLGERTLLDFLMNPIE
FT                   RSMFVLAGVRRKDDMTVSQYIRAVLYSNLIMGISVYLLLYFQRLLPWNPNGFGAPSWDV
FT                   LLHTTISFVTNTDQQHYAGETTLSYFSQVAALGFLMFTSAATGLSVGIAFIRGLTGRRL
FT                   GNFYVDVVRAITRILLPISIIGAIALLLTGVPQTLAKTMDVRTLEGGTQYLARGPVASF
FT                   EMIKLLGENGGGFFGVNSAHPFENPNGASNLIEMIAMISIPAALIYTYGIFANNIKQAW
FT                   LLFWMVFVIFVVLVGVTAVGELQGNPLVNNAFALEQPNLEGKEVRFGWLQTAFWAVMTT
FT                   ATMSGAVNGMHDSLMPQGIFSTLFNLFIQVIWGGQGTGTAYLFIYLILTVFLTGLMAGR
FT                   TPEFLGRKIEKREIVLASVVLLIHPILVLIPSAIALAYPISLSGISNSGHHGISQVVYE
FT                   YASATANNGSGLEGLKDNTLWWNLSTLVSLIGGRYIPIIAILLLADGMSRKQQVQETPG
FT                   TLRTDSLVFTGITAGVTLVLGVLTFFPVLALGPIAEGLKLASGN"
FT   gene            382792..383895
FT                   /locus_tag="Npun_F0303"
FT   CDS_pept        382792..383895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0303"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ava:Ava_B0208
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79088"
FT                   /db_xref="GOA:B2J5S2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S2"
FT                   /protein_id="ACC79088.1"
FT                   /translation="MTILSRLVAMKEAINERGETYGLIAIAFAIVISLEYLTPPEYVFG
FT                   YLYTGTILLADSRLNRKAVLGITLAATGLTLLNLFVPGGEIIYPPTLANRLIAVLALMV
FT                   TGWLSDRNHRNEEAIAYTQAQLRSQEQLAIMREDFVSTLTHDLKTPLLGAIETLKYFQN
FT                   EQFGEITPMQAKVLQTMARSHRSTLQLVQTLLDVYRNDAEGLKLQISPVNLATVAEEII
FT                   ATLAELARTRQVYISLHYGESDFRSFLWVNGDSLQLGRVFTNLLSNGINHTPRGGKVEV
FT                   VLEGYSSDQVVKILDTGSGFTEEELPHLFERFYQGHSDRHVSGSGLGLYLTRQIIAAHG
FT                   GTIWAENRSPRGAMFGFRLPACPPPGS"
FT   gene            383981..384655
FT                   /locus_tag="Npun_F0304"
FT   CDS_pept        383981..384655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0304"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: ava:Ava_B0209
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79089"
FT                   /db_xref="GOA:B2J5S3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S3"
FT                   /protein_id="ACC79089.1"
FT                   /translation="MTKILLVEDDELFRLGLRMRLQQETSLEIVAEAEDGEQAVELANR
FT                   YPLDLVLLDIGLPGIGGIEACRQIKQKHPNLPILVLTSRSEKPLISRLIAAGAQGYCLK
FT                   GIPAESLILAVRSVAGGASWWDQTATTEIRAAFEGNSTVVLPAKTEGTLENPLTKREQE
FT                   ILALVAAGKSNQEIAEILYIAPGTVRVHVHAILQKLEVRDRTQAAVLAIQKGLVAPELL
FT                   IN"
FT   gene            385129..388854
FT                   /locus_tag="Npun_F0305"
FT   CDS_pept        385129..388854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0305"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; Na-Ca
FT                   exchanger/integrin-beta4; FG-GAP repeat protein; KEGG:
FT                   ava:Ava_0582 integrins alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79090"
FT                   /db_xref="GOA:B2J5S4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S4"
FT                   /protein_id="ACC79090.1"
FT                   /translation="MPTNTAPTLDNAGNPILTAITQDVTDTENLGTLVSAIIATGTGGN
FT                   PITDVDTGAVEGIAVIGVDNTHGIWQYSTNGGNNWINFAVSAISATLLRDTEKVRFIPN
FT                   AGYNGTAEITFRAWDASDGNASGTTGVNPGVGGGTTAYSSATETASISILPLVGLRPYS
FT                   IIVADLNKDGNTDLVTANKSSQSVSVLLGKGDGTFKPATTFSVVGFNGLNPYSVAVADF
FT                   NKDGKLDLVTANNVSNNISVLLGKGDGSFQAAVNFDLPSGSAPISIAVGDFNKDGKSDI
FT                   VTANNASQNISVLLGNGTGGFGSAINFKVPSRPTSVIVGNFNGDGISDLAVTSSYFNNV
FT                   SILLGNGDGTFNSATQFDVGTNPHSVVIGDFNKDGKSDLAVANSDSNNVSVLLGNGDGT
FT                   FKPATNFNVGLNPVSVTVIDFNGDGKSDLAVANADSNTVSVLLGDGIGSFGNATNFDVG
FT                   TTPYAVTVGDFDKDGKSDLAVANSESRNVSILLNNRAESYDPVPPQPILINEIFFDPPS
FT                   TDGPREYIELRGTPGETLAPGTYLVGIEGDSGSPNPGNVQDIFDLSGKQFGSNGLLVLL
FT                   QKGNPYVNVVNPNANIVTNAGTGAGWGSGASSSIGHTGQTGATDIENNSVSFFLIQTTT
FT                   APTLSNDIDSNDDGIVDPAVYSKWTVLDSVSVLDGTSTTDRAYSSIVFRKGSNGGSVPA
FT                   NATVVDTSFIAGYVGRSGNTTGSTASDWVASAITTGTAPNFALATAPNTSPGNFAEQPL
FT                   NHIGNTNFAPPANINYAISTATPTVIEGNSGSKTVSFTVTRSGNTAIATTINYALDGTA
FT                   TSVSDYNTIKVGTATGTLSGTLKFAVGETTKTISLNVLGEKLTEPDETINLNLNYPNQV
FT                   AAIAPATITIVDDDNIPAISIADKSGSEGSGNFVFTVKLSNASTEIVTVAYNSSNDTAI
FT                   AGIDYTAVTGSLTFNPGVTTQTITVPILNDFVAESSERFFVNLINPTNASIADNQAIGT
FT                   ITDNDIVGFNISPATGLITTEAGGTANFNIQLTSQPTADVTLNLSSSKVSEGTVSNSVT
FT                   FTAANWNTPQVITVTGVNDGIVDDNIAYKIITGTVVSNDSKYNNFNPANIADIDVVNIK
FT                   NGNQVNSIITGSAKADNLQGTSSDDLIFGFASNDIIVGGLGNDQIYGGLGSDNLTGGAG
FT                   NDIFVLAKGEGIDTIKDFNLSEDLIALSGGLIYSGLSLTQSGSNTIIKDTSNNQNLAIL
FT                   TGIQASTLNASYFITY"
FT   gene            complement(388940..391468)
FT                   /locus_tag="Npun_R0306"
FT   CDS_pept        complement(388940..391468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0306"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: ana:all4248 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction enzyme, res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79091"
FT                   /db_xref="GOA:B2J5S5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S5"
FT                   /protein_id="ACC79091.1"
FT                   /translation="MYINGISLSPLVVAQASESYQSGTTLNRWVEVLVDCPGSTGLFTY
FT                   RLPAQLEIKPGDILSVPFGAQQLGAIAIRLLAQPNVDLAPEKIREVEDIVSVGFFPSAY
FT                   WELLNRVAAYYYTPLIQVIRVALPPGLLGRSQRRIRLVRGGRAAGSSYLLASTNPSAFL
FT                   TPTARQVWELLQTQPAGDYSFAYLQQKVKSAYRGIRELLRFGLVESYLEPPRLTRPKLQ
FT                   KAVTLTGTIDCDLTTRQREILVVLRRHNGELWQNELLQICNASSSILKTLSQKGYIVIE
FT                   EREVLRTEQGPVLAGDGAKSLTSAQASALATIETLDGFAEVLLHGVTGSGKTEVYLQAI
FT                   APLISEGKSALVLVPEIGLTPQLTDRFRARFGNKVSVYHSALSDGERYDTWRQMLTGKP
FT                   QVVIGTRSAVFAPLPKLGLIILDEEHDSSFKQDSPIPTYHARTVAQWRAELENCPLLLG
FT                   SATPSLESWISVRRQKAEGRRQETYYLSLPERINSRPLPPVEIVDMRQELQQGNRSIFS
FT                   RSLQEALQQLQERKEQGILFIHRRGHSTFVSCRSCGYVLECPHCDVSLAYHHTEEKAPE
FT                   LLRCHYCNYARSHPKYCPDCSSPYLKFFGSGTQRVTQELARQFPELRLIRFDSDTTRNK
FT                   GSHRTLLTQFANGEADLLVGTQMLTKGLDLPQVTLVGVVAADGLLNLSDYRASERAFQT
FT                   LTQVAGRAGRGNDPGRVIVQTYTTEHQVIAAVRSHDYHSFSQAELEQRQALNYPPYGRL
FT                   ILLRLSSLDPIQVQNTAQIIATALSTEEKFEILGPAPASILRVANRYRWQILIKFAPDA
FT                   LPQLPDWEEVRSLCPASVSLTIDVDPINIM"
FT   gene            392309..393445
FT                   /locus_tag="Npun_F0307"
FT   CDS_pept        392309..393445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0307"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /note="PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   sigma-70 region 1.2; KEGG: ana:alr4249 group 2 sigma
FT                   70-type sigma factor F"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79092"
FT                   /db_xref="GOA:B2J5S6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S6"
FT                   /protein_id="ACC79092.1"
FT                   /translation="MNIVELGKMEILENAADIEEPSLDSLDAVADEEPPIVVENLESDE
FT                   RDGDDMAAARPSGYNKTEHDDAVGAFFKEMARYPLLKADEEVELARRVRFLEEIRELQA
FT                   ALNLKLGQEPTKLEIASELEMTEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRG
FT                   VPFLDLIQEGAMGLNRATEKFDPDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIV
FT                   EKLNKLKKAQRELKQKLCRNPTEGEMAEALDISVQQLRQLQQLRRQALSLNHRVGKEED
FT                   TELMDLLEDEDNLSPEAKMNENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLE
FT                   EVGNMFNLSRERVRQIQSKAMRKLRRPHIAKRLKGWLI"
FT   gene            393732..394226
FT                   /locus_tag="Npun_F0308"
FT   CDS_pept        393732..394226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0308"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /EC_number="2.3.1.110"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ana:alr4250 probable N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79093"
FT                   /db_xref="GOA:B2J5S7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S7"
FT                   /protein_id="ACC79093.1"
FT                   /translation="MTLCSNLILRFAEPTDYSVLFQLIQGLAEYEKLSHAVTGDALALK
FT                   EHLFGSHRYIEAILAETAGQAVAFALFFHNYSTFLTKPGIYLEDLFVLPEYRRQGIGKA
FT                   LISKVAQIAIERDCGRLEWSVLDWNEPAKVFYRSIGASILDDWRICRVTEDALTQLGAV
FT                   N"
FT   gene            complement(394745..395989)
FT                   /locus_tag="Npun_R0309"
FT   CDS_pept        complement(394745..395989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0309"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41; KEGG:
FT                   ana:all3420 carboxyl-terminal processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79094"
FT                   /db_xref="GOA:B2J5S8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5S8"
FT                   /protein_id="ACC79094.1"
FT                   /translation="MGFMNKQVFRVGFSLLMAFWLAFGTLTQPAVALTGEQKLVSEVWR
FT                   IVNRTYLDETFNHQNWAAVRQKVLEKPLTDSNASYAAIGKMLKSLDDPFTRFLDPEQYR
FT                   SLKVNTSGELTGVGLQIVLNPETGKLEVVAPIAGSPADKAGIRPRDRILKIEGVSTKNL
FT                   TLDEAATKMRGPSGSLVTLLIERDGEPETEIKLTRDRIALNPVVSELRVSAEGTSIGYL
FT                   RLTQFNANASMELAHAISSLEKKGAAAYILDLRNNPGGLLQSGIEIARQWLDSGTIVYT
FT                   VNRQGIQGSFEALGPALTNDPLVILVNQGTASASEILAGALQDNGRAQLVGETTFGKGL
FT                   IQSLFELSDGSGLAVTIAKYETPQHRDINKLGIKPDKVISQDPINREQIGTEADLQYQA
FT                   AVELLKKDLVVAGKA"
FT   gene            396496..397143
FT                   /locus_tag="Npun_F0310"
FT   CDS_pept        396496..397143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0310"
FT                   /product="Cytochrome b/b6, N-terminal domain protein"
FT                   /note="PFAM: Cytochrome b/b6, N-terminal domain; KEGG:
FT                   ava:Ava_3441 cytochrome b6"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79095"
FT                   /db_xref="GOA:B2J5S9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J5S9"
FT                   /protein_id="ACC79095.1"
FT                   /translation="MANVYDWFEERLEIQALAEDVTSKYVPPHVNIFYCLGGITLVCFL
FT                   IQFATGFAMTFYYRPTVTEAFSSVEYIMNEVNFGWLIRSIHRWSASMMVLMMILHVFRV
FT                   YLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGV
FT                   LISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLFHFLMIRKQGISGPL"
FT   gene            397405..397887
FT                   /locus_tag="Npun_F0311"
FT   CDS_pept        397405..397887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0311"
FT                   /product="Cytochrome b/b6, C-terminal domain protein"
FT                   /note="PFAM: Cytochrome b/b6, C-terminal domain; KEGG:
FT                   ava:Ava_3442 cytochrome b/b6-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79096"
FT                   /db_xref="GOA:B2J5T0"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR005870"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J5T0"
FT                   /protein_id="ACC79096.1"
FT                   /translation="MATQKKPDLSDPQLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIM
FT                   GSFAAIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMGSV
FT                   PVGLILVPFIENVNKFQNPFRRPVATTVFLVGTLVTVWLGIGAALPLDKSLTLGLF"
FT   gene            398109..398687
FT                   /locus_tag="Npun_F0312"
FT   CDS_pept        398109..398687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0312"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: ava:Ava_3443 putative anti-sigma regulatory
FT                   factor (Ser/Thr protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79097"
FT                   /db_xref="GOA:B2J5T1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T1"
FT                   /protein_id="ACC79097.1"
FT                   /translation="MPKSFIFCILVDKISQLRFFGIRAIWRIMQNLITSNLGLFIFKSQ
FT                   LMFTIVQQDHLKVKSELSLLNQVQEWFEQFCLQHLSQLGWSKTQLDRLNLALAEGFTNA
FT                   VRHAHHALPPETTIEINVDLWIDRLEIRIWDYGKPFNPDAIAEPAPGTLQVGGYGWFLL
FT                   RRLADRVVYERGADGRNCLLIVKYSVEAQ"
FT   gene            399031..400020
FT                   /locus_tag="Npun_F0313"
FT   CDS_pept        399031..400020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0313"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ana:alr3424 GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79098"
FT                   /db_xref="GOA:B2J5T2"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T2"
FT                   /protein_id="ACC79098.1"
FT                   /translation="MTKTALVTGITGQDGYYLSHLLLNRGYRVVGLVPPHRQPNLTKLG
FT                   TLANQVEIFTVDLRDSRALLTAVEQLRPQEIYNLAAPSFVPDSWNDPLGTLDLITGTAT
FT                   RLLEAVRQVGLSTRFYQASSSEMFGDVFSSPQDEETPFRPKNPYAAAKMHAHWTMVHHR
FT                   QRYGLFACSGILYNHESPLRAPQFVTRKVSLAAASIKLGLTDTLEMGNLDAKRDWGFAG
FT                   DYVEAMWLMLQVDEPEEYVIGTGKLHSVRDLVATAFESVGLDWTRYIVLNTSLLRQDEH
FT                   FQLVADPSKAKRNLGWEPQVSFEELLEKMVKTDLERLQSGAIAPLTQV"
FT   gene            400031..401218
FT                   /locus_tag="Npun_F0314"
FT   CDS_pept        400031..401218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0314"
FT                   /product="glycosyl transferase, group 1"
FT                   /EC_number="2.4.1.345"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ava:Ava_3445 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79099"
FT                   /db_xref="GOA:B2J5T3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T3"
FT                   /protein_id="ACC79099.1"
FT                   /translation="MHITKVTQNLKVGDKVNQKTNHVFVFLEIFAHEGGIQSYIKDIFR
FT                   AYLGLSQAYKAEVFLLRDSPDRLNLFEDENLKFHYFKNQSPHLGRLQMTAALLKCLLQN
FT                   RPQQVFCGHINLAVLIQTLCQPLGIPYTVLTYGKEVWEPLKNQERRALTSADKIWTISR
FT                   YSRDRACLANGINPKMVEMMPCAIDGDKFTPGSKQPEFVQKYRLTGSKVLMTVARLWSG
FT                   DIYKGVDVTIRALPQIAQVFPQVKYLVIGRGDDQPRLAQLAKDLGVSDRVVFAGFVATE
FT                   ELMQHYHLADAYIMPSQEGFGIVYLEAMACGVPVLSGDDDGSADPLQDGKLGWRVPHRN
FT                   PDAVAAACIEMLQGNDQRCDGQWLREQAIALFGIDAFQQHLQKMLLSSVFTPNNK"
FT   gene            401263..401634
FT                   /locus_tag="Npun_F0315"
FT   CDS_pept        401263..401634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0315"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79100"
FT                   /db_xref="GOA:B2J5T4"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T4"
FT                   /protein_id="ACC79100.1"
FT                   /translation="MSFKSFQLNLLNLRPWLTLLAVVWLLASLGLGWLVNSLLIIVGLL
FT                   FLAPIVAFFGFRWWLQRNLVADQCPVCRYEFTGLNNSQLQCPNCGESLLVQDSHFQRFT
FT                   PEGTIDVTAVEVPAKSLED"
FT   gene            complement(401677..402108)
FT                   /locus_tag="Npun_R0316"
FT   CDS_pept        complement(401677..402108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79101"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T5"
FT                   /protein_id="ACC79101.1"
FT                   /translation="MKTLRLLAILPISLVMSLVFTEANLAQIPNVQINRTFQPDPLVLN
FT                   GKSGGTVKSNCGNITTEPSQVIQVTESLPYLRLTVESQGKPTLLIDGPGGRFCVMADSY
FT                   SGGKPEQSGYWQAGRYSVYVGELSQQQHNYSLSISQHNK"
FT   gene            402577..402921
FT                   /locus_tag="Npun_F0317"
FT   CDS_pept        402577..402921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0317"
FT                   /product="conserved hypothetical protein, HglK"
FT                   /note="KEGG: ava:Ava_0606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79102"
FT                   /db_xref="GOA:B2J5T6"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T6"
FT                   /protein_id="ACC79102.1"
FT                   /translation="MNPQPEEDLQRRLDKLEAEINSAPGAVTQPQGQKQMPQPVFANLS
FT                   LQLERFKIWFNGLSGTKKLVVSGVTVLVGLAMLQAVFKLVASVITLALLAVLVYVGYKF
FT                   FVSSSFQRKQ"
FT   gene            403106..405259
FT                   /locus_tag="Npun_F0318"
FT   CDS_pept        403106..405259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0318"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: pentapeptide repeat protein; RDD domain
FT                   containing protein; KEGG: ana:all0813 heterocyst-specific
FT                   glycolipids-directing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79103"
FT                   /db_xref="GOA:B2J5T7"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T7"
FT                   /protein_id="ACC79103.1"
FT                   /translation="MTSPIVRRSSNQSGQSKEPERASSMLLASRRFAAWAAEITLVVAS
FT                   GLIPFGIGVYANSRSDLNRVPLNPVLVVTERAIARPLALPVSYGIRNVAWPTNILWTIA
FT                   LLAPVTLSCWQLYLLAKTGRTIPKRWFKVRVVNEQGKPPGLGAVVIREGVGRWTVPISI
FT                   AYLLWRYSFAFPNLGLFTFLSLLMIVGEGIGLPSRRGRRALHDQLAGTYTIDTTRPLPS
FT                   SLLANNRQAQSADGNNGAEGQEEELTAAETNHSPNLWRRIQQNPNLTLFGVGLTSMTAV
FT                   LATLIGTQVYIQIQQSQRATKQINSQQFLELVKQLTPNSGATNEQRQSAILAMGGLNDP
FT                   QSIKFLADLLVSETNPSLLDTIQQSLTTVGPQAIPELKNKNQFLVSELESVGSAATKER
FT                   ELRQGRLQRNQRTINKILSVYSGKMEGVDLSSTQLGQSGTPGSSFFNLVLDNLDLSGVK
FT                   FKSANLNQASFKGSRFRGAGEDGRWDTYDDVIADLSQAQLQQANLTDANLSRVLMNRID
FT                   LSRATLNRANLSNARLYDAKLNSTQLVGADLRNAVLERASLTGADLGDAKLNEANLYAA
FT                   RLGRVTAIGTQLSFANLTNTDWQGADLSGAYLDRANLSNANLSATRLAGAVLRSAQMEN
FT                   VNLQNADLSLADLRGANVAGADFKGAILAPSKEDPADQFVKTPDLGSVSAVVQGVDFSQ
FT                   AKNLDSKQLAYICTQGGIHPRCP"
FT   gene            405379..405870
FT                   /locus_tag="Npun_F0319"
FT   CDS_pept        405379..405870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr5049 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79104"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T8"
FT                   /protein_id="ACC79104.1"
FT                   /translation="MKYVPYLVSILGASLVLSLASTKPAQAQVAYGSYIGIGPTVGFTD
FT                   GIQFGGVIAGRYKLLEAPLSLRAQVLIGNNTAVVPTVSYDFPLNWQADAYLGAGLVLAG
FT                   GGGSSPVGDKISFALQPGIDYMIPNSNTVLFGNAIIAFDAYRDSGGTAISVQGGVGLRF
FT                   "
FT   gene            406288..407801
FT                   /pseudo
FT                   /locus_tag="Npun_F0320"
FT   gene            408337..408543
FT                   /locus_tag="Npun_F0322"
FT   CDS_pept        408337..408543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79105"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5T9"
FT                   /protein_id="ACC79105.1"
FT                   /translation="MESNLLTDAGADEVNQDFSEYVANLQLHMTLQARNLVPSLKQTLV
FT                   DSRQQLLHQTQAHFEKLVSRQGL"
FT   gene            408765..410003
FT                   /locus_tag="Npun_F0323"
FT   CDS_pept        408765..410003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0323"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ava:Ava_3803 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79106"
FT                   /db_xref="GOA:B2J5U0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U0"
FT                   /protein_id="ACC79106.1"
FT                   /translation="MTSLLPRNLSVVIRPVQYRDLDGIERITQESFAALTPQGAGFAIS
FT                   QMLMLRRWYGLLKFLSWFPNPLQYRLCAYVAEQGRMLLGMIQVSPFNRTRSTWRIDQVL
FT                   LERGVDKQGIGSQLLRHCFESILEARTWLLEVNINDIEALALYRQNGFQRLAEMTYWEI
FT                   GPELLAELAQAEPDLPNLLPVSNADAQLLYQLDTASMPPLVRQVFDRNTRDFKTSLFGA
FT                   LTDAVKQWLTKTEIVSGYVFEPQRKAAIGYFQVQLDRKGEVPHVATLTVHPAYTWLYPE
FT                   LLSQLARIAQDFPQQGLQLASSDYQAEREEYLERIGAKRIEHTLVMSRSVWHKLRESKF
FT                   VSLEGIQWTDMLQGLQPARKPIPGGMSWIQPGKLPSSDKPLPIKSEPINFSVKNPSIEA
FT                   SPIPESADAEQEN"
FT   gene            410003..410479
FT                   /locus_tag="Npun_F0324"
FT   CDS_pept        410003..410479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0324"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold; KEGG: ava:Ava_3804
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79107"
FT                   /db_xref="GOA:B2J5U1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U1"
FT                   /protein_id="ACC79107.1"
FT                   /translation="MISQEQPKPFISALGLDFGRKRIGVAGCDRTGLIATGITTIERTS
FT                   FEQDVEQIRQIVNEREVQILVMGLPYSMDGSIGFQARQVQKFTTRLSKALKLPVEYVDE
FT                   RLTSFQAEQLLIAENRSPSRHKGLIDRKAAALILQQWLDVKRASSRSSVAVIEY"
FT   gene            410622..411194
FT                   /locus_tag="Npun_F0325"
FT   CDS_pept        410622..411194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0325"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="KEGG: ava:Ava_3805 protein of unknown function
FT                   DUF1292"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79108"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="InterPro:IPR022203"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U2"
FT                   /protein_id="ACC79108.1"
FT                   /translation="MFSPPFPEENDNAHAGSITLTDEKGRSLECYVEHSLEVDGQEYVL
FT                   LLPVDSPVEIFSWEGDDEEEEAVLVEDDNIIEQIFATAQAVLSEQNLILKNTAYALTVA
FT                   GDLPPVEESELFTLEIEDEEADLDPEQLQLLASFYDEDQEYAIYTPLDPLLFFARITKT
FT                   GEPELLSPEEFRKVQPLLEEHLFNEVE"
FT   gene            411401..412027
FT                   /locus_tag="Npun_F0326"
FT   CDS_pept        411401..412027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ter:Tery_2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79109"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U3"
FT                   /protein_id="ACC79109.1"
FT                   /translation="MAYSDFTLSKFKKSFSIRIDEETDLCADIEPLQASDKLKNSLEET
FT                   TELALAINTEKARSEMIITPILLEVRRRGNYPISLFSGTDFNVDVENGLNGYCDFIISR
FT                   SREQLTINVPVVVIIEAKNENIKGELGQCAAAMLAAQLFNQQEGNEIRKIYGAVTTGDI
FT                   WKFLKLEENDIFIDLSNYYIKEIDKILGILSQNVQGDIPECSSTN"
FT   gene            412081..412620
FT                   /locus_tag="Npun_F0327"
FT   CDS_pept        412081..412620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0327"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   HAD superfamily (subfamily IIIA) phosphatase, TIGR01668;
FT                   KEGG: ava:Ava_3806 HAD-superfamily hydrolase subfamily
FT                   IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79110"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U4"
FT                   /protein_id="ACC79110.1"
FT                   /translation="MAWNNLLQPDLILEGSVLNLTPDIIQKYGLKGLVLDVDETLVPFT
FT                   VGMASPELREWVEQIRTCTALCLVSNNLSEARIGGIARSLNLPYYLGAAKPSRRKIRAA
FT                   VRTMDLPVHLVGMVGDRLFTDVIAGNRLGMFTILVEPIVHADAALRSHPVRNFEVWISE
FT                   ILGASITPKKSKIHKS"
FT   gene            412912..414015
FT                   /locus_tag="Npun_F0328"
FT   CDS_pept        412912..414015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0328"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: ava:Ava_3807 gamma-glutamyl kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79111"
FT                   /db_xref="GOA:B2J5U5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J5U5"
FT                   /protein_id="ACC79111.1"
FT                   /translation="MTKTIVVKIGTSSLTQAETGQLALSTIATLAETLCHLRSQGHRVI
FT                   LVSSGAVGVGCARLGLTERPRAIALKQAVAAVGQGRLIRIYDDLFTTLQQAIAQVLLTR
FT                   SDLVQRSRYLNAYNTFQELLGLGVIPIVNENDTVAIDELKFGDNDTLSALVASLIEADW
FT                   LFLLTDVDRLYSADPRSVPDARPIALVSSIKELAELQIGSQGSQWGTGGMVTKISAARI
FT                   AIAAGVRTVITQGRFPQNIEKIIQGELIGTHFEPQPEPTSARKRWIAYGLLPAGKLYLD
FT                   EGAIAAISLAGKSLLAAGIKLVEGEFDTQDAVQLCDSNGNEIARGLVNYNSNDLQKIRG
FT                   CHSREISTILGYAGAETVIHRDNLVLI"
FT   gene            complement(414298..415257)
FT                   /locus_tag="Npun_R0329"
FT   CDS_pept        complement(414298..415257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0329"
FT                   /product="ROK family protein"
FT                   /EC_number="2.7.1.60"
FT                   /note="PFAM: ROK family protein; KEGG: ava:Ava_4339 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79112"
FT                   /db_xref="GOA:B2J5U6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U6"
FT                   /protein_id="ACC79112.1"
FT                   /translation="MTLILALDFGGTKLAAALVNVGSRKWLRYERRLSPVGANASTDLE
FT                   IMRSLIYSLLEDAKPAAIGVSFGGPVDASTGTVRLSHHVAGWENIPLKGLLEEEFGVSV
FT                   GVDNDANVAALGEHRFGAGQGYDSLFYITVSTGVGGGWILNGQPWRGAGGMAGEIGHIV
FT                   VDPSGPVCLCGKRGCVERLASGPYMAQNVREILENEPQRRGGFRDGEILRGLAGDDLTL
FT                   LTGQLVSEAAAAGDDLAKEVLHKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGEDFWR
FT                   VVRQVARETALPEVDFEIVPAVLGDDAPLWGGVAIASM"
FT   gene            415369..415590
FT                   /locus_tag="Npun_F0330"
FT   CDS_pept        415369..415590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79113"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U7"
FT                   /protein_id="ACC79113.1"
FT                   /translation="MNTEQPDPLIDFSHAKEPPRSLDIDKAQEADPIEPEEVSGESKLN
FT                   PTPDDLNSEEQDPRIGGSQIISGNISAG"
FT   gene            complement(415595..416347)
FT                   /locus_tag="Npun_R0331"
FT   CDS_pept        complement(415595..416347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0331"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   rha:RHA1_ro03628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79114"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U8"
FT                   /protein_id="ACC79114.1"
FT                   /translation="MAIAYFYFHAELNHFLPRHHKQVKISHFFEEKASIKDMIESLGVP
FT                   HPEVDFINVNGKYVNFSYIVSDGDAINVYPISARSVIIPSISVFPEPLSIIHFVVDIHL
FT                   GKLATSLRLLGFDTLYRNDYEDEKLAQISSSQGRILLTRDKGLLMRSLVTHGYYVRNTN
FT                   PQEQIIEVLQRFDLFKLITPFKRCLRCNGLLEWVDKQSIIEQVPEKVRSQIDQFQRCQD
FT                   CDRIYWKGSHYERLQQFIDGVLNSQKGE"
FT   gene            416737..417051
FT                   /locus_tag="Npun_F0332"
FT   CDS_pept        416737..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79115"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5U9"
FT                   /protein_id="ACC79115.1"
FT                   /translation="MRIICNMDNLIDILKADRSEIFFNLYWLIPHRSLEIYFSKERQKT
FT                   RFLCIKTGLLTNYINNFSKTLNKYLIASNIFGCSIGYIDIASKLILGNSPSRYCVYVED
FT                   "
FT   gene            417360..418337
FT                   /locus_tag="Npun_F0333"
FT   CDS_pept        417360..418337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0333"
FT                   /product="Sucraseferredoxin family protein"
FT                   /note="PFAM: Sucraseferredoxin family protein; KEGG:
FT                   ava:Ava_4340 protein of unknown function DUF942,
FT                   thioredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79116"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR010350"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V0"
FT                   /protein_id="ACC79116.1"
FT                   /translation="MNTFFCSDDSRQVGEDVIGSATNYQTYILVECPLPWTSEALNSKW
FT                   VPQNLRILVEEVKRAKLPIRFLLIANDASHKVNHTTLLIYQKEDGLSNGYQKQEFKLAN
FT                   IEQVAGVVQKWIWGIDSNFEVETSTTRDILVCTHGSHDKCCARYGAPFYFHVTASNTDL
FT                   CLDNVRIWKSSHFGGHRFAPTIIDLPEGRYYGRLDQDSFRSILTRTGDIQCLHQVYRGW
FT                   GILPPVLQVLERELILYKGWDWFNYKVAGKILEQSLDNSTILAELSFEQPCGSLYTYQA
FT                   KLVKDETKTQQLKSSCNATRELVVTKYAVGSFWITSSKVMSYST"
FT   gene            complement(418501..420096)
FT                   /locus_tag="Npun_R0334"
FT   CDS_pept        complement(418501..420096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0334"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: helix-turn-helix domain protein; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein; KEGG:
FT                   ana:all2512 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79117"
FT                   /db_xref="GOA:B2J5V1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V1"
FT                   /protein_id="ACC79117.1"
FT                   /translation="MPYTIPNNSCVGCDNCRPQCPTGAIKIEDNEYWVDPGLCNNCEGY
FT                   YSEPQCVIACPTKSPIPWQAKKGRCKVEPRDSTSLDLFSNGKNNPFASAIAIWEACNVL
FT                   GQRTSLHWETDEDGYLCYSRQVNQGKGAIAFHIQDPFQVNDKATDIAAIEALDIRAACI
FT                   HLIFAGYATALEQPWEQEFAIDERQIEKYLGMEKRKDLSKAAKLALMKNLVQQACSLII
FT                   SIDWPQQGRINGFSVTNSRLWHLVDIQHHFQEDNHGCKYLIGLTFKVKAGLWAQYFLNK
FT                   QACKERTAFYQYGSLPKTLLTTVMSIWQQHEGAVRLMLWLLFKTKMGKEQRITIPTLLR
FT                   IAYGEEKVALASRQREERKRLLRTFESDLEILNHYGMKPLFDPVTYPPEIQPLWAKLID
FT                   LPEDPDEALEFWTNDGGSETRLTDTGPRGKWNLLMNARILAFELPPEWEQQISESEKKK
FT                   TRTAKAKKKTKATNDLLGEQILQARKNLNLSQRELAKLTGKSQSWIRDIENGRLKAKLE
FT                   DQLLLRKVLNMASS"
FT   gene            421151..421444
FT                   /locus_tag="Npun_F0335"
FT   CDS_pept        421151..421444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0335"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: ava:Ava_0445 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79118"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V2"
FT                   /protein_id="ACC79118.1"
FT                   /translation="MAQLTGLTFGGKAWTPKFAQEIDKDKCIGCGRCVKVCGYNVLGLK
FT                   ALNEEGEFVEDEDDEEIERKVMAVTSPENCIGCEACSRICPKNCYTHVAVNN"
FT   gene            421932..422921
FT                   /locus_tag="Npun_F0336"
FT   CDS_pept        421932..422921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0336"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome C
FT                   oxidase subunit II, transmembrane region; KEGG: ana:alr2514
FT                   cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79119"
FT                   /db_xref="GOA:B2J5V3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V3"
FT                   /protein_id="ACC79119.1"
FT                   /translation="MQQVPVSLWTLVAGIVVTAISIWIGQNHTLMPMQASLQAPLVDGF
FT                   FNVMFTIAIALFLVVEGTILIFLVKFRRRRGDDTDGLPIEGNVPLEIFWTAIPTVIVLG
FT                   LGIYSVDVFNQMGGFEPAGHPHSAAHVAHQSGTAIAATLSDSSEVTAAPAIAPTIGIGA
FT                   SPQTLNKPADLVVDVKGIQYAWLFNYPDSGITSGELHIPVGADVQLNLSAEDVIHSFWV
FT                   PNFRLKQDALPGIPTELRFVATKPGTYPVVCAELCGGYHGSMRTQVIVHTPEEYDSWRT
FT                   ENQIAQQQNLNQVVAVNPADLSTSEFLAPHTHDMGISAATLESVVIGH"
FT   gene            423077..424765
FT                   /locus_tag="Npun_F0337"
FT   CDS_pept        423077..424765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0337"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I; KEGG:
FT                   ana:alr2515 cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79120"
FT                   /db_xref="GOA:B2J5V4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V4"
FT                   /protein_id="ACC79120.1"
FT                   /translation="MTQVEFPRNTPPEGNKPKMVTGHTSHPKAWKWQDYFTFNVDHKVI
FT                   GIQYLVTAFVFYLIGGLMAIALRVELATPDADVLDPNLYNAFMTNHGTIMIFLWIVPSA
FT                   IGGFGNYLVPLMVGARDMAFPKLNAIAFWLNPPAGLLILGSFIFGGSQSGWTAYPPLSL
FT                   VTAPIAQTMWILAIVLVGTSSILGSLNFVITILMMKVPSMKWDQVPLFCWAILATSILA
FT                   LLSTPVLAAGLVLLLFDLNFGTSFFKPDAGGNVVIYQHLFWFYSHPAVYLMILPIFGIM
FT                   SEVIPVHSRKPIFGYKAIAYSSVAICVVGLFVWVHHMFTSGTPGWMRMFFTISTLIVAV
FT                   PTGVKIFAWVATLWGGKIRFTGAMLFAIGLLSMFVMGGLSGVTMGTAPFDVHVHDTYYV
FT                   VGHFHYVLFGGSVFGIYAGIYHWFPKMTGRMLNESLARIHFALTFIGTNLTFLPMHELG
FT                   LKGMPRRVAMYDPQFIDLNQICTFGSIVLGISVIPFAINMIYSWLKGPLAGDNPWQALT
FT                   LEWTTSSPPAIENWEVLPVVTHGPYDYGHGNSNEVQPSATPEASA"
FT   gene            425235..425834
FT                   /locus_tag="Npun_F0338"
FT   CDS_pept        425235..425834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0338"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit III; KEGG:
FT                   ava:Ava_0448 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79121"
FT                   /db_xref="GOA:B2J5V5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V5"
FT                   /protein_id="ACC79121.1"
FT                   /translation="MTIATTTSEEHGAGHEEHPDLRVWGLLTFLASESLMFGGFFATFL
FT                   FFKGITPVWPPEGSEVELLVPTINTIILVSSSFVIHFGDTAIKKNNVKGMQLWYAITAI
FT                   MGAIFLAGQVYEYSTLGYGLTTNVFANCFYIMTGFHGLHVFVGLLLILRALWRSRLPGE
FT                   YSATNHTFIEMTEIYWHFVDIIWIVLFTLVYVLTLF"
FT   gene            425922..426407
FT                   /locus_tag="Npun_F0339"
FT   CDS_pept        425922..426407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79122"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V6"
FT                   /protein_id="ACC79122.1"
FT                   /translation="MQLDANKFSWFQVPEDIKNLLILAAQNWENTSESEKYIQQALAQT
FT                   GENTDVLVAAYRFFYYKNNYSLALQTTIKLLDKIKELEKFPDDWEQLQAILVNRKEDPQ
FT                   IRLYLNAYAASGLVLAKLGEIEQAKQISTRVKQIDEKNDFGSGILLDILTRPAEEDD"
FT   gene            426607..427218
FT                   /locus_tag="Npun_F0340"
FT   CDS_pept        426607..427218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0340"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: ana:alr2518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79123"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V7"
FT                   /protein_id="ACC79123.1"
FT                   /translation="MKGRDWLLTGDGQHQACKSVRSWDLLRENYRLYRFLTEVEDVLNG
FT                   SDNETNCLPETRMLVRRLIVNSYWVQSQHLEPSPKTGNSVLLLYDELGFPLTVQTVTFA
FT                   PGTRSNIHNHGTWGIVAVLKGQEKNTFWRRTNSPEFQDKIEATGEVTLFPGDIISFTPD
FT                   AIHSVEAVGDEPTVTFNIYGETDPNERFEFDLVSHKARNF"
FT   gene            427275..427760
FT                   /locus_tag="Npun_F0341"
FT   CDS_pept        427275..427760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0341"
FT                   /product="nitrogenase-associated protein"
FT                   /note="TIGRFAM: nitrogenase-associated protein; PFAM:
FT                   arsenate reductase and related; KEGG: ana:alr2520
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79124"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V8"
FT                   /protein_id="ACC79124.1"
FT                   /translation="MARVIFYSKPGCKGGVKQKVLLTAAGHEVIPQNLLKEAWTAERLR
FT                   SFFGDRPVVEWFNLSAPKIKSGEVVPEKVDEQTALALMLKEPLLIRRPLLEVGDRREVG
FT                   FDVQKIDTWIGLQAVDESLQEISDKLLKQDLQNCSHGKDHNHGQGSQQHQKQGNCKH"
FT   gene            427968..433451
FT                   /locus_tag="Npun_F0342"
FT   CDS_pept        427968..433451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0342"
FT                   /product="multi-sensor signal transduction multi-kinase"
FT                   /note="PFAM: protein kinase; GAF domain protein;
FT                   ATP-binding region, ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: tyrosine protein kinase;
FT                   serine/threonine protein kinase; KEGG: ava:Ava_4489
FT                   serine/threonine protein kinase and signal transduction
FT                   histidine kinase (STHK) with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79125"
FT                   /db_xref="GOA:B2J5V9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5V9"
FT                   /protein_id="ACC79125.1"
FT                   /translation="MTATLSGYQLLETLHSGSKTIIYRGRRETDNASVIVKTLLCEHPL
FT                   LEDIARLRHEYQIIETLEIPGIVKAYELKNYQHGLALVLEDIPGCLLQELIATQTTTLI
FT                   TFLKVGINLAQILGELHAQQIIHKDIKPHNILIDPDSGEAKLIDFSISSRLDKENPTLS
FT                   NPNLLEGTLAYMSPEQTGRMNRAVDYRTDFYSLGVTLYEMLTGILPFQAVDPMELIHSH
FT                   IAKTPAAPCSETVCRILGDVPEAISAIILKLLAKTAEERYQSAWGLKADLEECLFQLQT
FT                   TGKIENFVPGRQDKSGHFLIPQTLYGRKAEVATLMAAFKRVAVGSSELMLVSGYSGIGK
FT                   TSVVNEVHKPIVGARGYFIAGKFDQFKRNIPYASLIQAFQSLIGQLLTESEAQIQVWKD
FT                   KLLTALGENGQVIIDVIPQVELIIGTVPPVTQLGAAESQNRFNRVFGQFIGVFTTQHHP
FT                   LVVFLDDLQWADSASLNLIELLMTDSERKYLLLVGAYRDNEVSPTHPLMLSLDKIQSSG
FT                   AVVDNIILAPLQLTDVEALISDTLNDTEASKPLAQLLFHKTGGNPFFLTQLLKTLHQED
FT                   LLTYDFQSGVWQWDIQHIQAIGLTDLNVVELTARNIRKLSLETQSVLKLAACIGNTFNL
FT                   DILAIVNEAYSLRTAAQLWSALQAGLILPLNQDYKIPLAFSQEDSGGFTLTDVKVDYKF
FT                   LHDRVQQAAYSLIPDEQKKATHLKIGQLLLQKTTPEERQENIFALVNQLNYGTDLLISE
FT                   TEKSQLAELNLIAGKRAKAATAHDSAIKYFQVGLQLLTEESWKCEYELTLALHSEAAEA
FT                   AFLSGDFAEMQRFVEIVQNCAKTLLDKIEVYEVLIQAYIGQNRLVEAVSTGLQVLKLLG
FT                   VEFPQEPNPSDIGQALGETAAILSGTLIEDLIDLPQMSDRYKLAAMRIMSSIFAPAYMA
FT                   APALVPLTVCKQVNLSVQYGNASVSGFAYANYGLLLCGVVGDIDSGYQFGQLALTLVSK
FT                   LNAQEIKAKTLLIVNIFIRPWKDHLRETLEPLVAVYSSGLETGDLEFAAYGLLMYSCFA
FT                   YFSGKELTVLEREMAINRDAIDKIKQETPLHYLETYSQATLNLLGKCENPCLLKGKACD
FT                   EQIKLPLHEQANDILGVAYIYWNKLLLSYWFENYSEAIENTALAEKYLNVVVGLPIVPL
FT                   FHFYDSLVRLAVYPDRQASEQHAIIDRVQANQEKMQKWAHHAPTNHLHKFYLVEAERHR
FT                   VLGEKIEAIEMYDKAIALAKQNEYINEEALAHELAAKFYWSWGKEAIAQTYMTNAYYAY
FT                   SHWGAKAKVKDLEARYPQLIVQSNTEKPETNYLQTIQTSSTTSGGAEILDLMAVMKASQ
FT                   VLSEEMVLSRLLEKLMKNVIENAGAQQGYFIVKHENQWMLEAAGMVEGKNVNVVVKSQD
FT                   ETDSPLLPIALFNYVERTRENLVLNDAVKDSRFATDACIITYQSKSILCLPLIHSGKFT
FT                   GLIYLENNLIPGAFISERVNVLSLLTAQISIAIENARLYTNLQVYSQQLEANNEALQAS
FT                   ETREREKAEQLEKSFHKLQQTQAQLVQTEKMSSLGQLVAGVAHEINNPVNFIFGNLTHA
FT                   NSYTQEVLGLLELYQKHYPSPHPEIQEQAEDIDLEFVLEDLPKLLSSMWVGADRIRQIV
FT                   ASLRTFSRMDEAEIKAVNIHEGIDSTMMILQHRLKAKSDRVGIELIKHYGNLPQVECYA
FT                   GQLNQVFMNVLSNAIDALEDTLAKNQGQIITPTITIHTEQIDAHQVEIRIADNGLGMPE
FT                   SVRQRLFDPFFTTKPVGKGTGMGLSISYQIVTEKHGGSLSCTSEPGEGAEFQIRIPICQ
FT                   EVNPFEELKMKN"
FT   gene            complement(433576..434535)
FT                   /locus_tag="Npun_R0343"
FT   CDS_pept        complement(433576..434535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0343"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: cysteine synthases; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: ava:Ava_0452 cysteine synthase K/M/A"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79126"
FT                   /db_xref="GOA:B2J5W0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W0"
FT                   /protein_id="ACC79126.1"
FT                   /translation="MRIAQDITELIGRTPLVQLNKIPQAEGVVARIVVKLEGMNPAASV
FT                   KDRIGLSMVLSAEAAGSIQPGKTILVEPTSGNTGIALAMVAAARGYRLILTMPETMSQE
FT                   RRAMLRAYGASLELTPGAEGMRGAIRKAEEIVANTPDAFMLQQFRNPANPKVHQETTAE
FT                   EIWTDTDGEVDIVIAGVGTGGTITGIAEVLKGRKKTFKAIAVEPSNSPVLSGGEAGPHR
FT                   IQGIGAGFIPDVLRLELVDEVIRVSDEQAIAYGRRLAKEEGLLSGISSGAALCAAIQVG
FT                   KRPENAGRLIVMIQPSFGERYLSTPMFQDLSLETAGVR"
FT   gene            435530..435952
FT                   /locus_tag="Npun_F0344"
FT   CDS_pept        435530..435952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79127"
FT                   /db_xref="GOA:B2J5W1"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W1"
FT                   /protein_id="ACC79127.1"
FT                   /translation="MKAKLLNVLTVCVVILAVLSPELVVFGIVWERHLDLVKSQNLAYE
FT                   VNKTTKNAPDLAPQTEVTHSPQTSIQSSDRNVINQMLTVAEQYKFAAILQWFFLLTPIC
FT                   VGLGILFYDRYLVHRAAVLKEQVEMLERLWQQSIEQ"
FT   gene            435997..436278
FT                   /locus_tag="Npun_F0345"
FT   CDS_pept        435997..436278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:asr2523 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79128"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W2"
FT                   /protein_id="ACC79128.1"
FT                   /translation="MSEQRQQLYFNLIDELLKCPNGQEPEILESKPELIDSGFVETMLQ
FT                   VATMFAHEGNQDGAKFLFFVARELAKELGLYPEVPNTEVENPEVANKE"
FT   gene            436281..436592
FT                   /locus_tag="Npun_F0346"
FT   CDS_pept        436281..436592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79129"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W3"
FT                   /protein_id="ACC79129.1"
FT                   /translation="MLLTSTDAGQIALELLMADWNISEENREWFTIFNSRLIGESWYTV
FT                   ELGVEGFPDRWFIQVYDTGACDPNYTFISPIRGSEGFTDFVNVPDIIAEVLVCERNAR"
FT   gene            436975..437337
FT                   /locus_tag="Npun_F0347"
FT   CDS_pept        436975..437337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79130"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W4"
FT                   /protein_id="ACC79130.1"
FT                   /translation="MDATEISVPMIAEDILAKEFTRVLNHYYPKVGELLDGCYVKVITC
FT                   FWGRPARRLQYIGIYCSDEMISYVQAHKEILREVADNMGLVQVVCMNAKRLLRDPMSKV
FT                   KHNNPRLWLELQWVAN"
FT   gene            437453..438460
FT                   /locus_tag="Npun_F0348"
FT   CDS_pept        437453..438460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0348"
FT                   /product="luciferase family protein"
FT                   /EC_number="1.14.14.3"
FT                   /note="PFAM: luciferase family protein; KEGG: ava:Ava_0457
FT                   luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79131"
FT                   /db_xref="GOA:B2J5W5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W5"
FT                   /protein_id="ACC79131.1"
FT                   /translation="MKTGIFCNYDNHHQDARRAISEQVALIKQAESLGFESAWVSEHHF
FT                   SESNLSPSMLLLMAHLAGLTSTIQLGTAAVLLPFHNPIRVAEDIATLDNLCNGRLLFGV
FT                   AKGGPFPQQNKHFATLPSEARPKMLEAIALVQKLLYETDVSFNGKYYQCDRLTIYPKPL
FT                   QSQVPVYVATGGDDGIELAAKHSFSLMGGPPFSLHRLKDTVAKYRALNSSGAENFVLAR
FT                   FFYVGKTFDEAVSEALPFVRQFSQKMKANTAQVLQNSANPNQKPFDRTNICFDEDYLIE
FT                   NSIIGDVETCRDKIKKFQDELNLGTLALKPSSADLQKNLDSLTRYNQEVRNYVF"
FT   gene            438450..438824
FT                   /locus_tag="Npun_F0349"
FT   CDS_pept        438450..438824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79132"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W6"
FT                   /protein_id="ACC79132.1"
FT                   /translation="MSSKLYLLPPDDLPPTGVTKQDGMLQMELEQSTGRCFYLACDRIT
FT                   RVLLSNCQWYLTTNASILTLIVDCPDLVSYWHIVSNIAQLGNRLERFASNGKIRVYPPF
FT                   GKGMPFEISVNEISAYRDWL"
FT   gene            complement(438932..439603)
FT                   /locus_tag="Npun_R0350"
FT   CDS_pept        complement(438932..439603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79133"
FT                   /db_xref="GOA:B2J5W7"
FT                   /db_xref="InterPro:IPR007715"
FT                   /db_xref="PDB:3MSQ"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W7"
FT                   /protein_id="ACC79133.1"
FT                   /translation="MENVITYNNDKGLLAYIQFLASSAQKIGDGNTDRVFDFEDALDQT
FT                   QMAQLAVDELKKIPEVNALFSERWLPAPFNLDDLAKLPEGTLGHVYAREMKARGFDPYF
FT                   YKKVPVVDDISYLKMLWRSTHDIYHVVAGFDTNVFGEIGLQAFFLAQTPIPISVMLLSF
FT                   GMVMISLYQPTNFKALMTEISRGYRVGSHTPGKLIAQKWDQLWDVQVSEIRERLGVNSI
FT                   L"
FT   gene            complement(439913..441496)
FT                   /locus_tag="Npun_R0351"
FT   CDS_pept        complement(439913..441496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0351"
FT                   /product="alpha amylase, catalytic region"
FT                   /EC_number="3.2.1.133"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: gvi:gll1595
FT                   alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79134"
FT                   /db_xref="GOA:B2J5W8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W8"
FT                   /protein_id="ACC79134.1"
FT                   /translation="MAKVEELTPQQLSETDLKPRGRVYPSPISWRDQFLYQLVLDRFSD
FT                   DNENQRELFDHTNLAKFQVKDKAGWMAAGTKFVGGTLRGIKSKLDYLQRLGVTTLWINP
FT                   PWQQRSELEAYHSDRIQEFLDIDPHFGTRQDLRDLIDAAHDRRMYVILDVIYNQNADNW
FT                   FHRNDVIAALARVYQYWIALSDCDGLRIDSLKHVSPEDSRKFCTAIREYAESIDKDNFL
FT                   LTGEITSGSMAGAYIDIIARNFSAVLDIAQTPNELAAFAKGLVHPKQFFDLYSENNLAG
FT                   EYRQIGTYHVSILDDYEMSFRTNKQRFAAYSNVPHLYEQVAHAVGVQLTMPGIPAIYYG
FT                   TEQAFDGNEGYHDYSIEGRKFAEDRYIKEAMFGGAFGAFQTADCHFFDIDHPTYLRIAA
FT                   IARIRNSHDKIGKALRRGHHYLRETSFFNSPFSIPGQGELVAWSQTLFDTEVLMVLNTN
FT                   GLENRGAEVTVDTYMHPQDSTMTFLYKSDWSDSYLRHPPRDQTVAVQHHNDRRATVRID
FT                   LPPSGMAILA"
FT   gene            complement(441759..443609)
FT                   /locus_tag="Npun_R0352"
FT   CDS_pept        complement(441759..443609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0352"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: ter:Tery_4585 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79135"
FT                   /db_xref="GOA:B2J5W9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5W9"
FT                   /protein_id="ACC79135.1"
FT                   /translation="MIQLLINRIWQSLLRLLLQRITLVLTLMLCVAIAIAISNMSRLSS
FT                   SLIESQAVQNAALNIQSLTQAFDLYSAAAADRAKLVPGITVTHAYLNTKGAIPLPSTFA
FT                   IELGEQISEKNAEMSVRLYSNYPYPWRTKGGAKDEFERDALNFLKENPRQKFYRLEKKN
FT                   GNTTLRYAQASLMKASCVTCHNTDATSPKKNWEVGDVAGAWEISQSLDNLVTKTNQSLQ
FT                   GTFAMLGGMSVLGLSGLTLVVGKLRENSRNLEHRVKERTTDLAEANTELEKRNQLIRQV
FT                   FGRYLSDTVVANLLESPEGLKLGGERRKITILTSDLRGFTALSERFPPEEVIHILNLYL
FT                   EYMADVINHYQGTIDEFMGDGILVLFGAPIAKEDDALRAVTCACAMQLAMGGVNEKMKT
FT                   LGWPPLEMGIGINTGEVIVGNIGSEKRTKYGIVGSQVNLTYRIESYTSGGQILISEQTF
FT                   KEVGSSIKIIGQKQVQPKGLSQTITIYEVYGVGGRYNLYLPKEEELFLPVPQEIPLLYT
FT                   ILDDKQMGNPVFYGRLVKLSAKGAELQVDIPNEVPPKLTNLKINLFISKNSAQVSEDIY
FT                   AKVLEKPTIRGNFYINFTSVPPSLIAQFDNLYKIISQKSN"
FT   gene            443918..447574
FT                   /locus_tag="Npun_F0353"
FT   CDS_pept        443918..447574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0353"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: gvi:gll4356
FT                   WD-repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79136"
FT                   /db_xref="GOA:B2J5X0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X0"
FT                   /protein_id="ACC79136.1"
FT                   /translation="MDIDQALAFTDALVFAKSRIHLSDLQQAMLRESWSLERQSYDRIA
FT                   DIYGYSPTYLKHDVGPKLWKLLSEVLGEKVNKTSFRTAIERATAQSNQYIEEKTRVKFT
FT                   DNLLVAEAQTSYQDWGDAIDVDFFYGRQAELAQLQQWILVDQCRLVAVSGMGGIGKTSL
FT                   SIKLAQQLQSDFKWVIWRSLRNAPPVQEILTELLKLLSNQQEIDYPETVEGKISRLLHY
FT                   LRSQRCLVIFDNIETILQHNEKSKSSYIKGYEYYGEIFRQIGEIRHQSCLVLTSRDQPP
FT                   EVGLLEGASLPVRAFQLGGLKKTEAQELLHLKGNFQGSTEEWNRLVEGYAGNPLALKII
FT                   ATTIQNLFDGSISDFLNQQAFVFGNIRNLIGQQFERLSESEKTVIYWLAIYRDPASFSE
FT                   LRSDIFPRRSPQELIDILESLEQRSLIEKTKPTLIEKHQTQFSLQPVVMEYATEKLVAQ
FT                   VCQEILAGLEANADQKILLFKTHALLKAQAKDYVRETQVRFILKPILERLLLDRLLIEV
FT                   SEQLAIENLLTQCLTKLRGTSSLKTGYAGGNILNLLCQLQSTLTNYNFSNLTIWQAYLQ
FT                   DVNLHNVNFESSDLSQCVFAETFGMVFAGIAFSPDGTLLATGDAEGELRLWEVATGKLV
FT                   VNFAGHLGWVWSLAFSPDGQLLASCSSDKTIRLWDVNTGKCLRTLSGHTSSIWSVAFSA
FT                   DGQMLASGGDEPTIRLWNVNTGDCHKIFSGHTDRILSLSFSSDGQTLASGSADFTIRLW
FT                   KISGECDRILEGHSDRIWSISFSPDGQTLVSGSADFTIRLWEVSTGNCFNILQEHSDRV
FT                   RSLAFSPNAQMLVSASDDKTVRIWEASTGECLNILPGHTNSIFSVAFNVDGRTIASGST
FT                   DQTVKLWDVNTGRCFKTLKGYSNSVFSVAFNLDGQTLASGSTDQTVRLWDVNTGTCLKK
FT                   FAGHSGWVTSVAFHPDGDLLASSSADRTIRLWSVSTGQCLQILKDHVNWVQSVAFSPDR
FT                   QILASGSDDQTIRLWSVSTGKCLNILQGHSSWIWCVTFSPNGEIVASSSEDQTIRLWSR
FT                   STGECLQILEGHTSRVQAIAFSPDGQILSSAEDETVRLWSVDTGECLNIFQGHSNSVWS
FT                   VAFSPEGDILASSSLDQTVRIWDRHTGVCLKVLPVLPHAMRSAIAFGKSTEHYAIASGS
FT                   QNGTIQIWDAQTGECLKILNPDRPYQGSNITGVTGITTAQKDVLKALGAFEI"
FT   gene            448136..451837
FT                   /locus_tag="Npun_F0354"
FT   CDS_pept        448136..451837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0354"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: ana:all2379 two-component hybrid sensor and
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: CBS domain
FT                   containing protein; response regulator receiver;
FT                   ATP-binding region, ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79137"
FT                   /db_xref="GOA:B2J5X1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X1"
FT                   /protein_id="ACC79137.1"
FT                   /translation="MRSLSPVDLPTLEQIVECSPLIVLPDTPVIDVIALMNRVNSSIVE
FT                   SKFDFSSYVLVVEETNLIGILTLRDVIRLTGMGKDLSSVKISEVMTQPVISLGLAQAQN
FT                   ALTALSFMRQHCIRHLPVVDDLGQLVGLITQDRIRQVIQPVHLLKLQCVTEVMVTEVIH
FT                   ALPTTSVLELSQIMSDRQISCVVIVAQQKAKLIPVGMITEKDIIKFHLQGLDIAQTQAQ
FT                   DVMSTPVLSITPTESLWTVHQLMQERKVRRLTVVGEQSELQGLVTQTNLLQVLDPLEID
FT                   SIIQVLQAKVEEQTVKLRQCNQQLEQEVEQHRQAQQELELRVAERTAELLQANVRLKRE
FT                   IEERKQTEIALQQREHQWKALFDRALDAIAIADDEGRYVEVNPAACKLFGVSKEELLGS
FT                   TIADFAAPEFDFTQAWQQFYEQGQMLGEFNIYCPDGTVRETEFAAVANFIPHRHLSILR
FT                   DVSDRQAMLRARKQTEETLRESEQRLQLALSVGNIGTWEWNLRTNQVIWSESLFTLFGL
FT                   TPDTFDVSYENFLNLIVHPEDRELLHQSVLRAIDQQVPHNLEFRFIYSDGTVGWSVCKG
FT                   QVLYDDTTNKPLQMIGVNIDITERKQSELEIRKFVSLADNSTEFIGMCDMNFVPFYLNP
FT                   AGMQLVGLNDTQQYSETPVREFFFPEDRDFIINEFFPRVLREGRAEVEIRFRHFQTGEA
FT                   LWMVYSVSCVKDMNDQLIGLAAVSRNITDRKLAKQKIAEQAALIDIATDAIFVRDLENR
FT                   ILFWSPGAEKLYGWTAQESMGKLVHELFNVESLSQLAAGFKTTLEQGYWQGELEKTTKT
FT                   GRKIIVASRWTLVQNQFGQSQSILSVNTDITEKKQLEQQFYRAQRLESVGTLASGIAHD
FT                   LNNVFAPIIMIAELLPLRYKNVDLQTQELFKTLENSSQRGANLVKQILTFTRGTEGKRI
FT                   LLQPGHLLQELVKVIKQTFPKSIEIVNDIPINTLWMVQADPTQLEQVFMNLAVNARDAM
FT                   PNDGMLTINAENRMIDETNARMHLDAKAGGYMVVTVSDTGTGIPPEFLERIFDPFFTTK
FT                   EVGKGTGLGLSTVLGIVKNHGGFVEVSTQVGKGTRFQVFLPRGEGKATETITKAELPEG
FT                   NGELILVVDDEDLVKQTNQGTLEDYNYKTLVANDGIEAIALYAQYKERISAVLLDMSMP
FT                   NMDGLTTISILRTFNPNIKIIATSGLPANEQKAIAIGAKKFLSKPYTATDLLTTLSAVI
FT                   GHPGEPQS"
FT   gene            complement(452026..452172)
FT                   /pseudo
FT                   /locus_tag="Npun_R0355"
FT   gene            452588..455518
FT                   /locus_tag="Npun_F0356"
FT   CDS_pept        452588..455518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0356"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   ana:alr1403 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79138"
FT                   /db_xref="GOA:B2J5X2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X2"
FT                   /protein_id="ACC79138.1"
FT                   /translation="MGTYTGDNSNNTFIADDDGQPWLLSGKGGDDYLAGKSQNDRIYGD
FT                   EGNDNLLGGAGNDILDGGTGNDNLYGGIGFDSLYGGDGNDIISDTDGIVDGGAGTDTLV
FT                   ADYSQLSNGAGIDVAYQGQNAIFSRFTGNPVLNYSNIERFEITGTQYADVLRGGTGNDI
FT                   FNGGAGDDALTGGAGYDTLNGGDGNDIISDTDGIVDGGAGTDTLVADYSQLNNGAGIDV
FT                   AYLGQNAIFSRFTGNPVLNYSNIERFEITGTQYTDVLRGTAGNDILNGGAGDDVLIGSA
FT                   GSDTLNGGAGTDTLVSDYSQLNNGAGVDAGFNGQNAIVSRLNNSTLLNFSNIERFELTG
FT                   TQYADVLRGGTGNDILNGGAGDDALTGGAGYDTLNGGDGNDRITDTDGIVDGGAGTDTL
FT                   VADYSQFNNGAGVEVAYLNQNAIFSRFTGNPVLNYSNIERFEITGTQYTDVLRGNAGND
FT                   ILNGGAGDDVLIGSAGYDTLNGGDGNDIISDTDGIVDGGAGTDTLIADYSQLNTATPVD
FT                   VGYLGQNAIFSRISGNPVLSFSNIERFEITGSQYADALRGAAGNDILNGGAGDDALIGG
FT                   AGYDTLNGGDGNDRITDTDGIVNGGAGTDTLVADYSQFNNGAGVEVAYQGQNAIFSRFT
FT                   GNPVLNYSNIERFEITGTQYTDVLRGAAGNDILNGGAGDDVLIGGAGYDTLNGGDGNDR
FT                   ITDIDGIVDGGAGTDTLVADYSQLNNGTPVDVGYQSQNAIFSRVSGNPVLSYSNIERFE
FT                   LTGSQYADVLRGAAGNDILNGGAGDDALIGGAGYDTLNGGDGNDRITDTDAIVDGGTGT
FT                   DTLVADYSQFSNGAGVDVAYQGQNAIFSRFTGNPVLSYSNIERFEITGSQYADVLRGTA
FT                   GNDILNGGAGNDILVGGAGNDILTGGIGADQFVFNSKLEGLDVIKDFSRVEGDKIQISK
FT                   IGFGITDFSGFSYNDATGALLFQGTQFATLENKPANFAVSLDIQLI"
FT   gene            complement(455679..456506)
FT                   /locus_tag="Npun_R0357"
FT   CDS_pept        complement(455679..456506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0357"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K; KEGG: ana:alr0700
FT                   hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79139"
FT                   /db_xref="GOA:Q9EYH2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EYH2"
FT                   /protein_id="ACC79139.1"
FT                   /translation="MCVTCGCSDDGEIKITNLETDEAEHNHTHTLPDGTIITHSHGHDT
FT                   HIKAPQIHAKIHNTTISLEQDILAKNNLLAAQNRGWFKGRNILALNLMSSPGAGKTTLL
FT                   TQTINDLKNQLSISVIEGDQETANDAKKIKETGSKVIQINTGTGCHLDASMIDRGLQQL
FT                   NPPLNSVVMIENVGNLVCPALFDLGEQAKVVILSVTEGEDKPIKYPHIFRASDVMIITK
FT                   IDLLPYVNFDVQKCIVYAVEVNPKIQIFQVSATTGVGLDNWYKWVSESLLSKC"
FT   gene            complement(456497..456838)
FT                   /locus_tag="Npun_R0358"
FT   CDS_pept        complement(456497..456838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0358"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis, HypA; KEGG:
FT                   ava:Ava_4607 hydrogenase expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79140"
FT                   /db_xref="GOA:Q9EYH3"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EYH3"
FT                   /protein_id="ACC79140.1"
FT                   /translation="MHEFGITQNIVAIVTEHAKGAKVQRVLLEIGKLSAIMPDAIRFCF
FT                   DICTQGTVLEGATLEILEIPGLGRCRQCGGEIYLDKPFGICNCGSVQLDLITGEELKIK
FT                   EIEIEELCV"
FT   gene            complement(456859..457962)
FT                   /locus_tag="Npun_R0359"
FT   CDS_pept        complement(456859..457962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0359"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ava:Ava_4606
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79141"
FT                   /db_xref="GOA:B2J5X5"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X5"
FT                   /protein_id="ACC79141.1"
FT                   /translation="MNISPTNSAQNSLFQKMEQVRRRQGKVRDTHITLAHGSGGKAMHD
FT                   LIDDIFVSNFDNPILSQLEDQASFDLANLIQQGDRLAFTTDSYVVDPLFFPGSDIGELA
FT                   INGTVNDLAVSGAKPLYLTCSVILEEGLPVEILRRVAASMNAAAKNAGIKIVTGDTKVV
FT                   HRGAADKLFINTAGIGVIPRGVNISAHNIKPGDAVIINGEIGNHGTAILIARGELALET
FT                   NIESDCQPLHSLVETILHICPQVHAMRDATRGGLATVLNEFALSSNVGIRLFEESIPVR
FT                   EEVNGVCEILGLDPLYLANEGKLVVLVSKENADNVLSTMKSHPAGKDACIIGEVISSPP
FT                   GIVLLKTVFGAERIVDMLVGDQLPRIC"
FT   gene            complement(458008..459246)
FT                   /locus_tag="Npun_R0360"
FT   CDS_pept        complement(458008..459246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0360"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypD; PFAM: hydrogenase formation HypD protein; KEGG:
FT                   ana:alr0696 hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79142"
FT                   /db_xref="GOA:B2J5X6"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X6"
FT                   /protein_id="ACC79142.1"
FT                   /translation="MRFVKKNSLPQSEINYSPVPMKYVDEFREPEKAEALCREITKLSH
FT                   QLEKPIKIMEVCGGHTHSIFKYGIEEILPQTIELIHGPGCPVCVMPKGRLDDAIAISQN
FT                   HNVIFATFGDAMRVPGSKTSLLQARAQGADIRMVYSPLDSLQIAKDHPDREVVFFALGF
FT                   ETTAPSTAFTIVQAAAEEIHNFSMFSNHVLVIPALKALLDNPDLQLDGFVGPGHVSMVI
FT                   GSDPYQFISQQYNKPIVVSGFEPLDILQSIWMLLQQIVENRCEVENQYNRIVQKSGNTV
FT                   ALQAINKVFAVRDSFDWRGLGDIPYSGLKIKPEYAQFDAELKFTIPNLKVADHKACKCG
FT                   EILKGVLKPWECKVFGTACTPETPIGTCMVSSEGACAAYYKYGRLSTIAKRTITQKPKI
FT                   TQEPLPACGFSLD"
FT   gene            complement(459376..459636)
FT                   /locus_tag="Npun_R0361"
FT   CDS_pept        complement(459376..459636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0361"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: ava:Ava_4603 hydrogenase expression/formation protein
FT                   (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79143"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X7"
FT                   /protein_id="ACC79143.1"
FT                   /translation="MCLGIPGQIIEITNVNHKLALVNIGGVKREVNIACIVDEQHPPEA
FT                   CIGDWVLVHVGFAMNRINEQEAAETLQLLQELAAAQAGINT"
FT   gene            complement(459718..462063)
FT                   /locus_tag="Npun_R0362"
FT   CDS_pept        complement(459718..462063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0362"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein; KEGG: ana:alr0694
FT                   hydrogenase maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79144"
FT                   /db_xref="GOA:B2J5X8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X8"
FT                   /protein_id="ACC79144.1"
FT                   /translation="MATEEIRVRGTVQGVGFRPTVYRLAKACGLYGDVCNDGQGVLIRI
FT                   SGSEEALTEFVARLQTECPPLAKINQLTRIPYEGEFNFNNFVISNSVNNAIKTEIVPDA
FT                   ATCPQCQQEIFDPFSRFYRYPFTNCTHCGPRLSIIRAIPYDRCNTSMSAFVICPECAKE
FT                   YHDVENRRFHAQPVACHVCGPTAWLERADGKAVTASMFSMLDDVDAVCTLLQKGEIVAI
FT                   KGLSGIHLACDATQETVVQKLRQRKKRYHKPFALMARDIEIIEQYCTVNAKEKELLTSS
FT                   AAPIVLLQAISKKLVAPSVASGQNTLGFMLPYTPLHHLILRRMNRPIVLTSGNLADEPQ
FT                   CIDNDEAREKLGTIADYFLFHNREIINRVDDSVVIIGDKVQTIRRARGYAPASISLPPG
FT                   FDNVPQILAMGSELKNTFCLLREGEAILSQHLGDLENAAAFNAYQETLNLYLNLFEHTP
FT                   EVIAIDKHPEYLSSKLGKELADTNRIPIHQIQHHHAHIAACMAENGIPLTSPPVLGIAL
FT                   DGLGYGDDSTLWGGEFLLADYRKFQRLATFKPVPMIGAEQAIYQPWRNTYAQLIAANLW
FT                   DDCQQQYADLEIVKLLNKKPLKLLNQLIEKKINSPLASSVGRLFDAVAAAIGICPEECS
FT                   YEGQTAIAMEAIVDVSSLNNDKEALIYPFSFSFSDSIYCIDSRPMWQALLYDLQQQIPQ
FT                   PVIAAKFHKGLANAIVEMVKRLRQENPIHQVALTGGVFQNCILLQQVSKQLETLGIKVL
FT                   THSLVPANDGGLSLGQAVIAAAKLIHKY"
FT   gene            complement(462216..463430)
FT                   /locus_tag="Npun_R0363"
FT   CDS_pept        complement(462216..463430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0363"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   ava:Ava_4601 NHL repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79145"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5X9"
FT                   /protein_id="ACC79145.1"
FT                   /translation="MDIPIIINPISQLPLEATENTQYLPLLSQGAEVILGNIIELEQLV
FT                   IPVVPNATTMFGPRGACLLSETGPLWVSDTGHHRLLGWKNLPTRDSQPADWVIGQPDFY
FT                   HEGQNAKTTPGKATLSVPTGICACGEGLAVADAWNHRVLIWKNLPEDNNVPADLVLGQV
FT                   NFTDNKPNRGNQQASASTMHWPYSIFYHQGRLFIADTGNRRLLIWHQLPTENGQPADLV
FT                   LGQPDMISRNENGGDSPTAASMRWCHDIAFWGENLVVSDAGNHRVMIWQGMPTENNASC
FT                   AVVLGQKSFDFVEMNQGVYYPSASSLSMPYGVAVAGDWLVVADTANSRLLGWKKPESIL
FT                   SLQGVMADGLAGQINFQSKGENRNFGLPKRDSLNWCYGIKICGNTAVIADSGNNRILLW
FT                   QFNNL"
FT   gene            complement(464061..464906)
FT                   /locus_tag="Npun_R0364"
FT   CDS_pept        complement(464061..464906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0364"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; Rieske
FT                   [2Fe-2S] domain protein; KEGG: ana:alr0692 similar to NifU
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79146"
FT                   /db_xref="GOA:B2J5Y0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y0"
FT                   /protein_id="ACC79146.1"
FT                   /translation="MTNLEELIQEINRFEAIISEWDESQRCVAVGLKRAIEALHKAALT
FT                   NLIKNLKQESMPALRHAVADELVYAVLLYHELVKPPKPPLAQRIETALEEVRPGLKSHD
FT                   GDVELVAIKSPDTVEVRLIGTCSSCPASTLTLSQGVEQAIKNHCPEITKVVAVNNSPAV
FT                   NNANSGLISPFSSKITCTWMKVATLDEVPEFSVVVVQLAGTSLILHRQGVTVKCYRNAC
FT                   THLGSPLEKGKVENGIITCPAHGFQYKLETGKCLTVPDVSLQSYPVKVKDDKVFVKLQK
FT                   "
FT   gene            complement(464963..465187)
FT                   /locus_tag="Npun_R0365"
FT   CDS_pept        complement(464963..465187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr0690 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79147"
FT                   /db_xref="GOA:B2J5Y1"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y1"
FT                   /protein_id="ACC79147.1"
FT                   /translation="MLELGWLSAKLFFKGKLIRNPIFFVTQTTIGIAIGFLLLVLLAQA
FT                   PIPFYLPIILSSLVTGMIMPFLFKDFKTK"
FT   gene            complement(465196..465462)
FT                   /locus_tag="Npun_R0366"
FT   CDS_pept        complement(465196..465462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79148"
FT                   /db_xref="GOA:B2J5Y2"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y2"
FT                   /protein_id="ACC79148.1"
FT                   /translation="MREILTTPNLINFLTSLADGDLNIATELVWLIIATALAMVGGAIG
FT                   GMLLAGKDIGYQLSAMLGALFAPAGVIPAIFLGLIALNFLTNY"
FT   gene            complement(465521..466552)
FT                   /locus_tag="Npun_R0367"
FT   CDS_pept        complement(465521..466552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79149"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y3"
FT                   /protein_id="ACC79149.1"
FT                   /translation="MCLVHSWVLDSIPNWLEYGRVMTPSITDSAVKAAIAAVASESATA
FT                   EEKIQMLIEIAQGFQKKPKAAQDLRNAVGLYYRAYEMCGEEYPLLKARAKVGMAGTLQA
FT                   IPDADYQLLMQAKVGYEEALPILQQLATPQEVAETQMNFGLVLQSLVPFNLARITDSIQ
FT                   AYHEALRVFTWEDYPQEYAILYNNIAIAYLSMPLASEREYLRQGLAVQSFEVALKHINL
FT                   IDHPREYAMLQNNLGNALQYLVSSHPVENNLRAIAAYDEALKVRNPKDTPLEYANTISN
FT                   KANALFNLPDDPEKPEAGNPQNLLQARIYYQSALEIFTEYQQIAQAEVVVQALQDVEAE
FT                   MKG"
FT   gene            467305..468267
FT                   /locus_tag="Npun_F0368"
FT   CDS_pept        467305..468267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0368"
FT                   /product="Ni Fe-hydrogenase I small subunit, HupS"
FT                   /EC_number="1.12.99.6"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit; KEGG: ava:Ava_4596 NADH ubiquinone oxidoreductase,
FT                   20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79150"
FT                   /db_xref="GOA:O68306"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:O68306"
FT                   /protein_id="ACC79150.1"
FT                   /translation="MTNVLWLQGGACSGNTMSFLNAEEPTVCDLIADFGINILWHPSLG
FT                   LELGNDLQILLRNCISGTIPLDILVFEGSVVNAPNGTGEWNRFADRAMKDWLADLAKVA
FT                   KFIVAVGDCATWGGIPAMSPNPSESEGLQFLKRQEGGFLGKDFVSQAGLPVINIPGCPA
FT                   HPDWITQILVAIATGRIADIAFDELNRPQTFFNTYTQTGCTRNVHFAYKASTAEFGQRK
FT                   GCLFYDLGCRGPMTHSSCNRILWNRVSSKTRAGMPCLGCTEPEFPFFDLKPGTVFKTQT
FT                   VMGVPKELPPGVNKKDYALLTMVAKDAAPPWAEEDFFTV"
FT   gene            468460..470055
FT                   /locus_tag="Npun_F0369"
FT   CDS_pept        468460..470055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0369"
FT                   /product="nickel-dependent hydrogenase, large subunit,
FT                   HupL"
FT                   /EC_number="1.12.5.1"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: ava:Ava_4595 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79151"
FT                   /db_xref="GOA:B2J5Y5"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y5"
FT                   /protein_id="ACC79151.1"
FT                   /translation="MTIQSLDISPVGRVEGDLDVRVDIEHGRVVNAWTHAELFRGFEVI
FT                   LRGKDPQAGLIVTPRICGICGGSHLTSASWALDTAWETEVPRNAILARNLGQIVETIQS
FT                   IPRYFYGLFAIDLTNKKYRNSRHYEEAVRRFAAFTGKSYELGITISAKPVEIYALLGGQ
FT                   WPHSSYMVPGGVMCAPTLTDITRAWAILEYFRTNWLEPVWLGCSLERYEQIQTYDDFRD
FT                   WLDEDRNHRDSDLGFYWRMGLDIGLDRYGAGVGKYVTWGYLAHEDKYQKPTIEGRNAAM
FT                   IMKSGVYDSFADTHVLMDQSFTRENTTHSWYDEGTEDIHPSDRTTKPTAINTKDFDNAY
FT                   SWSSAVLHKDFGRLETGPLARQLVAGGQHGESWQHYDGFILDVFKQMGGPSIHVRQLAR
FT                   LHEIVKLYRQAEHCLREFKLNDPWYIKPKEKDGRGWGATEAARGSLSHWVEIEGGKIKN
FT                   YQVIAPGTWNIGPRDGEGIRGPIEEALIGTPIYDSSDPVEVGHVARSFDSCLVCTVHAH
FT                   DAKTGEELARFRTA"
FT   gene            complement(470138..472831)
FT                   /locus_tag="Npun_R0370"
FT   CDS_pept        complement(470138..472831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0370"
FT                   /product="ATP-dependent endonuclease of the OLD family-like
FT                   protein"
FT                   /note="KEGG: mhu:Mhun_1796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79152"
FT                   /db_xref="GOA:B2J5Y6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y6"
FT                   /protein_id="ACC79152.1"
FT                   /translation="MYLKTVFIRFYKSFNDDFIRKNNNKVKPKPWEKIDNAFYPYIEVP
FT                   LDPKITTIVGANESGKSHLLSAIEKAISGNNIERSDFCRYSHFFTVKQNELKYPDFGTE
FT                   WSDLSKSEEVSLRKIIEIPENIIFDRFLVFRRNISNIIVYLPEKGDYRPYRIGERQVSE
FT                   LQSLLPEILRIESDVALPSSVPIKKLVHLGQEKYLDSRRFELLDREQRNRIVDALDEFS
FT                   DNPELVTKVRLFWGENKDVVDPDAIETMKSIISALDEAVFSLNEKERRDKETNLAYKLI
FT                   CKIAQVDTNALLDLAGAIKKGMQGYANGIIEKINRQLSINLNFPNYWVQDRNFCLKVMA
FT                   RDYDLVFTITDRTGTEYSFEERSQGLRYFLSYYIQYRSHEPHPNKTEILLMDEPDAYLS
FT                   SQAQQDLLKVFDLFAIPAQGSHLTHPIQVVYVTHSPFLIDKNHAERIRVLRKGNEDEGT
FT                   RVVKDAAKNHYEPLRSSIGAYVGETAFIGNCNLMVEGISDQILIAGATTYLRANGAPNL
FT                   ETLDLNQITIVQSGSASHIPYLVYLARGRDVEQPAVIVLLDSDNSGNEAKKQLLGKGGQ
FT                   HRRPVLKEQFILQLTDLKEEFSLVTDPLTVKIEIEDIIPLSICIQATKFYLKEFLQLDE
FT                   TEFCFLTEDLVLKKLANQTILDAIQASLLEFPDKGLQINKVGFARNVIQVVNEWKQKRD
FT                   SLDKHQSDALQVFEKNFRVLFKKLNIMQRRARQRLTDERLSQKIERLKKDFIALHPISA
FT                   RREDGVILLDEIEVILENNIENEAIKEIEAIKNALQNLRRDYKLEIDMSKTIDDYIGFQ
FT                   KGLEIIKYAGLLASQEETPDEPQAKKSATSESEEVPEKVHIDNLIVDEHQQVIIEQVPT
FT                   ISEVKIAEVSNNSTKANQRRKSRIRS"
FT   gene            473167..473412
FT                   /locus_tag="Npun_F0371"
FT   CDS_pept        473167..473412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0371"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   syn:ssl1004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79153"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y7"
FT                   /protein_id="ACC79153.1"
FT                   /translation="METVNIHQAKTNLSKLLSRVELGEEIIISNRGVPIAKLVPFRTSS
FT                   NRLNSLGQDKGRFVVPDDFNAPLPEEILAAFEGGEE"
FT   gene            473409..473807
FT                   /locus_tag="Npun_F0372"
FT   CDS_pept        473409..473807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0372"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: syn:sll0525
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79154"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y8"
FT                   /protein_id="ACC79154.1"
FT                   /translation="MKLLLDTQCWLWWFTQPELLNESAIAHIADETNELWLSVASIWEM
FT                   GIKVAIGKLPLADPLDSYISSRMTVLAMRSLEITASHALQAAALPLHHRDPFDRMLIAQ
FT                   AQIEEMTLVSADSMFNKYDISLLWAAKS"
FT   gene            474022..474444
FT                   /locus_tag="Npun_F0373"
FT   CDS_pept        474022..474444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all1395 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79155"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Y9"
FT                   /protein_id="ACC79155.1"
FT                   /translation="MSDLALHNYLPRVPDAALQEYIEWCVLEQAQAAECNFTPDRSKLD
FT                   NLLPEDYIPKLVEQFMKVKPDPIKAGLVAAIAGKEADKHALSGLAIAADFVSLYVKYLI
FT                   PKEGSTKEQAEEILTQASQHQYEKLTEVAKKHGVEF"
FT   gene            474590..475063
FT                   /locus_tag="Npun_F0374"
FT   CDS_pept        474590..475063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0374"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52, hydrogen uptake protein; KEGG: ana:alr1423
FT                   hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79156"
FT                   /db_xref="GOA:B2J5Z0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z0"
FT                   /protein_id="ACC79156.1"
FT                   /translation="MLTIIGCGNLNRSDDAVGVIIAQHLQKYLAENPHPYVRVYDCGTA
FT                   GMEVMFQARGSQQLIIIDASSTGSEPGAVFKVPGKELEALPEPSYNLHDFRWDNALAAG
FT                   RKIFQNDFPDDVTVYLIEAANLGLGLELSPIVKHSADLVFEEVAALISQNINF"
FT   gene            complement(475083..475457)
FT                   /locus_tag="Npun_R0375"
FT   CDS_pept        complement(475083..475457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79157"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z1"
FT                   /protein_id="ACC79157.1"
FT                   /translation="MARNMYYFNSDDSHPMQPTSADIILRQQLEDSISRYFYDACDRTI
FT                   QNLLSDCRWYVTTHANALTLVIECPDQVINWRVLQKIVPMGTLLYGIVNSAKIRVCPPE
FT                   SQGVPFEMRVDELSVYRDWA"
FT   gene            complement(475476..476762)
FT                   /locus_tag="Npun_R0376"
FT   CDS_pept        complement(475476..476762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79158"
FT                   /db_xref="GOA:B2J5Z2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z2"
FT                   /protein_id="ACC79158.1"
FT                   /translation="MPSSQISGKAYHEATKHSYLSVQLDPNYVDASTQPSAFKVYPKFY
FT                   RRVKLNLNNPVHSFISLTSTITLEKVYKDGPYKLRVNPSAGALYPTEVYVQIRGIEGMV
FT                   DGIYHLEVENNCLTLIYELIDDGLENYIIPGKSINGFIFLISCVYYRSSWKYQNRSIRY
FT                   CFLDSGHHLGAVAASASLYNRDIQLIFDFDKIALNSDLGFENKEFITACAVSGELENKK
FT                   IRSLRLKVPFVSGTDYFESNQFIEDAYQATTLQKSRQHKLEYPQFDFDRDKFYQTIWNR
FT                   RSIRRFRKEAISQEDYLYVVQQLQQSIPTENYEQLEIYSVVHRVEGMTPGLYKGTYLVK
FT                   TGNFSEKTGYLCINQAIAKDSAVTLFFVSDYLNYQTAMQIAGFLGQRLYLTSNYMGIQC
FT                   SGIGAYYDDETQELLETNKDVLYGMVIGR"
FT   gene            complement(476737..477234)
FT                   /locus_tag="Npun_R0377"
FT   CDS_pept        complement(476737..477234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0377"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: ana:all1426 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79159"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z3"
FT                   /protein_id="ACC79159.1"
FT                   /translation="MSQLNRQDLSEATTQWLIAKGYNPGDLNQLGENGDTALMKATREG
FT                   VYAVVKELIDAGGDINAQNSDASGGLRLRNNALWFACFGNHYDLINLLLAANININNQN
FT                   DNGATVLMFAASAGKTEVVKLLLQHNPNLYLKNLDDYKAIDFASNVEVLRILKNAIKSD
FT                   IG"
FT   gene            477884..478093
FT                   /locus_tag="Npun_F0378"
FT   CDS_pept        477884..478093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0378"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: ana:asr1428
FT                   molybdo-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79160"
FT                   /db_xref="GOA:B2J5Z4"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z4"
FT                   /protein_id="ACC79160.1"
FT                   /translation="MEISARNSLKGTVKKVVPGTVNTEVILEIAPGVELVSIITKSSAE
FT                   KLGLAEGKEAYAVIKSSDVIVAVE"
FT   gene            complement(478300..478560)
FT                   /locus_tag="Npun_R0379"
FT   CDS_pept        complement(478300..478560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0379"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ana:asl1429
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79161"
FT                   /db_xref="GOA:B2J5Z5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z5"
FT                   /protein_id="ACC79161.1"
FT                   /translation="MFTPFSITGCSLELLRTGEQGIVTFCKSQDKIILNQLISIGVTLG
FT                   TIITLEQNFPSFIIKIENISLALDTKSIQAIYVRIIDNLTN"
FT   gene            complement(478670..478969)
FT                   /locus_tag="Npun_R0380"
FT   CDS_pept        complement(478670..478969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0380"
FT                   /product="ferredoxin (2Fe-2S)"
FT                   /EC_number="1.18.1.3"
FT                   /note="TIGRFAM: ferredoxin [2Fe-2S]; PFAM: ferredoxin;
FT                   KEGG: ava:Ava_3940 ferredoxin (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79162"
FT                   /db_xref="GOA:B2J5Z6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z6"
FT                   /protein_id="ACC79162.1"
FT                   /translation="MATYQVRLINKKEDIDTTIEVDEETTILEAAEENGIELPFSCHAG
FT                   SCSSCVGKVVEGEVNQEDQNFLDDDQVSKGYALLCVTYPRSNCTIKTHQEAYLV"
FT   gene            complement(479198..479569)
FT                   /locus_tag="Npun_R0381"
FT   CDS_pept        complement(479198..479569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0381"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   ava:Ava_3939 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79163"
FT                   /db_xref="GOA:B2J5Z7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z7"
FT                   /protein_id="ACC79163.1"
FT                   /translation="MAVILSEKAEFHLRAFLKGSAPDADGATKGVRISVKDGGCSGYEY
FT                   AIDITSKPQPDDLVSHQGKVVVYVDAKSAPLLDGVIVDFVEGVMESGFKFINPNATDTC
FT                   GCGKSFKTDDGTPTGVPCS"
FT   gene            complement(479737..480546)
FT                   /locus_tag="Npun_R0382"
FT   CDS_pept        complement(479737..480546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0382"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: ava:Ava_3938 MoeZ/MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79164"
FT                   /db_xref="GOA:B2J5Z8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2J5Z8"
FT                   /protein_id="ACC79164.1"
FT                   /translation="MVNLTPTELERYRRQMMLPNFGETAQKRLKSATVLVTGVGGLGGT
FT                   AALYLAVAGVGRLILVRGGDLRLDDMNRQVLMTDDWVGKPRVFKAKETLDAINPDVQVE
FT                   IVHDYITPEHVDSLVQSADMALDCAHNFTERNLLNEACVRSRKPMVEAAMNGMEAYLTT
FT                   IIPGVTPCLSCLFPEKPEWDQRGFSVLGAVSGTLACLTALEAIKLITGFSQPLLSQLLT
FT                   IDLNRMEFAKRRSHRDRSCPVCGNSAPWRHAQSNSMEPTATGIAQNT"
FT   gene            complement(480557..480874)
FT                   /locus_tag="Npun_R0383"
FT   CDS_pept        complement(480557..480874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0383"
FT                   /product="nitrogen fixation protein NifW"
FT                   /note="PFAM: nitrogen fixation protein NifW; KEGG:
FT                   ava:Ava_3937 nitrogen fixation protein NifW"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79165"
FT                   /db_xref="GOA:B2J5Z9"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J5Z9"
FT                   /protein_id="ACC79165.1"
FT                   /translation="MTGTIDEFKKLVDAEEFFQFFNMSYDLEVVNVHRLHILKKFSQYM
FT                   HEIDENSPDLSQEEKLNQYSLALQKAYQVFIESTAYEQKLFKVFNDKPKNVVTLTEITS
FT                   D"
FT   gene            complement(480871..481071)
FT                   /locus_tag="Npun_R0384"
FT   CDS_pept        complement(480871..481071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0384"
FT                   /product="protein of unknown function DUF683"
FT                   /note="PFAM: protein of unknown function DUF683; KEGG:
FT                   ava:Ava_3936 protein of unknown function DUF683"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79166"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="UniProtKB/TrEMBL:B2J600"
FT                   /protein_id="ACC79166.1"
FT                   /translation="MTIEELQGQIRRLNSKAGQMKMDLHDLAEGLPTDYNQLMDVAAAT
FT                   YEIYRKLDELKQQLKKLESAK"
FT   gene            complement(481194..481670)
FT                   /locus_tag="Npun_R0385"
FT   CDS_pept        complement(481194..481670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0385"
FT                   /product="protein of unknown function DUF269"
FT                   /note="PFAM: protein of unknown function DUF269; KEGG:
FT                   ava:Ava_3935 protein of unknown function DUF269"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79167"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="UniProtKB/TrEMBL:B2J601"
FT                   /protein_id="ACC79167.1"
FT                   /translation="MTTNNSVNGTATTEVLNSPFLKVLIKQIRGQDSYGVYRSWSDELI
FT                   LKPFIVTKQKKREISVEGEVDPITQARIMAFFRAVAAGIEQETGLISQVVVDLSHEGFG
FT                   WALVFSGRLLLAVKTLRDAHRFGFDSVEKLAEEGENYVKKGLDLAKRFPEVGKI"
FT   gene            complement(481667..482080)
FT                   /locus_tag="Npun_R0386"
FT   CDS_pept        complement(481667..482080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0386"
FT                   /product="nitrogen fixation protein NifX"
FT                   /note="TIGRFAM: nitrogen fixation protein NifX; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor biosynthesis; KEGG:
FT                   ava:Ava_3934 dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79168"
FT                   /db_xref="GOA:B2J602"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B2J602"
FT                   /protein_id="ACC79168.1"
FT                   /translation="MKIAFTTSDRVHINAHFGWAKMIDVYEITDEGYHFVETLTFEGEL
FT                   KEDGNEDKITPKLEAIGDCTIVYVTAIGGSAAARLIKKGVTPVKARSEEEEISEVLNKL
FT                   VKTLKGNPPPWLRKALQPKTTNFADEIEDEATV"
FT   gene            complement(482370..483707)
FT                   /locus_tag="Npun_R0387"
FT   CDS_pept        complement(482370..483707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0387"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase molybdenum-iron cofactor
FT                   biosynthesis protein NifN; PFAM:
FT                   oxidoreductase/nitrogenase, component 1; KEGG: ana:all1437
FT                   nitrogenase olybdenum-iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79169"
FT                   /db_xref="GOA:B2J603"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:B2J603"
FT                   /protein_id="ACC79169.1"
FT                   /translation="MAIVTASNKALTVNPLKQSQALGATLAFLGLKGTMPLFHGSQGCT
FT                   AFAKVVLVRHFREAIPLATTAMTEVTTILGGEENVEQAILTLVEKANPEIIGLCSTGLT
FT                   ETRGDDIEGFLKEIRDRHPELNDLAIVFAPTPDFKGALQDGFAVAVESIVKEIPRAGGL
FT                   RTEQVTILAGSAFTPGDVQEIKEIVTSFGLVPIFVPDLGASLDGHLEDNYSAVTVSGTT
FT                   LKQLREVGSSAFTLALGESMRGAAKILEERFGTPYEVFGELTGLEPVDEFIQALAILSG
FT                   NSVPEKYRRQRRQLQDAMLDTHFYFGAKRVSLALEPDLLWSTVHFLQSMGSQIHAVVTT
FT                   TRSHLLEKLPVKSITIGDLEDFESLAGGSDLLIGNSNVGAIAKRLSIPLYRLGLPIYDR
FT                   LGNGQFTKVGYRGTMELLFGIGNLFLEAEEARVKQFQEFGIVSAEF"
FT   gene            complement(483707..485089)
FT                   /locus_tag="Npun_R0388"
FT   CDS_pept        complement(483707..485089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0388"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase MoFe cofactor biosynthesis
FT                   protein NifE; PFAM: oxidoreductase/nitrogenase, component
FT                   1; KEGG: ana:all1438 nitrogen Fe/Mo cofactor biosynthesis
FT                   E"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79170"
FT                   /db_xref="GOA:B2J604"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:B2J604"
FT                   /protein_id="ACC79170.1"
FT                   /translation="MKSTQGKINELLTETGCEHNQHKQAEKKNKSCAQQAQPGAAQGGC
FT                   AFDGAMIALVPIADAAHLVHGPIACAGNSWGSRGSLSSGPQLYKMGFTTDLGENDVIFG
FT                   GEKKLYKAILELKERYQPAAVFVYATCVTALIGDDMDAVCKAAAEKIGIPVVPVIAPGF
FT                   IGSKNLGNRFGGEALLEYVVGTAEPEHTTPYDINLIGEYNIAGEMWGVTPLLEKLGIRI
FT                   LSKITGDARYNEIRYAHRAKLNVMICSRALLNMARKMEERYNIPYIEESFYGIDDMNRC
FT                   LRNIAAKLGDPDLQERTEKLIAEETAALDLALAPYRARLKGKRVVLYTGGVKSWSIISA
FT                   ARDLGIEVVATSTRKSTEEDKAKIKKLIGNDGIMLEKGNAQELLQLVKDTRADMLIAGG
FT                   RNQYTALKARIPFLDINQERHHPYAGYVGMIEMARELYEALYSPIWEQIRKPAPWEEEE
FT                   EV"
FT   gene            complement(485214..485561)
FT                   /locus_tag="Npun_R0389"
FT   CDS_pept        complement(485214..485561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0389"
FT                   /product="Mo-dependent nitrogenase family protein"
FT                   /note="PFAM: Mo-dependent nitrogenase family protein; KEGG:
FT                   ava:Ava_3931 Mo-dependent nitrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79171"
FT                   /db_xref="InterPro:IPR009717"
FT                   /db_xref="UniProtKB/TrEMBL:B2J605"
FT                   /protein_id="ACC79171.1"
FT                   /translation="METINHTHEHTHTHPHPNYHPPNQKKPGWFHNLLNPLRRVVDGIQ
FT                   VKNNRIAHLICQTIPCCCPFERQIKLFGKCIDIPPLCKLNPLYDEFVGLRFRALSYLTD
FT                   VCGEDVTKYIC"
FT   gene            complement(485720..487255)
FT                   /locus_tag="Npun_R0390"
FT   CDS_pept        complement(485720..487255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0390"
FT                   /product="nitrogenase molybdenum-iron protein beta chain
FT                   NifK"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase molybdenum-iron protein beta
FT                   chain; PFAM: oxidoreductase/nitrogenase, component 1; KEGG:
FT                   ava:Ava_3930 nitrogenase molybdenum-iron protein beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79172"
FT                   /db_xref="GOA:B2J606"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:B2J606"
FT                   /protein_id="ACC79172.1"
FT                   /translation="MPQNPEKIQDHVELFHQPEYQQLFENKKQFENGHDPEEVKRVSEW
FT                   TKGWDYREKNFAREALTVNPAKGCQPLGAIFAAVGFEGTLPFVQGSQGCVAYFRTHLTR
FT                   HYKEPFSGVSSSMTEDAAVFGGLQNMIDGLANSYQLYKPKMIAVCTTCMAEVIGDDLQA
FT                   FINNSKQAGSVPQDFPVPYAHTPSFVGSHITGYDNMMKGILSNLTAGHKKETSNGKINF
FT                   IPGFDTYVGNNREIKRIASLFGFDYTILADNSDYLDSPNTGEFDMYPGGTKLEDAADSI
FT                   NAKATIALQAHSTPKTREYIEKEWKQPTSVSRPWGIKGTDEFLMKLSELSGIPIPEELE
FT                   IERGRAVDAMTDSHSWIHGKRFAIYGEPDLVYSVVGFMLEMGAEPVHILVHNSNEVFEA
FT                   EMKELLASSPFGQHATVWPGKDLWHMRSLLFTEPVDFLVGNTYGKYLWRDTKIPLVRIG
FT                   YPIMDRHHLHRYATIGYQGVINLLNWTVNTLFEEIDRNTNIPSKTDISYDLIR"
FT   gene            complement(join(487562..487678,511303..512745))
FT                   /locus_tag="Npun_R0414"
FT                   /note="nitrogenase molybdenum-iron protein alpha chain
FT                   NifD; interrupted by an insertion element that pops out
FT                   under certain growth conditions; when the insertion element
FT                   pops out, the protein is expressed"
FT   gene            487789..489219
FT                   /locus_tag="Npun_F0392"
FT   CDS_pept        487789..489219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0392"
FT                   /product="phage integrase family protein, XisA"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ava:Ava_3928 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79173"
FT                   /db_xref="GOA:B2J607"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2J607"
FT                   /protein_id="ACC79173.1"
FT                   /translation="MHNQGQDKYQQAFADLEPASSTDGSFLGSSLQAQQQKEHMRTKVL
FT                   LELEKVNLRLKSAKAKVTIRESNGSLQLRATLPIKPGDKDSNGTGRKQYNISLNIPSNL
FT                   DGLKTAEEEAYELGKLIARKTFEWNDKYLGNEAIKKEFKTIGELLEQFENEYFKTHKRT
FT                   TKSEHTFFYYFSRTKRFTNPKDLAIAENLISSLEQIDKEWAKYNAARAIAAFCVTFNIE
FT                   INLSKYSKMPENNSRNIPTDAEIYDGILKFEDYLHNRGNQVNQNLQDSWQLWRWTYGML
FT                   AVFGLRPRELFINPDIDWWLSQENTDLTWKVHKDCKTGEREALPLHRQWIEDFDLRNPK
FT                   YLEMLKGAIAKKDNTNHAEITALTQRVSWWFRKIGLDFKPYDLRHAWAIRAHILGIPIK
FT                   AAADNLGHSVQVHTQTYQRWFSLDMRKLAINQALSKRNEVELIREENAKFRMENDKLKL
FT                   EVEKLRMELVYKRSYTQN"
FT   gene            489277..489540
FT                   /locus_tag="Npun_F0393"
FT   CDS_pept        489277..489540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_4991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79174"
FT                   /db_xref="UniProtKB/TrEMBL:B2J608"
FT                   /protein_id="ACC79174.1"
FT                   /translation="MALVTLQQIIKQLETLEIEELQQLNQTIQKYLADKEETVKQAAFH
FT                   QALISSGLVKQIKHPAYEPITERRLINVEGKPISETIIEERR"
FT   gene            489541..490005
FT                   /locus_tag="Npun_F0394"
FT   CDS_pept        489541..490005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79175"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B2J609"
FT                   /protein_id="ACC79175.1"
FT                   /translation="MAIYFIDSSALVKRYISETGSAWVLELFDPTLNNEVFIAAITSVE
FT                   IIAAITRRSRGGSISITDATITRNQFKRDLQKDYQIVEITENVINSGIVLSETYGLRGY
FT                   DAIQLAVGRAVNSICIANGLPSITFVSADNELNAAVGSEGLMIENPNSHS"
FT   gene            490170..490838
FT                   /locus_tag="Npun_F0395"
FT   CDS_pept        490170..490838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79176"
FT                   /db_xref="UniProtKB/TrEMBL:B2J610"
FT                   /protein_id="ACC79176.1"
FT                   /translation="MTKLMNADENVPNQFYIFVNELNPLTYHNFNFTGVFSSGAFGSLD
FT                   MNPEFFYKYQKGSANYLPYEPCDMDSMALSPYFLTAINDYRLEYDAEIFRKHYYQFFPS
FT                   RFSAIYAFGNIESCQAVNTKYGWPLDSVKRFRLIDNPLNRVVSVNMEHVSLLRHAYRVS
FT                   ALQDIDSLWRGYWSGFGNIVLELPTIGFQRKQYKSGLIWEYLIEGCVQHLDRPHNNAIQ
FT                   "
FT   gene            490977..491813
FT                   /locus_tag="Npun_F0396"
FT   CDS_pept        490977..491813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL1820 uncharacterized conserved protein,
FT                   containing metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79177"
FT                   /db_xref="UniProtKB/TrEMBL:B2J611"
FT                   /protein_id="ACC79177.1"
FT                   /translation="MNTHKIKFKGDKKGYCNICGKYSQLTRDHIPPQGCVKPTLVELRT
FT                   LTQHISVSSKNSTDSQSGLNILSICGDCNNNLLGAQYDPELIELSKNVAGMVRIQQELG
FT                   LSLPEKINLSVKPQKLIRSVIGHILAGKLPITGKPPISAPFPDTLRNYFLDQSSNIPDN
FT                   LDIYYWIYPSNKQIVINSLAIGSSLGEGFVSGSCLLKFFPLAFWVVWNQPTSFPINLPK
FT                   IPQNQVKYLDETCEIMIDLRQIPRLDYPEVPGEGRYIMYCDHSTFLAQPKKTKGFG"
FT   gene            complement(491858..492031)
FT                   /pseudo
FT                   /locus_tag="Npun_R0397"
FT   gene            complement(492207..492746)
FT                   /locus_tag="Npun_R0398"
FT   CDS_pept        complement(492207..492746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79178"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B2J612"
FT                   /protein_id="ACC79178.1"
FT                   /translation="MPDQSFRTNIPEVDPTEIEDTRTAIADEHHSFLEKVMVRSGFADL
FT                   YDARDFTEVVYRVMRDLMTKDTIERVEGELHTEAVPTDEKALQFEVAELWKDTNPIVRF
FT                   LSKIRQPLRGPAPIGIDSKLFLTRVANEGGVPGSVDAEQAVKAVFSATKDELSQERIQE
FT                   IAGALPDYVRQLWDQA"
FT   gene            492997..493593
FT                   /locus_tag="Npun_F0399"
FT   CDS_pept        492997..493593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0399"
FT                   /product="dienelactone hydrolase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: ava:Ava_4152
FT                   dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79179"
FT                   /db_xref="GOA:B2J613"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2J613"
FT                   /protein_id="ACC79179.1"
FT                   /translation="MVETTNIEINSAKVKVPNGDLEIDAYLAQPAQNGTFGAVIVFPEI
FT                   FGINSNIRDITELIAKQGYVAIAPAMYQRIAPGFEADFSAEDVGFSPESYRLGLEYYQQ
FT                   VKYQDILSDIQATITYLKTLPNVKDDAIGVIGFCFGGHVAYMAATFPDIKAIASFYGGG
FT                   ITTSSYGEEIPTINRTSEIKGTIYAFFGTRDTLIS"
FT   gene            complement(494009..494656)
FT                   /locus_tag="Npun_R0400"
FT   CDS_pept        complement(494009..494656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0400"
FT                   /product="Methyltransferase type 11"
FT                   /EC_number="2.1.1.17"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: noc:Noc_0914
FT                   phosphatidylethanolamine N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79180"
FT                   /db_xref="GOA:B2J614"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2J614"
FT                   /protein_id="ACC79180.1"
FT                   /translation="MQINQVIETYDRGAADYDAIMKRYWHIEREPLIASLQLQPGQIVL
FT                   DAAVGTGLNLSAYPEGVNVVGIDFSEKMLNEARKKHVSADITFNISDLCNLDFPDNSFD
FT                   AAASGFTLCVVEDPVLALKEILRVTKPGALIAILDYCKSQDPEIQKWQELIADGSSQLG
FT                   FPTGKIKWDALMDYDELIYNSKLTIEVLADDRTDSPNPFLCGCQFLLKNSKG"
FT   gene            complement(494776..496968)
FT                   /locus_tag="Npun_R0401"
FT   CDS_pept        complement(494776..496968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0401"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ana:alr0642 two-component
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79181"
FT                   /db_xref="GOA:B2J615"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J615"
FT                   /protein_id="ACC79181.1"
FT                   /translation="MKTHNNKGKAFPLQIVLVVPFLIQIFGAVSLVGYLSFKNGQRTVN
FT                   DLVEQLIDRTSEVVDEHLKSYLSIPQTLNQINADAIHRGILDVRDRQTVGKYFWDQMHA
FT                   SDLTYIGIGLTTGEGLGAARYDGKTITIDDWTAKLPNNISTYATDNQGNRTQVNARWDW
FT                   NNFKESWYTQPIAAGKPIWAKIVTGNFPTGPYIAASASRPIYDSQNRLLGMIACDIHLL
FT                   KLSDFLRNLDISKSGQVFLLERDGTLIASSGTEKPFVLVNQDIRRLRAIDSSDPVIQNI
FT                   GKHLQTSGFGSITQDTDFQLEVQGKRYFVDVAPWRDKYGLNWLMVVSVPENTFMAEINA
FT                   NTRTTIALCFGALVVASVMGVFTSHWIVRPILRLNWASKAMASGNLAQTVETSVIQELN
FT                   TLSNSFNYMAEQLYESFTALEKSKEKLEDRVEERTTELKNALGELQRTQSQVIQSEKMS
FT                   SLGQLVAGVAHEINNPVNFIHGNLVHVQEYTQDLLAFVQLYQQHDPKPAAEIQTFTEDI
FT                   DLEFLQEDLPKMLSSMRVGTERIRQIVLSLRNFSRIDEAEFKSVDIHEGIDSTLMILQH
FT                   RLKAKPEQPEIEVIKDYGTIPLVECYAGQLNQVFMNILVNAIDALEENNTKHTYQEIEE
FT                   NPSRIKIRTSVINSTWLEIAIADNGVGISKEFQQRIFDPFFTTKPIGKGTGMGMSISYQ
FT                   IITEKHGGKLECFSTSGKGTEFIIQIPLQLNVNQVV"
FT   gene            497397..498584
FT                   /locus_tag="Npun_F0402"
FT   CDS_pept        497397..498584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS03668 putative hemolysin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79182"
FT                   /db_xref="GOA:B2J616"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B2J616"
FT                   /protein_id="ACC79182.1"
FT                   /translation="MTTQVFRGITYTEQVIQESNQRVCGTANPDWFVVEGNNNVVNTRD
FT                   GNDVVLLAREIDLIYLSTTFNGEVLQTSPLSSNPDGISANVDTGGGDDYVSLGSGNYKI
FT                   HLGSGNNFLDDYGGNYLFDADGTNIIGLGTIPKVIASAGAGDDIFYLGGFANRNIDAGK
FT                   GNNLILLGSGDANIKTGSGNDIITSELSIATYIFFATGLPLYNQTINAGDGDNQIAVAP
FT                   YGETTVKTGCGEDFILAYGIPGSSDTKIFTGNGNDTIITIDTNSTIKSGSGDDLIFAGS
FT                   GDDTILVGNGNDLVNLRGGTVSLPDPLSRDTNLFGSSVEVIGGGNDTVYLGQGRDTVIL
FT                   GSIGFATIYGFDCNDRLDVTGLNASFTRIGHDTLINSSGSSLGVLKGYTGSVHLA"
FT   gene            498893..499777
FT                   /locus_tag="Npun_F0403"
FT   CDS_pept        498893..499777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0403"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG:
FT                   plt:Plut_0984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79183"
FT                   /db_xref="GOA:B2J617"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniProtKB/TrEMBL:B2J617"
FT                   /protein_id="ACC79183.1"
FT                   /translation="MQQFKVTSDSLNIRSAPIVDDTNRIGVLPKSQIVSKIENLDDNKW
FT                   LKVATILEGKILEGFVSQKFISPITTFSINTLMKIGGVSIQQADGESAIFYEAGMSINA
FT                   DGAPNAYHPADTGIDFLANAGNPGNWWAIVVNKDGNPFIQSSTDPYPGYYISTTALSDS
FT                   GFVKQDPRRYVDSTKIPYIVLPGNSDFKKLIGIKLGDFAVVYNTNNEKLAFAIYADIGP
FT                   KNQIGEGSIALSQALGNDPLVRSRVRQGIPKGIVYVVFPGSGNGQPRIISEIEAETKRL
FT                   FEIWGGIERIKSL"
FT   gene            complement(500150..501106)
FT                   /locus_tag="Npun_R0404"
FT   CDS_pept        complement(500150..501106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0404"
FT                   /product="nuclear transport factor 2"
FT                   /note="PFAM: nuclear transport factor 2; KEGG: gvi:glr0050
FT                   unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79184"
FT                   /db_xref="GOA:B2J618"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR015233"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036917"
FT                   /db_xref="UniProtKB/TrEMBL:B2J618"
FT                   /protein_id="ACC79184.1"
FT                   /translation="MNYTIESARNIFSSTQVADAVPATTAMFAELNIDDQLAFLWYAYA
FT                   ELGRTITPAAPGKANLQLMEGIFNEIKQMSHEEQTQLMRDLASNADTPISRSYAYFGVN
FT                   AKLGFWWQLGEWMKEGIVAPMPVGYQMSTQVKAVLEAVQKIDQSQQITVLRNTVVNMGF
FT                   DPSLADKKQAQINFKFPRTSLSPQFTIEGVTEPTVLKYIEAMNADNFEAAVALFANNGA
FT                   LQPPFQKPIVGREAITAYLRDEGQGLVMKPTKGVSETIEDGYTQHKITGTVETPWFGGN
FT                   VGMNIAWRFLLNPQGQIYFVAIDLLASPKELLNLTRK"
FT   gene            complement(501722..502387)
FT                   /locus_tag="Npun_R0405"
FT   CDS_pept        complement(501722..502387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0405"
FT                   /product="TraX family protein"
FT                   /note="PFAM: TraX family protein; KEGG: mmo:MMOB2780
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79185"
FT                   /db_xref="GOA:B2J619"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:B2J619"
FT                   /protein_id="ACC79185.1"
FT                   /translation="MIKVSAFSIKILAAVFMVMDHVCYLLMPEFRILHFIGRLSFPLFA
FT                   WLLAKGEKHTQNVYRYGSRLLITAIISQPIYSVVFQSLSLNILYTLVLGLVMLRLVRHY
FT                   SQLWQQLIITGLSAAVAESLGVEYGAYGIGVIFLMSLTDKLKPRVWLLCWCIFNFILVT
FT                   LFIGNIFQHWAILAGFIVFQFNGKQGQRARWFYLFYPAHLIILGIINYLIHSRYSNPL"
FT   gene            502555..503133
FT                   /locus_tag="Npun_F0406"
FT   CDS_pept        502555..503133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79186"
FT                   /db_xref="UniProtKB/TrEMBL:B2J620"
FT                   /protein_id="ACC79186.1"
FT                   /translation="MAKRKKSNLQWIKETLELKPDHRWESPSGYKIFVADRGAVRFNVP
FT                   QSWVLEPQDKSFKFLDKKPPNDDCCLEVSFNRLPPNDWSQFPLKSTLKKVLEDDSRNII
FT                   SKGEIVTIKRQTARIVWTEMKFIDVQEEPREAFSRTCIGLGSNVQCLITFDYWADQAEQ
FT                   LIPVWDEAMRSLTLGLYIRDPMTGLAFPD"
FT   gene            503259..503606
FT                   /locus_tag="Npun_F0407"
FT   CDS_pept        503259..503606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79187"
FT                   /db_xref="UniProtKB/TrEMBL:B2J621"
FT                   /protein_id="ACC79187.1"
FT                   /translation="MSLNPLTQLISERGFDRFQSGLRSRFAAYHLKYTLTYCKPSDNPA
FT                   MCLDFESLLHLGRVTVWESGACEMDILEISTGNNVFYESHHFNNEKQFHQTYLRLVIFM
FT                   RDMLRLKSDNI"
FT   gene            503752..503827
FT                   /locus_tag="Npun_r003"
FT                   /note="tRNA-Met1"
FT   tRNA            503752..503827
FT                   /locus_tag="Npun_r003"
FT                   /product="tRNA-Met"
FT   gene            503827..503901
FT                   /locus_tag="Npun_r004"
FT                   /note="tRNA-Met2"
FT   tRNA            503827..503901
FT                   /locus_tag="Npun_r004"
FT                   /product="tRNA-Met"
FT   gene            504299..505384
FT                   /locus_tag="Npun_F0408"
FT   CDS_pept        504299..505384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0408"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /EC_number="2.7.7.49"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: ter:Tery_2145 RNA-directed DNA
FT                   polymerase (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79188"
FT                   /db_xref="GOA:B2J622"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:B2J622"
FT                   /protein_id="ACC79188.1"
FT                   /translation="MYSQNLTTIPLATESNLERLETDNLALLRSHGLAEYNTAEEIAFA
FT                   MVISLEKLHFLTTSTSLTRHYLPFKISKKTGGKRIISAPKPELKAAQRWILENILEKLE
FT                   VHNAAHGFCKNRSIVTNAKPHVGANVIVNIDLQNFFQSISYKRIKELFSGFGYSESTAT
FT                   IFGLICTTAEIAINGQINHTASENRHLPQGSPASPAISNLVCRNLDIRLAAIAENLGFC
FT                   YTRYADDLTFSTSEDASSKISNLIKNTKFIIHGENFTVNDNKTKISSKSVQQEVTGVIV
FT                   NTQLNISKKTLKAFRATLYQIEQEGLSGKSWGKSTNLIAAITGFANYVAMINPDKGAEF
FT                   KSSVERIKQKYGGSQTDEVRF"
FT   gene            505602..505675
FT                   /locus_tag="Npun_r005"
FT                   /note="tRNA-OTHER1"
FT   tRNA            505602..505675
FT                   /locus_tag="Npun_r005"
FT                   /product="tRNA-OTHER"
FT   gene            506277..507815
FT                   /locus_tag="Npun_F0409"
FT   CDS_pept        506277..507815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0409"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: ana:alr0740 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79189"
FT                   /db_xref="GOA:B2J6Y1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y1"
FT                   /protein_id="ACC79189.1"
FT                   /translation="MQITMWETFYIKPNEIGILYHRSDFKKILQPGTHTYLGWHWQVKI
FT                   YDLNQPLAQIENLELLLRNHEAELQQDLLIIRTAFNQVALVRYGQNWVSVAPNKLIAFW
FT                   RGFIEVESYLFNLEESLELPNSFVQQLRSVALNGVKKFQISESEIGLLYLQNNFVRPLE
FT                   PGEYAFWSVDRDVTVRTLSRIIPNPDFPLEDVLIEKHPDFIAAYCEVVQLQTSQVAIVR
FT                   YRGKVISILPPTTRKLFWQGVAVEILDIIADAQLQPSLVAELVEGSTEVKLLSRNCLHI
FT                   CQVPAQHIGLVYINQEFQGQRSPGVHAWWLFGRSFQTETIDLRLQNMEVSGQDILSKDK
FT                   VPLRLNLTAGYRIQDPLRAKNGLSDISGFLYKELQFALRGAVGERNLDALLEDKGAIDR
FT                   SISEYIRQKAAEYGIEVDSVGVKDIILPGEIKTILSKVVEAEKAAQANVVRRREETAAT
FT                   RSMLNTAKVMEDNPVALRLKELEVLERIAEKIDRIQVNGSLDSILTDLIRMNPQ"
FT   gene            507912..508460
FT                   /locus_tag="Npun_F0410"
FT   CDS_pept        507912..508460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0410"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ana:alr2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79190"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y2"
FT                   /protein_id="ACC79190.1"
FT                   /translation="MNKVKQWSRFPTAGEIVLCDRSWYNRAGVERVMGFCTEAEYQEFI
FT                   QSCPEFERMLVRSGIVLIKYCFSVSDEEQEERFLSRSHDPARRWKLSPMDLESRDRWVE
FT                   YSKAKDTMFAYTNIPEAPWFTIEADDKRRARLNCIHHLLSKVPYEDMTPPPLELPSRPV
FT                   AEDYVRAPRNEQFFVPQVY"
FT   gene            508730..508948
FT                   /locus_tag="Npun_F0411"
FT   CDS_pept        508730..508948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79191"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y3"
FT                   /protein_id="ACC79191.1"
FT                   /translation="MKVHNKLLKLKCRQLKQRLIKFGHLELRHLELRHLELRHLELRHL
FT                   ELRHLELRHLELRHLELRHLELRHLEL"
FT   gene            509416..509574
FT                   /locus_tag="Npun_F0412"
FT   CDS_pept        509416..509574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79192"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y4"
FT                   /protein_id="ACC79192.1"
FT                   /translation="MSTTGYAYVVQLAVQNRGLFSAIALSRKLVLLTRNHRDLGKVPGL
FT                   LIEDWTV"
FT   gene            510151..510954
FT                   /locus_tag="Npun_F0413"
FT   CDS_pept        510151..510954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_0565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79193"
FT                   /db_xref="InterPro:IPR032557"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y5"
FT                   /protein_id="ACC79193.1"
FT                   /translation="MNALIFIDTNIFLDFYRVRGGEQKLNLLKRVDDHHDRIITTAQVE
FT                   MEYKKNRQIVILESLNKFKTPDWGGLTPPAFLSDAQPAIAITKSKSEISSQQNKLKKRI
FT                   EAILKNPSTNDPVFKILQRLFRSKSDFNLSREKKIRFKIRGLAWKRFILGYPPRKDKDT
FT                   SIGDAINWEWIIHCAENTEKDIILVTRDTDYGVNYNKELILNDWLSQEFKQRVGRKRKI
FT                   IITDRLTQAFKTISVTVTKQEEIEEDSLLEEKIRNTEEFSLENEF"
FT   gene            complement(512909..513802)
FT                   /locus_tag="Npun_R0415"
FT   CDS_pept        complement(512909..513802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0415"
FT                   /product="nitrogenase iron protein NifH"
FT                   /EC_number="1.18.6.1"
FT                   /note="TIGRFAM: nitrogenase iron protein; PFAM:
FT                   NifH/frxC-family protein; KEGG: ana:alr0874 nitrogenase
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79194"
FT                   /db_xref="GOA:B2J6Y6"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y6"
FT                   /protein_id="ACC79194.1"
FT                   /translation="MTDENIRQIAFYGKGGIGKSTTSQNTLAAMAEMGQRILIVGCDPK
FT                   ADSTRLMLHSKAQTTVLHLAAERGAVEDIELEEVMLTGFRNVRCVESGGPEPGVGCAGR
FT                   GIITAINFLEENGAYQDLDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTSGEMMAMYA
FT                   ANNIARGVLKYAHTGGVRLGGLICNSRNTDREIELIETLAKRLNTQMIHFVPRDNIVQH
FT                   AELRRMTVNEYAPESNQANEYRTLATKIIDNKNLAIPTPIEMEELEELLIEFGILESDE
FT                   NTAMLVGKSAAEAPVV"
FT   gene            complement(514151..514507)
FT                   /locus_tag="Npun_R0416"
FT   CDS_pept        complement(514151..514507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0416"
FT                   /product="globin GlbN"
FT                   /note="PFAM: globin; KEGG: fra:Francci3_2581 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79195"
FT                   /db_xref="GOA:B2J6Y7"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR016339"
FT                   /db_xref="InterPro:IPR019795"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y7"
FT                   /protein_id="ACC79195.1"
FT                   /translation="MSTLYDNIGGQPAIEQVVDELHKRIATDSLLSPIFAGTDMAKQRN
FT                   HLVAFLGQIFEGPKQYGGRPMDKTHAGLNLQQPHFDAIAKHLGEAMAVRGVSAENTKAA
FT                   LDRVTNMKGAILNK"
FT   gene            complement(514732..515631)
FT                   /locus_tag="Npun_R0417"
FT   CDS_pept        complement(514732..515631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0417"
FT                   /product="Fe-S cluster assembly protein NifU"
FT                   /note="TIGRFAM: Fe-S cluster assembly protein NifU; PFAM:
FT                   nitrogen-fixing NifU domain protein; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: ana:all1456 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79196"
FT                   /db_xref="GOA:B2J6Y8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y8"
FT                   /protein_id="ACC79196.1"
FT                   /translation="MWDYTDKVLELFYDPKNQGEIEETGEAGVKVATGEIGSIACGDAL
FT                   RLHLKVEVESDKILDARFQTFGCTSAIASSSALTEMVKGLTLDEALKVSNKDIADYLGG
FT                   LPEAKMHCSVMGQEALEAAIYNYRGIPLATHDDDDEGALICSCFGISESKIRRVILENH
FT                   LTDAEQVTNYVKAGGGCGSCLANIDDIIRSVQQEYASPALNNYGVQVATEIVTSKERSL
FT                   TNVQKIALIQKVLDEEVRPVLIADGGDVELYDVEGDRVKVVLQGACGSCSSSTATLKIA
FT                   IEARLQDRVSKSLVVEAV"
FT   gene            complement(515736..516944)
FT                   /locus_tag="Npun_R0418"
FT   CDS_pept        complement(515736..516944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0418"
FT                   /product="Nitrogenase metalloclusters biosynthesis protein
FT                   nifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   ava:Ava_3914 aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79197"
FT                   /db_xref="GOA:B2J6Y9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Y9"
FT                   /protein_id="ACC79197.1"
FT                   /translation="MQNNCIYLDNNATTKVDPEVIEVMLPYLTDYYGNPSSMHTFGGQV
FT                   GKAVRTAREQLAAILGADESEIVYTSCGTEGDNAAIRAALLAQPEKRHIVTTQVEHPAV
FT                   LNVCKQLETQGYSVTYLSVNHQGQLDLDELEASLTGNTALVTIMYANNETGTIFPIEQI
FT                   GLRVKEYGAIFHVDAVQAVGKIPLNMKTSTVDMLTLSGHKLHGPKGIGALYIRRGVRFR
FT                   PFMIGGHQERGRRAGTENVPAIIALGKAAELELLHLEEATTRERKLRDRLEQTLLAKIP
FT                   DCVVNGDVTQRLPNTTNIGFKYIEGEAILLLLNKYGICASSGSACTSGSLEPSHVLRAM
FT                   GLPYTTLHGSIRFSLCRYTTEAEIDQVIEVMPSIVERLRALSPFKNDDAGWLQGQEQAL
FT                   AHR"
FT   gene            complement(516979..517335)
FT                   /locus_tag="Npun_R0419"
FT   CDS_pept        complement(516979..517335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0419"
FT                   /product="4Fe-4S ferredoxin FdxN, iron-sulfur binding
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: ava:Ava_3913 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79198"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z0"
FT                   /protein_id="ACC79198.1"
FT                   /translation="MAYKILTSQCISCNLCLTVCPTNAVKVVDGQHWIDPELCTNCVGS
FT                   IHTVPQCKAGCPTCDGCVKQPSDYWEGWFANYNRVVAKLTNKQDYWERWFQTYSQKYSE
FT                   QLQKRQSQSVGSEA"
FT   gene            complement(517439..518890)
FT                   /locus_tag="Npun_R0420"
FT   CDS_pept        complement(517439..518890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0420"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="TIGRFAM: nitrogenase cofactor biosynthesis protein
FT                   NifB; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis; Radical SAM domain protein; KEGG:
FT                   ava:Ava_3912 nitrogenase cofactor biosynthesis protein
FT                   NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79199"
FT                   /db_xref="GOA:B2J6Z1"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z1"
FT                   /protein_id="ACC79199.1"
FT                   /translation="MTSPSTRLLNSNATESPTQAKSGGCGCDSTTSTTVERDEKLQERI
FT                   AKHPCYSEDAHHHYARMHVAVAPACNIQCNYCNRKYDCANESRPGVVSELLTPEEAAHK
FT                   ALVIGGKIPQMTVVGIAGPGDPLANPEKTFRTFELIAAQAPDIKLCLSTNGLMLPDYID
FT                   RIKQLNIDHVTITINMVDPEIGAKIYPWVHYRRKRYRGLEGAKILHERQMEGLQALKDA
FT                   DILCKVNSVMIPGINDHHLVEVNRVIREKGAFLHNIMPLISAPEHGTHFGLIGQRGPTP
FT                   KELKEVQDNCSGNMKMMRHCRQCRADAVGLLGEDRSQEFSKEKFLEMAPEYDMEQRATV
FT                   HEGIEKFKEELKVAKDKALAGKKIANSPKVLVAVATKGGGLVNQHFGHAKEFQIYEVGG
FT                   NEVRFIGHRKIDQYCQGGYGEEASFEHIMKAIADCKAVLVSKIGNCPQEKLQEAGIKTV
FT                   EAYDVIEKVALEFYEQYVKELGNNE"
FT   gene            complement(519989..521617)
FT                   /locus_tag="Npun_R0421"
FT   CDS_pept        complement(519989..521617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0421"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="KEGG: gvi:gll3269 probable L-sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79200"
FT                   /db_xref="GOA:B2J6Z2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z2"
FT                   /protein_id="ACC79200.1"
FT                   /translation="MVMFSLNQIPMLRRILSASLLSLIPSVASLITLEVFSPTALGQPP
FT                   AASVETKLTVPSSMNYAPFNINRYLKVPPNFSIAVYARINKARFMAVAPNGDLLVSQPS
FT                   ANKVLIVRANGSKDPIISDFVTGLRKPHDIVFHKINNTTYVYISETHQINRFIYNSGDL
FT                   TAKNRQIVVTGLPDSSTGELKGAYGHELKNIALDANHKLYVSIASTCNACKEDTISNPV
FT                   RGAVYQYNADGSNRRLFAQGLRNAEGLAFLPNTNDLWVVVNNRDNIAYPFNDGSGNYGK
FT                   IIPSYVDDHPPEEFTRVQDGGNYGWPFCNPNPDTSNGVNNMPFDRDYEFNANGKVNCNA
FT                   MDRISKGIQAHSAPLGLTFLQNTNFPSLYSNGAVAGLHGSWNRQKKTGYKIAYFPWNNS
FT                   TKAPEQEMDLVNGWLVPGTQEIWGRPVDMVVDQQGNLLISDDYSGTIYKLSYTPSAKVV
FT                   KAYRDANFAGSSQSFPTTPGVYKANQGDLKVVGNDAISSLSVPSGTVVRVCQHETGGRC
FT                   REFSPGDYKSVGADFDNIISFIEVK"
FT   gene            522152..525772
FT                   /locus_tag="Npun_F0422"
FT   CDS_pept        522152..525772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0422"
FT                   /product="putative signal transduction protein with Nacht
FT                   domain protein"
FT                   /note="KEGG: ava:Ava_4476 predicted signal transduction
FT                   protein containing NACHT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79201"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z3"
FT                   /protein_id="ACC79201.1"
FT                   /translation="MLDWLAIWGVTQAAGLIFKPILEDLAKDAAKDWAKDLLKGIPGKI
FT                   VQKLKKEDIEIAAGKALKEFLQLMQQQLKVRCKLAETEIKEYTTDIQKFISDKSVAELL
FT                   GKAFDINCESLDAKTLEDSWNRLQLKPLPSKFNWQSITEQYFTQVQELLLDSKELHHIL
FT                   ELQKLSDIEINTKEIAGVIVDFNLVKYQEGIRERYGNLKLDSLDTSGYAYNELKLWRIF
FT                   TAQNVRETHQVLPQVHELPKEHLRRLRESEQVEAVELEELERHKRVYFEQPIRSVLDVV
FT                   NKKQDYKYIVILGDPGSGKSTLLQFLALNWAESPLDNVISLPIPLLIELRTYMRRREDK
FT                   ECNNFLEFFHQCSGAVHHLNQLEVDKQLKAGNALVMFDGLDEVFEPGKREDVITDIHRF
FT                   TNDYPDVQVIVTSRIIGYKPQRLLNAEFRHFILQDLDSEQIQDFINRWHELTFTDAVDK
FT                   VRKQERLQRGIEASKSIAELAGNPLLLTMMAILNRNQELPRDRATLYDQASRVLLHQWD
FT                   VERVLIEDKRLDPKTIDYKDKQAMLRQVAYLMQTGDKGLAGNLINENDLVKVLTDYLKT
FT                   IEFDKPREVAKVMINQLRTRNFMLCFLGADYYAFVHRTFLEYFCAWEFVWQFKETQTLT
FT                   IEELKNEVFGKHWQDESWHEVLLLITGMIEAKFVGEILDYLIVQDGEEEKFVNLFLAAK
FT                   CLVEVRNRAAIASIAIQLLNQLKDLTKYDLWYYYDPRLYGAETELVQEIRTQAVTAIAT
FT                   TWQESLNTKTWLKERATQDDDNDVRRAAVEELANHFKDDPDTKSWLKERATQDDDNDVR
FT                   RAAVEELANHFKDDPDTKSILKERATQDDHENVRSAAVEGLAENFKDDPDTKSILKEHA
FT                   IQDDHEDVRCAAVEGLAKNFKDDPDTKPILKEHATQDDHENVRSAAVEGLAENFKDDPD
FT                   TKSILKERAIQDDDWYVRSAAIRELAKNFKDDPDTKAWLKQIANHDDDRLVRGAAVDEL
FT                   AKNFKDDPGTKAWLKQCATQDDDSVVRSAAIRELVKNFKDSDTKIWLKQLANYDDDSVV
FT                   RSAAIRELAKNFKDDPDTKTWLKQCATQDDNYLVRSTAAHELAKNFKDDPETKSILKEL
FT                   ATKDDDNDVRGAAVQELAKNFKDDADLFDIYYQCAVNDPFKGSHESYISNPRRIALEII
FT                   IKQYPQHPQTLPLLRDRAENDPDEQVREFAQKKLAQLSNN"
FT   gene            525911..526165
FT                   /locus_tag="Npun_F0423"
FT   CDS_pept        525911..526165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79202"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z4"
FT                   /protein_id="ACC79202.1"
FT                   /translation="MTTSINTAKVYDEIIEFIAAGTTPQSVIDFKLSDAAKDRLEDLVY
FT                   RAKTEGLTGSDQRELDHFLTLEHIMRLAKAKAHQYINPK"
FT   gene            526175..526615
FT                   /locus_tag="Npun_F0424"
FT   CDS_pept        526175..526615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0424"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   ana:alr7075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79203"
FT                   /db_xref="GOA:B2J6Z5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z5"
FT                   /protein_id="ACC79203.1"
FT                   /translation="MPRLYINAELRRLVAERAAHLCEYCLYPELDGLGFQVDHIISVKH
FT                   GGATTADNLCYACIFCNLQKGTDLGSINWQTGELVRFFNPRRDFWGDHFRLDEAVIQHQ
FT                   TDIGEVTARILDFNSDERIVERQALIASGQYPSASALKQINK"
FT   gene            526706..527182
FT                   /locus_tag="Npun_F0425"
FT   CDS_pept        526706..527182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79204"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z6"
FT                   /protein_id="ACC79204.1"
FT                   /translation="MAYQNIAATLSPQDIQEIKAALQTVQKKMPFLITLSTEERRKLVK
FT                   MGDKSLAFVNNSITAAQSNREILPATFDVEELVQDYQLAAALTELLTSMQQLTEQVDDT
FT                   LMAVGSEAMTSSLTVYDYVKTASKKTPGLKTVAEQLGERFKAIKGRPTKAASGS"
FT   gene            527187..527453
FT                   /locus_tag="Npun_F0426"
FT   CDS_pept        527187..527453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79205"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z7"
FT                   /protein_id="ACC79205.1"
FT                   /translation="MILINESLNPINEPLNSINEPLNSINEALILINESLNPINEPLNS
FT                   INESLNSINEALILINESLNSINEALNSINEFLDTSFPVYGWE"
FT   gene            528086..528826
FT                   /locus_tag="Npun_F0427"
FT   CDS_pept        528086..528826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0427"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   ava:Ava_3953 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79206"
FT                   /db_xref="GOA:B2J6Z8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z8"
FT                   /protein_id="ACC79206.1"
FT                   /translation="MQQSLDSISDPPSTKTQDSAHKSMLKNLLSGVFFEPLLSDFRIIF
FT                   ERDPAARNWLEVVFCYPGLHALCLHRLAHWLHGRGVGFIPRFISHLGRFLTGIEIHPGA
FT                   EIGQGVFIDHGMGVVIGETAIVGDYTLIYQGVTLGGTGKETGKRHPTVGKNAVIGAGAK
FT                   VLGNLQIGDRVRIGAGSIVLRNIPNDCTVVGIPGRIISRNENASLSPLEHGKLPDMEAT
FT                   VIRSLLSRVEQLEKQLQTLGVKSH"
FT   gene            528893..529123
FT                   /locus_tag="Npun_F0428"
FT   CDS_pept        528893..529123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79207"
FT                   /db_xref="UniProtKB/TrEMBL:B2J6Z9"
FT                   /protein_id="ACC79207.1"
FT                   /translation="MTNHVLQIPLSDRWRIYHRLQELKINSSCPPDGSLRVQVNNLLEV
FT                   ILIRSTVMQFLASRQELLEWLERCWYYSDES"
FT   gene            529391..529606
FT                   /locus_tag="Npun_F0429"
FT   CDS_pept        529391..529606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79208"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:B2J700"
FT                   /protein_id="ACC79208.1"
FT                   /translation="MKVQSFMATRNRDIKLLNYLHNELELSNADIAVALRHRELENGPL
FT                   PMLLWQYGLVDLEQLGKIFDWLAEHS"
FT   gene            529978..531111
FT                   /locus_tag="Npun_F0430"
FT   CDS_pept        529978..531111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0430"
FT                   /product="homocitrate synthase"
FT                   /EC_number="2.3.3.14"
FT                   /note="TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase; KEGG: ava:Ava_3956 2-isopropylmalate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79209"
FT                   /db_xref="GOA:B2J701"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2J701"
FT                   /protein_id="ACC79209.1"
FT                   /translation="MNQIIINDTTLRDGEQAAGVAFTLQEKVAIAKFLDSIGIPELEVG
FT                   IPAMGDEETRAIAAISDLGLQAKLLGWNRAVISDIKASIACGLNRVHIAIPVSGIQIAA
FT                   KFHGQWRVSLQKLKDCISFAVDQGLWVAVGGEDSSRADENFLLDVALYAQEWGASRFRF
FT                   CDTVGVLDPFTTYTKVKRLVSALMIPLEIHTHNDFGLATANALAGIKAGALSVNTTVNG
FT                   LGERAGNAALEEVVMAIKRIYGVDLGIDTPGLLELSQLVAAASGASVPPWKAIVGENTF
FT                   AHESGIHAHGVLQNPITYEPFAPEEVGWERRLVLGKHSGRHLVSNLLEQHGIFLNSQET
FT                   QSVLDAVRHQSVQKKRSLTTEELLNLVREQRYSHATR"
FT   gene            531098..531385
FT                   /locus_tag="Npun_F0431"
FT   CDS_pept        531098..531385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0431"
FT                   /product="NifZ family protein"
FT                   /note="PFAM: NifZ family protein; KEGG: ava:Ava_3957 NifZ"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79210"
FT                   /db_xref="GOA:B2J702"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:B2J702"
FT                   /protein_id="ACC79210.1"
FT                   /translation="MQRDELELNLPPAFEIGEKVRVRKLLKNDGTFPGKEVGQVLVNKG
FT                   DIGYIASIGTYLQTSYIYAVHFLETGFVVGCKKKELESVEESHESNATHE"
FT   gene            531360..531563
FT                   /locus_tag="Npun_F0432"
FT   CDS_pept        531360..531563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0432"
FT                   /product="NifT/FixU family protein"
FT                   /note="PFAM: NifT/FixU family protein; KEGG: ana:asr1409
FT                   NifT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79211"
FT                   /db_xref="GOA:B2J703"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J703"
FT                   /protein_id="ACC79211.1"
FT                   /translation="MKVMLRMNDAGTLVVYVAKKDLEEEVVKQTDGNDGKILTLANGWE
FT                   LEFRNLPDTANLPQTVEAKRLA"
FT   gene            531678..532220
FT                   /locus_tag="Npun_F0433"
FT   CDS_pept        531678..532220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0433"
FT                   /product="nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; KEGG: ana:alr1410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79212"
FT                   /db_xref="GOA:B2J704"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J704"
FT                   /protein_id="ACC79212.1"
FT                   /translation="MGDKYLTLSELNLEGQLLGFVGGEPGKYKYLQLAVPSGNVEIKLP
FT                   KELRRSLSLSLVPGQHIRICGHSKVDSRTSKIKIKAYRVTPIDGCPKQDLPPQIKARIM
FT                   VCQKGGCLKRGGKGLLSDLEKTLCDRGLLDKVTIEHTSCQKCCNSAPNCVLHLGKKKYK
FT                   NIHPDAIASLLESHLTE"
FT   gene            complement(532888..533817)
FT                   /locus_tag="Npun_R0434"
FT   CDS_pept        complement(532888..533817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79213"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J705"
FT                   /protein_id="ACC79213.1"
FT                   /translation="MKTQSLFNLLKVGITTFGIFFVAGQGAYASDLKGTAFSISLECMN
FT                   DTTGLLMGQNSTDANSWQYAFDSNKDGMNGNYWVGAAPGKVNPYDISGMAIKETATSII
FT                   VAINGNMKLTGEAEQGAVGGQIGYGDLFFNMAGKTFDNAMSSGDLFGIHFASANASGVQ
FT                   QLGVYSGVQAKTVTNIKEGYTVATYGGLAGGGNSYESQVKQGGGIVGYGDLTSSYFTNN
FT                   GKDNTFNLNVIDSGKYLSGISFLAQGNVTQQLLTTGYDASKFNGTQTIAFEFKKSGVVQ
FT                   STPEPASLAGLGIVGLALAGSKRRKKLA"
FT   gene            complement(534343..535725)
FT                   /locus_tag="Npun_R0435"
FT   CDS_pept        complement(534343..535725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0435"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="SMART: phospholipid/glycerol acyltransferase; KEGG:
FT                   ava:Ava_2310 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79214"
FT                   /db_xref="GOA:B2J706"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2J706"
FT                   /protein_id="ACC79214.1"
FT                   /translation="MADVIYQAQPPLEFIPPAFNPLFLRFVHLLLPSWINWQTPITQIE
FT                   ADNVEVLVDLYRQFQEGKIRFMLAFRHPKTDDPFCLAYLLSQLVPKIARSQGTTLQLPI
FT                   HAHFIYDRGIPLWAGSYVGWIASRLGGTPIQRGKADWTGLRSARDLFANGKFPMAAAPE
FT                   GATNGLSENISPLEPGIAQLGFWCAEDLHKAERPEQVLIVPVGIKYSYVDAPWDAIANL
FT                   LSELEAASGLPVNSAENASIESLYPRLLALAEHLLLLMEEFYTRFYHQKLPDSKIVNGQ
FT                   IPDRNEALAVRLQALLNAALLISEQYFNLQSKGSLSDRCRRVEQAGWNYIFREEFKDVK
FT                   GVSAVERALGDRVAEEANARMWHMRLVESFVAVSGNYIRENPTVERFAETTLILWQMIA
FT                   KIKGDKGVQRPQLGKQKVKITVGEPISISEHYPAYKENRLGARQAVADVTNDLQHALEG
FT                   LI"
FT   gene            535989..537803
FT                   /locus_tag="Npun_F0436"
FT   CDS_pept        535989..537803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0436"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; KEGG: ava:Ava_2311 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79215"
FT                   /db_xref="GOA:B2J707"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J707"
FT                   /protein_id="ACC79215.1"
FT                   /translation="MRLSQMLFVTLRDDPADAEIPSHKLLLRAGYIRRIGSGLYAYLPL
FT                   MWRVLQKVSQIVREEMNATGAQECLLPQLQPADLWKESGRWDTYTKAEGIMFSLIDRRE
FT                   QQLGLGPTHEEVITAIARDMIRSYRQLPLHLYQIQTKFRDEIRPRFGLMRGREFIMKDG
FT                   YSFHTDEASLKETYQDMYKAYSNILRRSGLAFRAVEADSGAIGGSGSTEFMILAEAGED
FT                   EVLYTEDGKYAANVEKAVSLPIDAETSRFTTYEKRDTPGTETIEKVCQLLNCSPTQLVK
FT                   NVLYQTVYDNGKTVLVLVSIRGDQEVNEVKLQNELTKLASEYGAKTIISLNVPNVEAQQ
FT                   AWTTKSLPLGYIAPDIADEYIAANKQIHSKFLRLVDQTAVDLKNFVTGANEAGYHVVSA
FT                   NWDEQFKLPERVVDIRKSRPGDRAIHNPEQTLQSARGIEAGHIFQLGTKYSQAMGATYT
FT                   NEQGEEKPLLMGCFGVGVSRLAQAAVEQSYDNDGIIWPVAIAPYHAIVTIPNIKDAQQV
FT                   EVAQKLYTELNQAGIETLLDDRDERAGVKFKDADLIGIPYRIVTGRAIANGKVEVVERA
FT                   TRKSQEIVIDEVTTTLQQWITAAIDVKN"
FT   gene            538131..538742
FT                   /locus_tag="Npun_F0437"
FT   CDS_pept        538131..538742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr5055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79216"
FT                   /db_xref="GOA:B2J708"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B2J708"
FT                   /protein_id="ACC79216.1"
FT                   /translation="MKDQQGSNRISSGTIAAVSAVVVAVGGGVAWFTTHSSNPPTPSNP
FT                   SGPIAQPAQPSTRQPANEQSPNVYWLRPKDKSVALVPQPVKVASIRASQPLEAAFQSLL
FT                   AGPTEGTDSTTIPKGTKLLGLKSENDEVHVNLSEDFTSGGGSTSMMGRVGQVVYTATSL
FT                   NPKAKVYIDVNGKPLDVLGGEGVELQQPLTRESFEKNYQL"
FT   gene            complement(538807..539154)
FT                   /locus_tag="Npun_R0438"
FT   CDS_pept        complement(538807..539154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0438"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: ava:Ava_2313
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79217"
FT                   /db_xref="GOA:B2J709"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2J709"
FT                   /protein_id="ACC79217.1"
FT                   /translation="MKQTLPLPPEVVQQVAEYFSLLSEPMRLRLLHLLRDEEKCVQELV
FT                   EATQTSQANVSKHLKVMWQAGILSRRSEGTCAYYRVEDEMIFDLCNRVCDRLATRLEEQ
FT                   ARNFRVLNSKR"
FT   gene            complement(539230..539787)
FT                   /locus_tag="Npun_R0439"
FT   CDS_pept        complement(539230..539787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0439"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: ava:Ava_2314 acetyl-CoA
FT                   biotin carboxyl carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79218"
FT                   /db_xref="GOA:B2J710"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B2J710"
FT                   /protein_id="ACC79218.1"
FT                   /translation="MPLDFNEIRQLLATIAQTDIAEVTLKSDDFELTVRKAVSVSNQML
FT                   SVGQATFGGVVGSGLTSGSSGGNQVNASQVTEVSTSRVFENTGTSTQLQLSVNPPSIID
FT                   QRLVEVPSPMVGTFYRAPAPGEAAFVEVGDRVRKGQTVCIIEAMKLMNEIEAEVSGQVM
FT                   EILLQNGDAVEYGQPLMRINPD"
FT   gene            complement(539896..540453)
FT                   /locus_tag="Npun_R0440"
FT   CDS_pept        complement(539896..540453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0440"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; Elongation factor P/YeiP-like; KEGG:
FT                   ava:Ava_2315 elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79219"
FT                   /db_xref="GOA:B2J711"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J711"
FT                   /protein_id="ACC79219.1"
FT                   /translation="MISSNDFRPGVSIVLDGSVWRVLEFLHVKPGKGSAFVRTKLKNVQ
FT                   SGSVMEKTFRAGETVPQATLEKSTMQHTYKEGDEFVFMDMETYEEGRLTRTQIGDRVKY
FT                   LKEGMEAEVIKWGDQVLGVELPKSVVLEIVQTDPGLKGDTATGGSKPATLETGAIVMVP
FT                   LFISQGERIKVDTQEDKYISRE"
FT   gene            540668..541795
FT                   /locus_tag="Npun_F0441"
FT   CDS_pept        540668..541795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0441"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: ava:Ava_2316 peptidyl-prolyl
FT                   cis-trans isomerase, cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79220"
FT                   /db_xref="GOA:B2J712"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B2J712"
FT                   /protein_id="ACC79220.1"
FT                   /translation="MLHLSYPMLNLLKSWLKNSLMAILLVTIFLGITTAGWTPSSSAAL
FT                   PAGNAITDGKALLRYALPIDNKPVRQLQASLEDISAQLRANRRWGAISKDISKASRILD
FT                   KPSQILTSVPTERQPQVEAWITELKSGVGKLEELANNKDKEQILQERGKLLNLVTQIEE
FT                   SMVKEFPFEVPAQYSNLPQLKGRATVEFKTNKGDLTVVVDGYSAPVTAGNFVDLVQRGF
FT                   YNGLEFTRSEESYFLQTGDPAGKDVGFIDPKTGEYRAIPLEVLVQGDKTPTYGITLEEA
FT                   GRYVDMPVLPFSAFGAVVMARPESEVNGGSSQFFFFLFEPELTPAGRNLLDGRYAVFGY
FT                   LTEGKEVLDKLKAGDKIESAKVVQGIENLVEPQAA"
FT   gene            complement(541955..542377)
FT                   /locus_tag="Npun_R0442"
FT   CDS_pept        complement(541955..542377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0442"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ana:all5060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79221"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J713"
FT                   /protein_id="ACC79221.1"
FT                   /translation="MMMVGKLELMNPPTIEHFLIVDSLDTAFKAEIKRCSSPWLCFRES
FT                   GVRTGRNKSRLTDLCVVTVEQARELLNASAVFQSPPLLIVEVVSPESVKRDYRHKRSEY
FT                   AALEVPEYWIVDPLKAKVSVLLLEDGFYEETVFTGT"
FT   gene            542516..543538
FT                   /locus_tag="Npun_F0443"
FT   CDS_pept        542516..543538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0443"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein; KEGG: ana:alr5061
FT                   thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79222"
FT                   /db_xref="GOA:B2J714"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B2J714"
FT                   /protein_id="ACC79222.1"
FT                   /translation="MNSNFSSQQVQDIGEQGLLERLQRFCPSEIIGDDAAVLVTAPEQS
FT                   LVVTTDVLIDGVHFSNLTTSPEDAGWRAAAANLSDLAAMGASPLGITVGLGLPGEVRVS
FT                   WVERLYQGITECLQKYNTSIVGGDVVRSPVTTLAITAFGQVSPYRIIRRSAAVIGDAIV
FT                   VTGVHGASHAGLELLLHPQLGQSLKDVERMALTRAHQRPQPRLDVLPILCKILASPSPI
FT                   PIAGMDSSDGLADAIIQICRASGVGAVLERRQISMPAAFDHWLTEEQALAYALYGGEDF
FT                   ELVLCLPQKSALALVQHLGQDAAIVGNITPGSTVLLHDEQKKFPDQVLSLSQGFQHFSQ
FT                   "
FT   gene            complement(543606..544619)
FT                   /locus_tag="Npun_R0444"
FT   CDS_pept        complement(543606..544619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0444"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase;
FT                   KEGG: ava:Ava_2318 glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79223"
FT                   /db_xref="GOA:B2J715"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J715"
FT                   /protein_id="ACC79223.1"
FT                   /translation="MIRVAINGFGRIGRNFARCWVGRENSQIDLVAINDTSDPRTNAHL
FT                   LKYDSMLGKIKGAEISADDNSIIVNGKTIKCVSDRNPEKLPWRDWGIDLIIEATGVFTS
FT                   KEGALKHVNAGAKKVLITAPGKNEDGTFVVGVNHHDYDHNIHNIISNASCTTNCLAPIA
FT                   KVLNDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAINIVPTSTGAAKAVALVI
FT                   PDLKGKLNGVALRVPTPNVSMVDFVVQVEKRTITEEVNQALKDAAEGPLKGILDYSELE
FT                   LVSSDYQGSDASSIVDSSLTLVMGNDLVKVMAWYDNEWGYSQRVLDLAELVAEKWQ"
FT   gene            complement(544736..545404)
FT                   /locus_tag="Npun_R0445"
FT   CDS_pept        complement(544736..545404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0445"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase; KEGG: ava:Ava_2319 probable
FT                   nicotinate-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79224"
FT                   /db_xref="GOA:B2J716"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J716"
FT                   /protein_id="ACC79224.1"
FT                   /translation="MKLFFNCIKPRHNWMQQLAIFGGTFDPIHWGHLLIAETAMQEVSL
FT                   EKVIWVPSLNPPHKEAALFEHRVEMLQLAIKDNPAFTVSLVEANRSGTSYAINTLIDLS
FT                   ACYPNTHWYWIVGLDTFQTLPRWYRGHELAQMCDWLIAPRLLGGETITQSKLICKQVEQ
FT                   QMREQSYTIYWQLLNIPLVGVSSSLIRKLCRERQSIRYLVPEAVRSYITNNSFYSNKSE
FT                   "
FT   gene            545766..547211
FT                   /locus_tag="Npun_F0446"
FT   CDS_pept        545766..547211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0446"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: ava:Ava_2320
FT                   UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79225"
FT                   /db_xref="GOA:B2J717"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J717"
FT                   /protein_id="ACC79225.1"
FT                   /translation="MTNSVDFSGRPFHFIGIGGIGMSALAYVLAKRQFPVSGSDLRPNH
FT                   ITHKLESIGAHIFGRQEASNLEFFRPQVLNSQEQLAADTKSKLPQVICSTAINTNNLEY
FT                   KAALELGCPVLHRSDVLAALIADYYSIAVAGTHGKTTTSSMIGYMLLEAGLDPTILVGG
FT                   EVNAWEGNARLGQSQYLVAEADESDGSLVKHAPEIGIITNIELDHPDHYDTLEEVIDIF
FT                   QTFAKGCKTLIGSIDCATVRDRLQPTISYSLHSDTDADYTVTNIDYRADGTTALVWERG
FT                   KALGVLKLRLLSRHNLSNALAAVAVGRALGLEFGAIAKGIATFEGARRRFELRGEVDGI
FT                   TFIDDYAHHPSEIRVTLAAARLQARPGQRVVAIFQPHRYSRTLTFLEEFAESFTHADLV
FT                   VLTDIYSAGEPNLGQITGEQLAAEIAKQHSQVVYQPTLPSVCEYLLQTLRPGDLALFLG
FT                   AGNLNQVIPEVITAFCEPAKATS"
FT   gene            547337..548335
FT                   /locus_tag="Npun_F0447"
FT   CDS_pept        547337..548335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0447"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; KEGG: ana:alr5066
FT                   UDP-N-acetylenolpyruvylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79226"
FT                   /db_xref="GOA:B2J718"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J718"
FT                   /protein_id="ACC79226.1"
FT                   /translation="MTISQAAGNVCTVSALNTKKHQTTNSVDSEVIYLPNTDCTIKSQA
FT                   CLSAFTSYRVGGAADLYVAPRNLEALQASLKYAKEGDLKVTTLGAGSNLLVSDGGISGL
FT                   VIATRHLRFSHFDPQTGQLTVAAGESIPSLAWAAAELGWQGLEWAVGIPGTAGGAVVMN
FT                   AGAHNSCIADMLVSAEVLSPDGTLETLTPEQLGYSYRTSLLQGGDRIVTQATLQLAPGA
FT                   DPAKVVAITKEHKKHRLSTQPYNFPSCGSVFRNPKPYSAGWLIEQTGLKGYQIGGAQVA
FT                   LLHANFIVNRGGAKASDIFCLIRHIQHQVQERWSINLEPEVKMLGEFQGAC"
FT   gene            548515..548862
FT                   /locus_tag="Npun_F0448"
FT   CDS_pept        548515..548862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0448"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   ava:Ava_2322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79227"
FT                   /db_xref="GOA:B2J719"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J719"
FT                   /protein_id="ACC79227.1"
FT                   /translation="MTGKGQGFGFGLGKMKELADAFKKAQQVQEGAKRLQEELEQMEIL
FT                   GESGGGLVKVIVSGNQEPKRVEISPDALAEGAEVLSDLVTVAMKEAYNKSTATMRERME
FT                   ELTSGLELPGF"
FT   gene            549061..549570
FT                   /locus_tag="Npun_F0449"
FT   CDS_pept        549061..549570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0449"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: ava:Ava_2323 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79228"
FT                   /db_xref="GOA:B2J720"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2J720"
FT                   /protein_id="ACC79228.1"
FT                   /translation="MTIDKGQKTSMPYKLLFVCLGNICRSPSAENIMNHLIEQAGLSDA
FT                   IICDSAGTSSYHVGSPPDRRMSAAAATKLGIKLRGQARQFQKSDFQDFDLILAMDQENY
FT                   ENILTLDRTEQYQHKVRLMCEFCSRHTLKEVPDPYYGGQDGFNQVIDLLIDACEGLLTK
FT                   VKSEEF"
FT   gene            complement(549597..550280)
FT                   /locus_tag="Npun_R0450"
FT   CDS_pept        complement(549597..550280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0450"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: ana:all5069 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79229"
FT                   /db_xref="GOA:B2J721"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2J721"
FT                   /protein_id="ACC79229.1"
FT                   /translation="MPLTILVVDDDLGTRLSVSDYLELSGYSVITANDGQEALFMVDEY
FT                   NPDLIVTDIIMPQMNGYELVRRVRQQAMFRLLPVILLTARTKTQERILGYQSGCDLYLP
FT                   KPFELEELAAAIRNLLERSQIIQSEYRFSHKESLGISGLTKPGDAHNSLSTQIQTSHLH
FT                   SSLTHREQEVLELLTHGLSNADMGHQLHLSPRTVEKYVSSLLRKTSTSNRAELVRFAMK
FT                   HGLVE"
FT   gene            550975..551442
FT                   /locus_tag="Npun_F0451"
FT   CDS_pept        550975..551442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0451"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: ava:Ava_2325 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79230"
FT                   /db_xref="GOA:B2J722"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J722"
FT                   /protein_id="ACC79230.1"
FT                   /translation="MSDKNEGYKVIADNRQARYLYEILETYEAGIELTGTEVKSIRAGK
FT                   VNLQDGYALLRNGEAWLINIHISPYNASGQYFNHEPRRTRKLLLHRQELRKLIGKVEQQ
FT                   GLTLIPLKMYLKRGWVKVSIALGKGKKLHDKREDLKRRQDQRDIQRAMKSY"
FT   gene            551582..551902
FT                   /locus_tag="Npun_F0452"
FT   CDS_pept        551582..551902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr5071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79231"
FT                   /db_xref="GOA:B2J723"
FT                   /db_xref="UniProtKB/TrEMBL:B2J723"
FT                   /protein_id="ACC79231.1"
FT                   /translation="MVSNFGWHKELSQLMKSNFITAVGAGILTLSMGILPLTLSAQAQT
FT                   TTDPGANTAPRTTTYDRNDFDWGWLGLLGLFGLAGLAGKKRDNEPTAYRDPNAPGATTY
FT                   RD"
FT   gene            complement(551966..553393)
FT                   /locus_tag="Npun_R0453"
FT   CDS_pept        complement(551966..553393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0453"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ana:all5073
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79232"
FT                   /db_xref="GOA:B2J724"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B2J724"
FT                   /protein_id="ACC79232.1"
FT                   /translation="MFFMNLVWQLFTLSSLPLKEYLATSYVHRSLVGLLSSWRQTSVLI
FT                   QWGDAIAAVLLSSIYALAPFASSTLVGLLLVACVGFWLLLTLSDEVTPANVSSVTPIHL
FT                   LVLLYWGIAVIATALSPVKKAALNDLGTLTLYLLLFALCARVLRSPRLRSWILTLYLHV
FT                   SLIVSVYGLRQWFFGATALATWVDPESPLSKTTRVYSYLGNPNLLAGYLLPAVIFSLVA
FT                   IFAWQSWLKKALALTMLIVNTACLILTFSRGGWIGLVVAVLAVMALLVFWKSVEMPPFW
FT                   RTWSLPIVLGGLIGILLLAVIFVEPVRLRVFSIFADRQDSSNNFRRNVWDAVFEMIRDR
FT                   PIFGIGPGHNSFNKVYPLYQHPRYTALSAYSILFEVTVETGFVGLACFLWLIIVTFNTA
FT                   LLQVRRLRRLRSVEGFWLIGAIAILLGMLAHGTVDTVWYRPEVNTLWWLIVALIASYWT
FT                   PLTQNQTNPSNPEPAVN"
FT   gene            complement(553580..555133)
FT                   /locus_tag="Npun_R0454"
FT   CDS_pept        complement(553580..555133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0454"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; histidine kinase A domain
FT                   protein; KEGG: ana:all5074 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79233"
FT                   /db_xref="GOA:B2J725"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J725"
FT                   /protein_id="ACC79233.1"
FT                   /translation="MIEPENKLFALKDGWDSHESREQQRLKALSDLGLRQPETIPVFEE
FT                   ATQTAAHFLEAPISILGFVDQERHWFKSAVGLSRLGLMNHLAQSRQLSRRESFCTQVVE
FT                   SLQIFVINDTHKLTDPVLVSSKLVQDYGIRAYLGAPLIDAEGHCLGALAVMDLVPRNFT
FT                   TRDIEFLQIIARWSMSEFERNRLLQGKLESTTLKTAPIFSLNDERNTEIKITAPTQDND
FT                   SVSTKQLKLELLGQLTQELRTPLTSVLGMASVLGREIYGPLTTKQREYLEIIQHSGRYL
FT                   LSLVNEITELGAMDDNSTVLNLAPVDIEMLCQQAINTLEEVANRREQDIRLSIEPGRNR
FT                   IWPLDKDKVRQMLYHLVFSVIQLSATGSIVRIHVSYKEDTLNITIWVSHPWLGDGITEV
FT                   DPYFRLNSLSLLELTGEVATYNTHTEGQQQLDTSSVAVDNSKSLSDSHSNFLAASSGLN
FT                   LAKLHGSLSRESLGLLLSCQLAELHAGQILIQGSPESGYRYVLSLPLQLATPSQAISDV
FT                   "
FT   gene            555685..556878
FT                   /locus_tag="Npun_F0455"
FT   CDS_pept        555685..556878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0455"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: ana:all0498 DegT/DnrJ/EryC1/StrS family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79234"
FT                   /db_xref="GOA:B2J726"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J726"
FT                   /protein_id="ACC79234.1"
FT                   /translation="MNKMAVRVPFVDLKLQHEPIQMQLQYAIQSVLEQGDFILGQALSD
FT                   FEAAFAAVSEAAYGVGVASGTDAIALGLQACNIGAGDEVILPANTFIATLIGVIRAGAK
FT                   PILVDCDRQTALIDLEAAAKAITPQTKAIIPVHLYGQMVSPRELIKFADTYKLLIFEDA
FT                   AQAHLAQRDGYHAGSVGIAAAFSFYPSKNLGAFGDGGMLLTRNSDVAQKMGRLRNYGAS
FT                   QKYFHTEPGTNSRLDTLQAAILHQKLPYLPQWNRDRLTIAQQYDLELAPLATTGIIPIE
FT                   NQSDTGHVYHLYVIKVDDSCPIERQQLQEKLTAVGIQTGIHYPIPCHLQPAFSNLGYQP
FT                   GDFPQAEKLSQQILSLPMYPGLSSSQVKEVVAAIAHAVSTTSKVDETSNADLDSVVA"
FT   gene            556972..557865
FT                   /locus_tag="Npun_F0456"
FT   CDS_pept        556972..557865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0456"
FT                   /product="eight transmembrane protein EpsH"
FT                   /note="TIGRFAM: eight transmembrane protein EpsH; KEGG:
FT                   ana:all0497 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79235"
FT                   /db_xref="GOA:B2J727"
FT                   /db_xref="InterPro:IPR013426"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="InterPro:IPR026492"
FT                   /db_xref="UniProtKB/TrEMBL:B2J727"
FT                   /protein_id="ACC79235.1"
FT                   /translation="MALQQQIKKRNASDLLNLAIIGVLLLLYAPILLHWLDGWLNKNIS
FT                   TEHEYFSHGIIGLPFAAYLAWMNRKKWTRLPETIHPLSAVLLLLGAVFYLSGVTEWVNL
FT                   SLPVILAGLCLWFKGIAGLRSQGFPLLLVFLATPTAAPYLIAPYTLPLQSFIAGTAGFI
FT                   LNQFGMDVTVNETNLYVGGRIVEVAPYCAGLKMLFTTLYVGLMLLYWTDALSSRRTTIS
FT                   FLSLAAIVSTIANIIRNTLLTFFHGTGQEAAFKWLHEGWGGDLYSACMLVSLVPLLNWI
FT                   NNYFSTSLETEQETES"
FT   gene            558086..558808
FT                   /locus_tag="Npun_F0457"
FT   CDS_pept        558086..558808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0496 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79236"
FT                   /db_xref="InterPro:IPR030917"
FT                   /db_xref="UniProtKB/TrEMBL:B2J728"
FT                   /protein_id="ACC79236.1"
FT                   /translation="MISFSKFFKENQFNQVAALLLLLLLLAIGGVPGYLTGHWQWKQPL
FT                   PVTNLHELKQIRNAGLALPGWQTIEQAEQEIGEHKWSLQVLKKEGSQSQAILLLLPQNG
FT                   PMDQPEVEWTDVNGWGRSRWGKWDIAQSRSAVFTVKPSGKLASNVESKVEARFFRAATP
FT                   QQTFAVLQWYAMPDGGNPSPFHWFLADQLAQWRKQRIPWVSVSILIPMEPLGQVETSWS
FT                   LAKSMGKTVQSTLMAGPL"
FT   gene            559169..560533
FT                   /locus_tag="Npun_F0458"
FT   CDS_pept        559169..560533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0458"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   ava:Ava_2909 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79237"
FT                   /db_xref="GOA:B2J729"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B2J729"
FT                   /protein_id="ACC79237.1"
FT                   /translation="MFIDPTSYMRAFSALCFISLQVGVFLTTPIQLVLAQPFPSQGQSP
FT                   RQPPSPVPGTETEVIPTGTNDETSSQLSRYLLGPGDIIGVVLQRPPGPYRLGIGDGISV
FT                   SVQRFPDLSFQALINPEGNIVVPLLGTVSLQGLTLEEAQEKIRLGLNRYVVDPVIVLAL
FT                   AAQRQDLSFQAVISPEGNIVVPQVGTVSLQGLTLEEAQEKIRLGLSRFFPDPIVVVSLA
FT                   GTRPVQVTVSGEIFRPGIYPINSATPRVADALLISGGSTLNADLRQIQVRRKLIDGSVI
FT                   SQTIDLYAALQNGGSIPNLRLQDGDAILVPRREVGNDDGYDRNLVARSSLATPQIRVRV
FT                   LNYAAGGLSIQALPNGSTFVDALGGVNLDTANLRDIALVRFDPEQGKAVTQKLDAKKAL
FT                   GGDASQNVALQDNDVIVVGRNLIGRITNFLTTITQPFFNVQSFLRFFDNFGGGSN"
FT   gene            560745..562919
FT                   /locus_tag="Npun_F0459"
FT   CDS_pept        560745..562919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0459"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="KEGG: ava:Ava_2908 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79238"
FT                   /db_xref="GOA:B2J730"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J730"
FT                   /protein_id="ACC79238.1"
FT                   /translation="MTPPIVKRYLIAFDKYKWIGLASFGLVIVGSTLVAMQPEPPTSYI
FT                   ASGALTYSGPPVSFSATGTEIQQQGKELNQEVLLSNQIIAGVAEKVGVKPTKLGNSVVL
FT                   SVPKKNPRTGELETSLLELKYVDTDPKRGIQVLAELMQAMIKLSSDINTGRLQAIIEKI
FT                   NDRVPQAKRELQVAEKKLEQYDRIERTAILAAENGSLLSAVTASQNLQRQMQLTISGVD
FT                   GQIRSLQNKLGLTVGQAYVSSALSADPIIGNLRAQIYQSESQIAVLKKDLRPEHPTMVQ
FT                   LMRQKQAAEELLQQRASEVLGGDGTAAPLQGSVAGIRTQSSLDPARQQLANQMVALQTQ
FT                   RETLQQQLIQEIQQEARLRQEYSLIPNKQLERSRLEQEVALKKSIYDQMQVKLTDAKTA
FT                   EAETTSSLSIARRPTAAADIKPPKSVPITLAVGGFLGVVIGGGVIFLLGALEGTFKTRE
FT                   DIRESLKQREVAVLGELPLMPVDDLDKEAVPVVISADSPYLEFYEKFRSNLRRIGGKNL
FT                   KVVLITSTSSLEGKTASAYNLGIASARAGKRTLIIETDLRSPSRSTSLKVIPDPDATIE
FT                   PLRYYANLSECIRLVPDVENLYILPSPGPVRQSAAILESSEMRRLIEDVRQRFDLVILD
FT                   TSPLSISNDPLLIQPYSDGIVLVTRPHYTQENMLGEAVDQLVEAELGLLGAIINGADII
FT                   VSVPEEVAQSSTFTSEVEKSEEVSASASKN"
FT   gene            complement(563058..563729)
FT                   /locus_tag="Npun_R0460"
FT   CDS_pept        complement(563058..563729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0460"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ava:Ava_1771
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79239"
FT                   /db_xref="GOA:B2J731"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B2J731"
FT                   /protein_id="ACC79239.1"
FT                   /translation="MFPLYDENPTRITPYFTYGLIGINIVVFLHEVSLSNAQLSQFLSQ
FT                   YAVVPQELTTNLNGEWITLFTSQFLHGGWWHLISNMLFLWVFGNNIEDRLGHAKYLIFY
FT                   LACGALAALCQWFIGMNSEIPSLGASGAISGVLGAYIIRFPHAKVMTLVFLGIFITTIR
FT                   IPALVIIGLFFVQNVISGLATLQTAAHMTVQTGGVAYWAHIGGFVFGVILAPVFGLFRQ
FT                   D"
FT   gene            complement(563850..564569)
FT                   /locus_tag="Npun_R0461"
FT   CDS_pept        complement(563850..564569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0461"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ava:Ava_2108
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79240"
FT                   /db_xref="GOA:B2J732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B2J732"
FT                   /protein_id="ACC79240.1"
FT                   /translation="MVPISDNNPTKITPYVTYGLIAANVLAFLYEASLPPQALNGFLHL
FT                   AAVVPRELTLSFGGISIHQPVPEWATLITSQFLHGGFLHLAGNMLFLWIFGNNVEDKLG
FT                   HAKYLLFYLSCGVLAALTQWFFAQDSSIPSLGASGAIAGILGAYILRFPNAEVLGIVPL
FT                   GIFFPTFRVPAYFFLGFWFLEQAFYGLASLETRTNIGMESGGIAYWAHAGGFIFGAILG
FT                   PLLGLFNDKSQEESWYK"
FT   gene            complement(564663..565451)
FT                   /locus_tag="Npun_R0462"
FT   CDS_pept        complement(564663..565451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0462"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.206"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ava:Ava_3338 tropinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79241"
FT                   /db_xref="GOA:B2J733"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J733"
FT                   /protein_id="ACC79241.1"
FT                   /translation="MSDAYGGLSLRWTLRGKKALITGATKGIGLAVANEFLSLGAEVII
FT                   VARNSQDVDQQLIIWRELGLPAYGITADVATAEGRQAIFEQVGKTWDKLDILVNNVGTN
FT                   ISKKVLDYTAAEYQFIIQTNQISIFEMCRLFYPLLQNRENSSIVNISSVAGLVSNRTGA
FT                   PYGMTKAAINQLTRSLSVEWACDQIRVNTVAPWAIRTPLTESVLDNQDFLKLVLSQTPM
FT                   GRVGQPEEVAGLVAFLCMPAASFITGQCITVDGGFLAFGF"
FT   gene            565604..566224
FT                   /locus_tag="Npun_F0463"
FT   CDS_pept        565604..566224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0463"
FT                   /product="expressed protein"
FT                   /note="KEGG: ava:Ava_2106 expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79242"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B2J734"
FT                   /protein_id="ACC79242.1"
FT                   /translation="MFFSNSQENQLQRWNETIRNQPENPNAYIRRGMVNFQLAKIDESI
FT                   KDFDIAEELDSRIKPYLWQRGLSYYYAERFAEGTEQFEIDLTVNAQDVEETVWRYLCIA
FT                   RSLGVEEVRKSLLTVKNDPRRIMQRVYDLYAGDCTPDDVLTVGQSEGIKGNFYSHLYLG
FT                   LYYEVENNIGLAQEYIVKAADNYKIDDYMWYLAQVHKILRGWI"
FT   gene            complement(566238..566840)
FT                   /locus_tag="Npun_R0464"
FT   CDS_pept        complement(566238..566840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0464"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ana:all2438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79243"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J735"
FT                   /protein_id="ACC79243.1"
FT                   /translation="MVALPDRILMSAEEYLVWESTQEERYEYWDGEVVMMSGATRNHNR
FT                   ISANFFKLLDDALADVYDGLRLRTCEVYIVDVKVQLEPGQKYFYPDVVVTCDERDRDPQ
FT                   LVQFPCLIIEVLSPSTEAADRGKKFAKYRQSPTLQEYVLVQIAQPGVEVFRRNEQGKWV
FT                   LSEYNLDEILRLESVDVEIAIIDLYRQVQFESEATEN"
FT   gene            complement(566982..567308)
FT                   /locus_tag="Npun_R0465"
FT   CDS_pept        complement(566982..567308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0465"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   mlo:mll1854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79244"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2J736"
FT                   /protein_id="ACC79244.1"
FT                   /translation="MAVYLIADVKVTDDAWISDYATNVHDIVHNHGGKYLSRSGNITTI
FT                   EGEELGTTLLALLEFPSAEAVQAFVNDPAYAKYRQARQAGSISRFHIIDDTDAAGTIPY
FT                   LPKG"
FT   gene            complement(567636..568196)
FT                   /locus_tag="Npun_R0466"
FT   CDS_pept        complement(567636..568196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0466"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ava:Ava_1502 protein of unknown function DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79245"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B2J737"
FT                   /protein_id="ACC79245.1"
FT                   /translation="MLTNIRLISVQEYHKMAEMGIFHPEERLELIAGQIIRMSAKGTAH
FT                   ESAITRTERLLRQRLGDKVLLRIQSPVQLDDYSEPEPDISVVNLNPLDYEDRHPNASEV
FT                   FLLIEIADSSLKYDREVKAIAYSKSGIIEYWILDVNGRKLYMYRLPSPDGYHSESILAE
FT                   DVTISPLAFPDCAIAIRELLRKI"
FT   gene            complement(568207..570258)
FT                   /locus_tag="Npun_R0467"
FT   CDS_pept        complement(568207..570258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0467"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: ana:all1132 excinuclease ABC subunit B;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79246"
FT                   /db_xref="GOA:B2J738"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B2J738"
FT                   /protein_id="ACC79246.1"
FT                   /translation="MDTGRNRHHEIGYFQQNCMTEFCLQAPFSPTGDQPQAIAQLTASI
FT                   QSGNRYQTLLGATGTGKTFSVAAVIEKIGKPTLVLAHNKTLAAQLCNELRDFFPNNAVE
FT                   YFVSYYDYYQPEAYIPVTDTYIEKTAAINDEIDMLRHSATRSLFERRDVIVVASISCIY
FT                   GLGMPAEYLKAAIPLQIGMEVNQRQILRDLANVQYSRNDIEMGRGKFRVRGDVLEIGPA
FT                   YEDRIIRVEFFGDEIDAIRYIDPVTGEILKSLEAVNIYPARHFVTPEERLEVACHDIAA
FT                   ELKQQKLDLEQAGKLLEAQRIDQRTRYDLEMLREVGYCNGVENYSRHLAGRQAGDPPEC
FT                   LIDYFPKDWLLIIDESHVTVPQIRGMYNGDQARKKVLIEHGFRLPSAADNRPLKAEEFW
FT                   QKVNQCIFVSATPGTWEIEVSEDHVIEQVIRPTGVVDPEISVRPTEGQIDDLLGEIKDR
FT                   ADRHERVLITTLTKRMAEDLTEYLQDRSIRVRYLHSEITSIERIEILQNLREGKFDVLV
FT                   GVNLLREGLDLPEVSLVAIMDADKEGFLRTERSLIQTIGRAARHVQGQAILYADNMTGS
FT                   MIKAIDETDRRRGIQTAHNRLHGITPQPIVKKSSNAILAFLDVSRRLNATDLKVVDEHI
FT                   DELPLEQIPGLITLLEAQMKEAAKKLEFEEAGKLRDRIKHLRDKMLGR"
FT   gene            570458..570916
FT                   /locus_tag="Npun_F0468"
FT   CDS_pept        570458..570916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79247"
FT                   /db_xref="UniProtKB/TrEMBL:B2J739"
FT                   /protein_id="ACC79247.1"
FT                   /translation="MAISSTGKAISSRQNNAKSSGETTEEVENQQDQSLNADKIEEKLP
FT                   VGASGTLAISGIRPIGPSDLEVAEKLSIAGVRPVSTSTLEVVETYDSMGIRPIGANTFQ
FT                   VVESINLSGIRPIASSALIISESYSTFGNRPIASNEIDNSESLMGFLD"
FT   gene            571267..571449
FT                   /locus_tag="Npun_F0469"
FT   CDS_pept        571267..571449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0469"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: ana:asr1134
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79248"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B2J740"
FT                   /protein_id="ACC79248.1"
FT                   /translation="MSIEDRAKAAAKNVEGKAQEALGNVTGDPEDKAKGKAKQAESEVR
FT                   HGIEDVKDNVKKNIG"
FT   gene            571757..572197
FT                   /locus_tag="Npun_F0470"
FT   CDS_pept        571757..572197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J741"
FT                   /protein_id="ACC79249.1"
FT                   /translation="MILFQQSRKILATFFLIGVLLITTACGGATVSQVDRTTTPSAIGR
FT                   DVTYAELERGNTPGGQTFGTWVVQTSQGLVQDAYVRDNNKLGVVVSSKVRPNEVRPLAK
FT                   SLVQGFHKNFPNQDLKVLVYAPDKKLILTTEYDTQTNQVKYS"
FT   gene            572303..572824
FT                   /locus_tag="Npun_F0471"
FT   CDS_pept        572303..572824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79250"
FT                   /db_xref="UniProtKB/TrEMBL:B2J742"
FT                   /protein_id="ACC79250.1"
FT                   /translation="MASSEQYKRQIMKDLAQGDVESLDDTTAESTAEYQNFDDFAQRTT
FT                   PDQRRQLFGRSLHPDRIPTSQMEPELQNAIAQIKPNERDDVARAFFKHLKERKLDEKHL
FT                   EQQLGLSTHHASRMTADDVSKLASFAYHNHPDIFREVLAEQPGIIKFLSNPVVAGILGI
FT                   AAAKWLGGRK"
FT   gene            573079..573717
FT                   /locus_tag="Npun_F0472"
FT   CDS_pept        573079..573717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0472"
FT                   /product="Phosphoglycerate mutase"
FT                   /EC_number="3.1.3.73"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ana:alr1107
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79251"
FT                   /db_xref="GOA:B2J743"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2J743"
FT                   /protein_id="ACC79251.1"
FT                   /translation="MSLTLYFLRHGQTECSRNNSFCGSIDSELTPEGLDMAKAFADAYT
FT                   SKDWTAIFCSPMRRTVLTAKPLCEAINIEPQLRDGLKEINYGKWEGKTPEVISREYHDD
FT                   YIRWSADPAWNAPTGGEMAVTIASRALQVIEEIKQNYTSGNVLVVSHKATIRILLCSFL
FT                   GIDVGRFRFRLGCPVASVSIVEFSSHGPLVKVLAERSHLDERLRNLAGT"
FT   gene            complement(573762..574199)
FT                   /locus_tag="Npun_R0473"
FT   CDS_pept        complement(573762..574199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79252"
FT                   /db_xref="GOA:B2J744"
FT                   /db_xref="UniProtKB/TrEMBL:B2J744"
FT                   /protein_id="ACC79252.1"
FT                   /translation="MNAQLTSVEIQELQQLLPNDTPAQHALTTLQQHNGNLEASFDTLW
FT                   QEKVGKTDYSRGKKSLLQLTLDEIRAEICGDDGLRGTIKEYTKNPGSSSLLNSIIGSLV
FT                   AVAAVHGIPIDGAIATIVVLYILKIGINVFCKYTEPDSKPE"
FT   mobile_element  complement(574222..575639)
FT                   /mobile_element_type="transposon"
FT   gene            complement(574248..575474)
FT                   /locus_tag="Npun_R0474"
FT   CDS_pept        complement(574248..575474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0474"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: ana:alr7305 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79253"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B2J745"
FT                   /protein_id="ACC79253.1"
FT                   /translation="MPSNPLLHFITKVINIEDIKVLNYDFITDDEIVIEIQNQSKVGQC
FT                   PRCGKTTNKTHQNHWYIVRDIPMSDYQVFLKVNRRQLKCTECQKVFSEKLSFVKSRRTY
FT                   TKRLANKVIKEVLETDVENAARRNRMSSSEIETILKELESELLKEKPNQIKKLGIDEIT
FT                   QLKGGKNYAAVLVDLETRRPIALLEKRNKAVIAEYLSSLGSEILNQIEEVSIDLWIPYK
FT                   SLIQEMLPNAQVVADRFHVMKQINQELDARRKQEKRAALKIKNRQEREKKLTGLTHSKY
FT                   PLLKKKECLSFQEQAQIDLLKKVAPDLGEMYRNKEAIRDIFESPITSDEALDKFLEWTQ
FT                   GAYKLFPKSCRTISRWIDEILAYFDRRTTQGIVEGINQKIKLIKCRAYGLTNFNSFRRR
FT                   VLLNWYFFC"
FT   gene            complement(575645..576064)
FT                   /locus_tag="Npun_R0475"
FT   CDS_pept        complement(575645..576064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0475"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: tde:TDE2577
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79254"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B2J746"
FT                   /protein_id="ACC79254.1"
FT                   /translation="MRVLLDTNIILDFALERHSFYSNTIQVFSFIYQKQIEGYLSASTF
FT                   SDLYYIIRKDKGRASALSLLNRIVTFCQVATVDSTTINIALTANFRDFEDAIQYSAAVL
FT                   NHLDAIITRNPRDFPVATPRIITPEELIQELTNTL"
FT   gene            complement(576061..576351)
FT                   /locus_tag="Npun_R0476"
FT   CDS_pept        complement(576061..576351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79255"
FT                   /db_xref="UniProtKB/TrEMBL:B2J747"
FT                   /protein_id="ACC79255.1"
FT                   /translation="MQAYKLNATIDESGNLIIHEPLNIAPGTVEVIILQPVPSLESSRE
FT                   NQIQSQPEKQKRIVECSIPILKEWLKSTEPTPSDFDPDQAKWEYLREKHNL"
FT   gene            complement(576399..576593)
FT                   /pseudo
FT                   /locus_tag="Npun_R0477"
FT   mobile_element  complement(577086..578090)
FT                   /mobile_element_type="transposon"
FT   gene            complement(577146..578039)
FT                   /locus_tag="Npun_R0479"
FT   CDS_pept        complement(577146..578039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0479"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ter:Tery_1717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79256"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B2IT26"
FT                   /protein_id="ACC79256.1"
FT                   /translation="MLNIEGALKQDRLLRALTGLNRKAFDALLPTFTTMYLDTQQAKPR
FT                   QRGLGGGRKARLLTAQDKLFFILFYFKCYPTFDVAGLLFDMHRSQAHEWMHRLQPILEA
FT                   ALGQKMALPERHLESIEAFLSRFPGVQRVMIDGTERPIARPQEREQQQQNYSGKKKRHT
FT                   RKHLAAVDETKRVLILSKAREGKLHDKRFHDEDDIAGSVPDEIPIEVDSGFQGLQKQYD
FT                   NLHLPHKKPKGGKLSDLQKTENRQLSQSRVVCENAFAGVKRYNAASVIYRNRIENFDDH
FT                   LMLTAAGLWNFYLMAA"
FT   gene            complement(578072..581623)
FT                   /locus_tag="Npun_R0480"
FT   CDS_pept        complement(578072..581623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0480"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fal:FRAAL5636
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79257"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J749"
FT                   /protein_id="ACC79257.1"
FT                   /translation="MAQNWLRITHQNDKIQLSWQRGYENPRFASEVAFQQPFDKENAAE
FT                   LRWYLEDYLKFPYGIFPDNAVKIEQKLQHWGQHLFELVFRSTEKGREFFQEAIREGLDK
FT                   CELGIISDNANVLNLPWELLYSPDYQFLAPSLAGMYRSLSSQGVKAPLPAMPDDQLNIL
FT                   LVIARPYDRQDVGFKTIARPLLAALQPIRQRVNLKVLRPPSLKAFEAELQAHKGFYHIV
FT                   HFDGHGNFDSETQGVLVFEDEQGNEQAVSAREIAQYLTDCRVPIFVLNACQSGQVGEEA
FT                   FSSVAGQLVKLGAKGVVAMAYSVYAKGAEHFIGRLYGELVRGECIATAVAAGRKSMSID
FT                   KMRPSPKGNLPLQDWLVPVLYQQEPYTPFVPKKTAPSFADLMAQTDNTPENSKAVGLPD
FT                   ESAYGFIGRDYEILRLERAFRQNHVVLVQGMGGVGKTELVAGFARWLDDTQGRTSGMFF
FT                   TSFEQGAGLSQVINQIGRALGGERFSQMMPDKQEDVVQQYLQTNPCLLIWDNFEPVNGF
FT                   PTGNEPLLSGEERNKLKRFLKELRVGKAWVLITSRREEPWLDCGYSLINLRGLSEADAQ
FT                   ELAAKILQTVGVERKNLPAEYLELLKLLGGHPLSLRVVLPHLKTQTPVQLIEALRRGLD
FT                   TFRGQEEEGREKSLTVSLDYSFAKLSERTRQHLPFLALFSERVDAGWLYSFSESPDNGF
FT                   GQAYQAVFGENLQKPDWMRIFNEAAAAGVLEYLGETIYKIHPALPWYLRQQLNTITSQE
FT                   VINELEKKLLILYAGFANYYREQLISNAELATFVLRVEEPNLLQNLRLAEHQKEWAEAQ
FT                   SILQALGEVYQRLGRKPEFKALQQRALNQIGIHLADAKVKGKDALDFWMYLRGYEANEA
FT                   LQSASLEEARKVYQEILDELIAINDFSVNDKIAVFYHNLGIVAQEQRQFDVAVDYYNKA
FT                   LKIYEDAGDLYSAASDYHQLGRVAQEQRQFDVAVDYYNKALKIKEDTGDLYSAAKEYHN
FT                   LGIVAQEQRQFDVAVDYYNKALKIFEDAEDLYSAAKEYHELGNIAQEQRQFDVAVDYYN
FT                   KALKIFEDAGDLYSAAKEYHQLGRVAQEQRQFDVAVDYYNKALKIYEDAGDLYSAASDY
FT                   HQLGRVAEEQRLFDVAVDYYQKTWEIYEQFRDWYLASATLGKWGRVLEAQENYAEALQI
FT                   YIRVLAIDLEHNRLVGK"
FT   gene            581849..583051
FT                   /locus_tag="Npun_F0481"
FT   CDS_pept        581849..583051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0481"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: ter:Tery_3439
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79258"
FT                   /db_xref="GOA:B2J750"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:B2J750"
FT                   /protein_id="ACC79258.1"
FT                   /translation="MKFCTKLLIQYRYSDNLLKSSPSYFMLPVIQSIVLRQMASGDRLY
FT                   LQLYKFIGAKPGKKVYIQANLHGAEIAGNAVIHQLIEFLLTINDTDLTGEIWLVPVCNP
FT                   MGTNERAHHFSPGRYCIYEAKDWNRIFWDYEKEADDLVAFTKSQLHIDLEVVRQNYLTI
FT                   IKQQFAKVLEKINSSNGVPYTEIFAYKLQNLSLDADYLIDLHSSTNQALDYVYYFRNRE
FT                   DSAKYFLLDFGILLNKYDGDAFDEAFIKPWLALEACFKEFGREIKFDVEAWTLELGSGM
FT                   QMNSDSVAKGIQGVKNYLAQKGVLQIPDLSDDIKTHEMTFASSSNREKYYAIAGGMIQS
FT                   RIALGSKVKTGEKLYQILSFNKEGQLPTVIDVCAQHDGLVYDVATNQAVNEGEFVLGII
FT                   S"
FT   gene            complement(583229..584326)
FT                   /locus_tag="Npun_R0482"
FT   CDS_pept        complement(583229..584326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0482"
FT                   /product="phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="PFAM: phosphofructokinase; KEGG: ana:all7335
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79259"
FT                   /db_xref="GOA:B2J751"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B2J751"
FT                   /protein_id="ACC79259.1"
FT                   /translation="MSIKNMGEPKRIGILTSGGDCSGLNAVIRAVVNCAVDTYGWEVLG
FT                   IRQATLGLMARPPQFTKLEIDQVDSLLTAGGTMLGTTNKGDPFAFPMTDGSLCDRSEEI
FT                   IAGYHELGLDALIGIGGDGSLAILRRLAQQGGINLVGIPKTIDNDIGVTEHAIGFDTAV
FT                   NIATEALDRLHFTAASHSRVMILEVMGRDAGHIAIAAGIAGGANVILIPEIPYTVEHIC
FT                   HKIKERQEKGKNYCLIIVSEAVRTHDGENVTITNRLGQSRYGGIGEYLADKIIEHIGVE
FT                   TRVTVLGHIQRGGTASPLDRLVATAFGVAAVNLIAEDKYDRMVTWQNRQVLSVPITEAI
FT                   AQYSAVDPNGTLVKTAHGMGIYLGD"
FT   gene            584610..585566
FT                   /locus_tag="Npun_F0483"
FT   CDS_pept        584610..585566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0483"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   ava:Ava_4517 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79260"
FT                   /db_xref="GOA:B2J752"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B2J752"
FT                   /protein_id="ACC79260.1"
FT                   /translation="MTSIDNYNFSFSGEVTIPQAPPDFKSGFIGIVGRPNVGKSTLMNQ
FT                   LVGQKIAITSPIAQTTRNRLRGILTTPEAQLIFVDTPGIHKPHHQLGEVLVQNAKIAIE
FT                   SVDVVLFVVDGAVACGSGDRYIAELLSRSKTPVILGVNKTDQQPSDSQFLDDSYAQMAQ
FT                   SHEWEIVKFSAKTSAGLPQLQELLIEHLEIGPLYYPPDLITDQPERFIMGELIREQILL
FT                   LTREEVPHSVAIAIDLVEETPSITRVLATINVERDSQKGILIGKGGAMLKAIGSEAREQ
FT                   IQKLIAGKVYLELFVKVQPKWRQSRISLAELGYRVEE"
FT   gene            585807..586484
FT                   /locus_tag="Npun_F0484"
FT   CDS_pept        585807..586484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0484"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: ava:Ava_4518 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79261"
FT                   /db_xref="GOA:B2J753"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2J753"
FT                   /protein_id="ACC79261.1"
FT                   /translation="MSLDTRYPLNLPANAPPLRVLIVEDDPMMQLGLEQSLMAHPQLEI
FT                   VGQAEDGYLGVQAALQLKPDLVVMDIGLPRLDGIAATQQIKAALPATHVVMLTSHQTET
FT                   EIIAALSSGADAYCIKGASVERLLSAIAAAVDGAAYLDPQIARRVIDNLKPPAPTSNNA
FT                   NLSARELEVLKLMVDGLSNPEIAEKLYLSPNTIKTHVRGIMNKLAVDDRVQAAVVALRS
FT                   GLV"
FT   gene            complement(587394..587963)
FT                   /locus_tag="Npun_R0485"
FT   CDS_pept        complement(587394..587963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79262"
FT                   /db_xref="GOA:B2J754"
FT                   /db_xref="InterPro:IPR022051"
FT                   /db_xref="UniProtKB/TrEMBL:B2J754"
FT                   /protein_id="ACC79262.1"
FT                   /translation="MQTESQVRSLAPETRGIGNTIRLTGWITFWLQLAIGVVSVLALLF
FT                   ALTGRNFVQQQNTGLGIGIFWAVCGIVVLLFSLYWDYRYTRIGKALENSNPALHPSKAD
FT                   TTRILRLGIVIGLVGMLLTLLGAGSTVLVLIAKSISQPPGVAITNPYNIIRAMDVFVAV
FT                   ADITGIAAHYVGTVASLWLLERVHQH"
FT   gene            588256..588729
FT                   /locus_tag="Npun_F0486"
FT   CDS_pept        588256..588729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0486"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: ana:alr4114
FT                   tryptophan-rich sensory protein (mitochondrial
FT                   benzodiazepine receptor homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79263"
FT                   /db_xref="GOA:B2J755"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:B2J755"
FT                   /protein_id="ACC79263.1"
FT                   /translation="MIKSWMVIGGVAFLVALAANVITPSDRQWFKRLQRPRWLTFEGAI
FT                   PIIWTVIFICGAWSAYIVWEKDPGSTSTWLIMGLYLLLEIITIAYTPVMFRLRSLKVGT
FT                   ILGGTGFIIGALLILAVLGISGWAALLLVPYLLWSPIGTYTTWQMIGLNPQDA"
FT   gene            588820..589293
FT                   /locus_tag="Npun_F0487"
FT   CDS_pept        588820..589293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0487"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: ana:alr4115
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79264"
FT                   /db_xref="GOA:B2J756"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:B2J756"
FT                   /protein_id="ACC79264.1"
FT                   /translation="MIPSWLIIGAVTFLIALGSFLITPRDVKWFALLSRPRWLVFEPLI
FT                   PLIWTVIFICGAASAYVVWEKNPGSPITWLIMALYLLVEIITVAYIPIMLRFRSLKAGE
FT                   ILGLVGLISGVVLAICVLPISLMAALLLLPYLIWTPIGTYTTDELKELNPQDA"
FT   gene            complement(589299..590006)
FT                   /locus_tag="Npun_R0488"
FT   CDS_pept        complement(589299..590006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0488"
FT                   /product="peptidase M15D, vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D, vanX D-ala-D-ala dipeptidase;
FT                   KEGG: ava:Ava_0787 peptidase M15D, VanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79265"
FT                   /db_xref="GOA:B2J757"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B2J757"
FT                   /protein_id="ACC79265.1"
FT                   /translation="MRPYHQIPIFECGEPLIEIPLELFAVESPHPYEKLGAPYGEQSPY
FT                   YLRQSVIKNLSQAQNYLKLLHPNWHIQIFDAYRPIAVQQFMVDYSFTQAVQDRGLTNVE
FT                   LSPNQRQEVWEAVYAIWAAPSLDEKTPPPHSTGAAVDVTLVDDIGQIVNMGSPIDEMSE
FT                   RSHPDYYANNDDPEAQKYHAHRQLLQDVMLKEGFQRNPREWWHFSVGDQMWAWLNNQSN
FT                   PANPVTARYGRIA"
FT   gene            590837..592351
FT                   /locus_tag="Npun_F0489"
FT   CDS_pept        590837..592351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0489"
FT                   /product="Orn/Lys/Arg decarboxylase, major region"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase, class I and II; Orn/Lys/Arg
FT                   decarboxylase domain protein; KEGG: ana:all4887 lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79266"
FT                   /db_xref="GOA:B2J758"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B2J758"
FT                   /protein_id="ACC79266.1"
FT                   /translation="MLNQNQTPLLDALKANAARPHAPFYTPGHKQGEGIPQPLADLLGK
FT                   AVFRADLTELADLDNLFAPQGVIQEAQQLAAEAFGASQTWFLVNGSTCGIEAAILATCG
FT                   TGDKIILPRNVHSSAIAGLILSGAIPIFLNPEYDPVLDIAHSITPNALESALQQHPDAK
FT                   AVLTVYPTYYGVCGDLSAIANITHQYNIPLLVDEAHGAHFAFHPELPTPALAAGADLTV
FT                   QSIHKVLGAMTQASMLHIQGDRIDCDRISKALQLVQSTSPSYLLLASLDAARQQMVLHG
FT                   KMLMSRTLQLANEARTIISQIPGLSVLQILSPPYQGGLGGSSSLGGLVGSPGFVALDKT
FT                   RLTVTVSGLGLTGFEADEILDEKFAVTAEFASLQHLTFIISLGNTPADIKQLVQGFTIL
FT                   AKEYRATNLNVTNPNLQNLLTTQGHTLHFSPREAFFALSETLPLAQTSDRICAEIICPY
FT                   PPGIPVLMPGEIITKPVLDYLQQIQGMGGFISGCNDSSLKTLKVVK"
FT   gene            592539..593558
FT                   /locus_tag="Npun_F0490"
FT   CDS_pept        592539..593558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0490"
FT                   /product="ABC transporter related"
FT                   /EC_number="7.3.2.3"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ava:Ava_0191 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79267"
FT                   /db_xref="GOA:B2J759"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J759"
FT                   /protein_id="ACC79267.1"
FT                   /translation="MAPAVLIQNLQKRYGTVVAVQDVSFQVEPGEIFGLLGPNGAGKTT
FT                   TLRALCTLTTPDAGKIEVSGISVLDNPRVARQRLGYVAQEVAIDKVLTGKELLQLQAAL
FT                   YHLPRAVAKQRIETVLDLLGLQEYANKKTGTYSGGLRKRLDLAAGLLHAPDVLVLDEPT
FT                   VGLDIETRFVVWDFLRKLRASGTTVVITSHYLEEIDALADRVAIIDRGVVIASGTPSQL
FT                   KDKVGGDRITLRIREFSPIEEAEIAKNLLQPLPFVQEVIINSAQGNSLNLVVTPQNDVL
FT                   INIQQALNTAGLPIFGIAQSRPSLDDVYLAATGRTLMDAELAAVATRDPKAEKKQLMR"
FT   gene            593713..594648
FT                   /locus_tag="Npun_F0491"
FT   CDS_pept        593713..594648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0491"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ava:Ava_0192
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79268"
FT                   /db_xref="GOA:B2J760"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B2J760"
FT                   /protein_id="ACC79268.1"
FT                   /translation="MPNPQSKIQNPKSKISMSITPKSDINWQSLASPQADVNAAPNFFG
FT                   ELVQETLALTRRLFIQLQRRPSTLVAGIIQPVMWLILFGALFQNAPKGIFGNTTNYGQF
FT                   LAAGIIVFTAFAGALNAGLPVMFDREFGFLNRLLVAPLASRFSIVFASAIFIISQSLLQ
FT                   AAVIVAAAAFLGAGLPDAVGLSAIALIVLLLALGVTAISLGLAFALPGHIELIAVIFVT
FT                   NLPLLFASTALAPLSFMPRWLQVIATLNPLSYAIEPIRYLYLHSSWGLGSVVMQAPWGD
FT                   VTFGGALLVLLGFALVALLSIQPQLRRTLA"
FT   gene            594689..595084
FT                   /locus_tag="Npun_F0492"
FT   CDS_pept        594689..595084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79269"
FT                   /db_xref="UniProtKB/TrEMBL:B2J761"
FT                   /protein_id="ACC79269.1"
FT                   /translation="MKKPFLQIPRLFVATLAGISFASLLMAQPSSAQVSSPADAFPSNS
FT                   TTDQNTDPFARSNSDNFNMFDLIHRANFGTLNWNSDQQNEQLDSAAAAFKARQQKRIQQ
FT                   GGQPQQATPASPSVTQPSFTLPLPSGN"
FT   gene            complement(595283..595720)
FT                   /locus_tag="Npun_R0493"
FT   CDS_pept        complement(595283..595720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0493"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ava:Ava_0194 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79270"
FT                   /db_xref="GOA:B2J762"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J762"
FT                   /protein_id="ACC79270.1"
FT                   /translation="MPLAVGTDAPAFTAKDTNGNTVSLSDFAGKTVVLYFYPKDDTPGC
FT                   TKQACSFRDAQSEYQGKDIVVLGVSADDEVSHQAFTQKYNLNFPLLADYDKSLITAFDV
FT                   DGGGYAKRVTYVIDPNGKITHVDNAVNTTTHASDILAALGL"
FT   gene            595914..596318
FT                   /locus_tag="Npun_F0494"
FT   CDS_pept        595914..596318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79271"
FT                   /db_xref="UniProtKB/TrEMBL:B2J763"
FT                   /protein_id="ACC79271.1"
FT                   /translation="MAAADSQNPNIFVYPQSTVKRAERSLVCSPFNLSLFEVMGHQSVS
FT                   VTAIALENGLKQGYTKRPLSELACDNALGWLIQVGVLRREVDGQGITDSFRLTPLGRQM
FT                   VEQYHGKNWRTPSWRDRLFDAVIRWLRIPF"
FT   gene            596552..598036
FT                   /locus_tag="Npun_F0495"
FT   CDS_pept        596552..598036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0495"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: ana:alr2377 cobyric acid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79272"
FT                   /db_xref="GOA:B2J764"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J764"
FT                   /protein_id="ACC79272.1"
FT                   /translation="MKSIMVVGTTSHAGKSLLTTAICRILSRRGWRVAPFKGQNMALNA
FT                   YVTASGGEIGYAQAVQAWAAGVVPWVEMNPILLKPQGDMTSQVIIKGRSVGKVSASDYY
FT                   EQYFELGWRTIEESLQHLGTEFDLLVCEGAGSPAEINLKHRDLTNMRVAKYLNAPTMLV
FT                   VDIDRGGAFAHVVGTLELLEPDERALIKGVVINKFRGQRSLLDPGIKWLEERTGIPVIG
FT                   VIPYLQEVFSTEDSLDLLERQSSSSKAQTDLNIAVIRLPRIANFTDFDPLESESTVSVK
FT                   YLSPKQDLGHPDAVIIPGTKTTIADLLLLQKSGMAEAIQHYAASGGTVLGICGGYQMLG
FT                   QIIADPEGIEGQAGRFQGLNLLPIRTVITGQKIARQRQVSSNYPQQGLPVNGFEIHQGR
FT                   SRIEQQGIDPQSYHALFDDINLGLVDSCQSVWGSYLHGLFDNGPWRRAWLNRLRQQRGL
FT                   KSLPTGVANYREQREQILDSLATEVESHLDLTPFLS"
FT   gene            598258..598494
FT                   /locus_tag="Npun_F0496"
FT   CDS_pept        598258..598494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0496"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: ava:Ava_0197 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79273"
FT                   /db_xref="GOA:B2J765"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2J765"
FT                   /protein_id="ACC79273.1"
FT                   /translation="MIVRVHFLPDDVTVDAEVGEAILDVADRAGVFIPTGCLMGSCHAC
FT                   TVELEDGEIIRACITAVPTREKLTINLFSDPTW"
FT   gene            complement(598624..599067)
FT                   /locus_tag="Npun_R0497"
FT   CDS_pept        complement(598624..599067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0497"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: ava:Ava_0199
FT                   streptomyces cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79274"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2J766"
FT                   /protein_id="ACC79274.1"
FT                   /translation="MSDWLEHTVQVEVEAPIDLVWSLWSDLEQMPRWMKWIDSVKIPPD
FT                   NPDISLWKLKTGSLEFNWQSRILKVIPNQIIQWESIDGLPNQGAIRFYDRHNSSIVKMS
FT                   ISYAIPGMIGKIMDNLFLGRIVESTIQADLERFKEYALNVKAN"
FT   gene            complement(599180..600619)
FT                   /locus_tag="Npun_R0498"
FT   CDS_pept        complement(599180..600619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0498"
FT                   /product="amine oxidase"
FT                   /EC_number="1.3.5.6"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: ana:all2382 zeta-carotene desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79275"
FT                   /db_xref="GOA:B2J767"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014103"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2J767"
FT                   /protein_id="ACC79275.1"
FT                   /translation="MRVAIVGAGLAGLATAVDLADAGCEIEIFESRPFVGGKVGSWVDG
FT                   DGNHLEMGLHVFFGCYYQLFDLMKKVGVLENLRLKEHTHTFINKGGRTGGLDFRFFTGA
FT                   PFNGLKAFFTTSQLSLQDKLQNAIALGTSPIVRGLVDFNGAMKTIRNLDKISFADWFRS
FT                   HGGSNGSIKRLWNPIAYALGFIDCENMSARCMLTIFQLFAVRTEASVLRMLEGSPSEYL
FT                   HKPILEYLEARGTKVYTRRQVREIQFIESNEQTRVTGIAVAQGDAVETITADAYVFACD
FT                   VPGIQRILPQEWRKWSEFDNIYKLDAVPVATVQLRFDGWVTELNDKEQRKQLNHAAGID
FT                   NLLYTADADFSCFADLALTSPADYYRPGQGSLLQLVLTPGDPFIAQGNEAIAQHVLKQV
FT                   HELFPSSRELNMTWYSVVKLAQSLYREAPGMDAYRPNQKTPVDNFFLAGSYTQQDYIDS
FT                   MEGATISGRRAAKVILESLKR"
FT   gene            complement(600894..601070)
FT                   /locus_tag="Npun_R0499"
FT   CDS_pept        complement(600894..601070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl2383 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79276"
FT                   /db_xref="GOA:B2J768"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B2J768"
FT                   /protein_id="ACC79276.1"
FT                   /translation="MIMTNKKWAVKRITVNLATQEAEKLEKYCQQTGRPATDVIRELIR
FT                   SLPVSDDGKDINK"
FT   gene            complement(602712..604355)
FT                   /locus_tag="Npun_R0500"
FT   CDS_pept        complement(602712..604355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79277"
FT                   /db_xref="UniProtKB/TrEMBL:B2J769"
FT                   /protein_id="ACC79277.1"
FT                   /translation="MTSFNRSTSRRLKKLTQIPSVWEGDRRPLSSPNQHSNSEEKGECI
FT                   LWVDYSQGVVRGMDVVASDVGPEAIVRTLMRAMEHPHSPARPARPQRIVVKDREIQFYL
FT                   RGVLQDLDIAIDYAPELPLIDELFRGFADILDSQTPDLPPQYAQILREKAFAIWQAAPW
FT                   EFLEEQQILSIEINKWDVGTLYASVMGMLGMEYGILFYRSEDSLKQFRTAVLQDEESTE
FT                   HLEEAFLKQDCLFLTFESADEDEDEDDDEESDLADLPLSEIDPTFGNIHPLEGLRSVLY
FT                   DEEALVIFVAIESLIRFIRDHRRHLHEDIFPTLSRRYRISLPQSEESIKSVAVTVSTMP
FT                   QLAAELEEMAGFGDDDEEIDNLNSANFQSLQDDLIPEDSFLSLGVVSWEMLDHLRKGVT
FT                   YHKAGEIKQVGDGLPVILIQTSRPKAKTVIERIEAAGGLRAICFNPGADPFDGDRYDLG
FT                   LLQTQNGELFLFGEFLDEDPIHVEARKKWNQRCKNTKGYCGLIIAKGLTGASRGNPQLR
FT                   DMMALFETRSLSPKDLGIGTLQLMPQLKLE"
FT   gene            604681..605037
FT                   /locus_tag="Npun_F0501"
FT   CDS_pept        604681..605037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0501"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   ava:Ava_0203 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79278"
FT                   /db_xref="GOA:B2J770"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B2J770"
FT                   /protein_id="ACC79278.1"
FT                   /translation="MTQAIQSQQRGILLSEAALHQVKSLRDKQGTDFCLRVGVRQGGCS
FT                   GMSYMMDFEDTSKITPQDEVFDYDGFKIVSDRKSLLYLYGLMLDYSDAMIGGGFQFTNP
FT                   NANQTCGCGKSFGV"
FT   gene            605170..605613
FT                   /locus_tag="Npun_F0502"
FT   CDS_pept        605170..605613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0502"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: ava:Ava_0204
FT                   TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79279"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J771"
FT                   /protein_id="ACC79279.1"
FT                   /translation="MIIDKLTMTQTVESLFDTGLERYKAGEAVDSLIPVFKEVCDRAPK
FT                   TSAAWICLAWLYLLDNKPNLAYKAAQKAVKLNPQDPQARVNIALAMLETGQKGLREHID
FT                   IAQQLIFVNEEWQDEIKNSIEDGLTRKPDWQSLKKVKNWLFEE"
FT   gene            605729..605977
FT                   /locus_tag="Npun_F0503"
FT   CDS_pept        605729..605977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr2387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79280"
FT                   /db_xref="GOA:B2J772"
FT                   /db_xref="UniProtKB/TrEMBL:B2J772"
FT                   /protein_id="ACC79280.1"
FT                   /translation="MKDKLLNWLNTVLVADVFLVLFGFVWLAIAAIGDSVGVNLGLDLW
FT                   HQLWQPVFNPAIGILMGGAILSGIISWVSKKFLSSQE"
FT   gene            complement(606088..607008)
FT                   /locus_tag="Npun_R0504"
FT   CDS_pept        complement(606088..607008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0504"
FT                   /product="domain of unknown function DUF1731"
FT                   /EC_number="1.1.1.219"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; domain of unknown function DUF1731; KEGG:
FT                   ava:Ava_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79281"
FT                   /db_xref="GOA:B2J773"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J773"
FT                   /protein_id="ACC79281.1"
FT                   /translation="MKVAITGATGFVGSILVQRLHGKGHKIVVLTRNTAFAQKVFPSEA
FT                   FPNVEIVAYTPNTSGSWQSVIASCDGVVNLAGEPIGEGRWTPERKQEILNSRKLGTQKI
FT                   VEAIANANPKPTVLINASAIGYYGTSETANFDETSQSGNDFLAQVCQAWEAEATKVKDA
FT                   GVRLVILRFGIVLGNGGALGKMIPPFKLFAGGPIGSGRQWFSWIHVDDLVNLIMQALTK
FT                   SEIEGVYNATAPNPVRMADLSQTLGQVMNRPSWLPVPAFAIEALLGDGAIVVLEGQQVL
FT                   PKRTVETGFEYKYPNLQSALRQILA"
FT   gene            607309..607656
FT                   /locus_tag="Npun_F0505"
FT   CDS_pept        607309..607656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79282"
FT                   /db_xref="UniProtKB/TrEMBL:B2J774"
FT                   /protein_id="ACC79282.1"
FT                   /translation="MARYTCSFIVSVASDHLLPLLVELLQDCQLDIQYHTGDYIIARQT
FT                   PGNVPFPKLITVEVLVDKSKSTETETRMSIVIKNEELPLQLDNYCRQMFEFIKQAIESS
FT                   RHWHLIESIAG"
FT   gene            complement(607729..609684)
FT                   /pseudo
FT                   /locus_tag="Npun_R0508"
FT   gene            607923..609263
FT                   /locus_tag="Npun_F0507"
FT   CDS_pept        607923..609263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0507"
FT                   /product="transposase"
FT                   /note="KEGG: ana:all7115 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79283"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:B2J775"
FT                   /protein_id="ACC79283.1"
FT                   /translation="MPDILSLLQCLLPQINATTMRQLNQIILAMLALSGRVTMLGIARW
FT                   AGDGGSYRTMGRFFSTVIPWATLFWLFFRQHLWRKNDVYLLAGDEVVVSKSGKQTYGVD
FT                   RFFSSLASKPINGLSFFVLSLVSVEGRQSFPIGIEQVIKSDAQINNTLPIKKVKAKEKR
FT                   GRGRPKGSKNKNKTEVILTSELLLIKKMINSLFELVANFIPLTYLVVDGHFGNNNALQM
FT                   VRQVNLHIISKLRHDSALYIPYENPDSNKRSRRKYGEKLDYRNLPEKYLCKSDIEDGIQ
FT                   TDIYQATLLHKEFAQSLNVVILVKTNLKANIRSHVILFSSDLDLTADRIIDYYKLRFQI
FT                   EFNFRDAKQFWGLEDFMNLSQTAVTNAANIAFFMVNLSHHLLADFRKHNPGSGIIDLKA
FT                   YYRGFRYVHEMLKILPQKPEPILLAQIFAKLTSLGRIHPLSTGVEPS"
FT   gene            complement(610010..612436)
FT                   /locus_tag="Npun_R0509"
FT   CDS_pept        complement(610010..612436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0509"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="7.2.2.9"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: ana:all3782 cation-transporting
FT                   P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79284"
FT                   /db_xref="GOA:B2J776"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2J776"
FT                   /protein_id="ACC79284.1"
FT                   /translation="MQLVPKTKLAPELGPILEKIILDVGGMKCAGCVNAVERQLTQHPG
FT                   VKSACVNLATEVAVVESETGAVDADALAQRLTAVGFPTQPRKARATVAGEISTLPDPAE
FT                   RQRREMRSSVRQLAIAAMLLLLSGSGHFGNLGSSVLPLLNNIWFHCGLATVALLIPGRP
FT                   ILVDGWLGWRRNAPNMNTLIGLGTLTAYIASLVALLFPQMGWECFFDEPVMMLGFILLG
FT                   RTLEQQARGRAAAAFRKLLALQPQVARLIANPEKGGVGSSSVEIPAEQVRVGEWLQVLP
FT                   GDKIPVDGEVVLGQTTVDESMLTGEAVPVIKQPGDSVTGGTLNQSGAIAIQTTRTGSDT
FT                   TLAQIVALVEAAQTRKAPVQKLADTVAGYFTYGVLTASLLTFVFWYFFDTHLWTDIAMS
FT                   GEMEMMSHAIHQAPRSPLLISLKLAIAVMVVACPCALGLATPTAILVGTAMGAERGLLI
FT                   KGGDVLEKVHQLDTVVFDKTGTLTTGHPIVTDCLLISETGSGNPYSLIQLATAVESGTH
FT                   HPLAKAIQQEAQRQKLSIPEAVDFHTEPGLGVSAVVEDTVVLLGNWDWLSWHGISISET
FT                   AQQVAQDLATDGKTVVCVAVGGTLAGLIAVSDTLRPDAQSTVDKLRQMGLRVMLLSGDR
FT                   LEAASAIAKQLGLDSADVIAGVPPAKKAAAIKNLQQAGTKGTPNSSLLTQHSVVAMVGD
FT                   GINDAPALSQADVGIALHSGTDVAMETAEIVLMRDRLNDVVESIQLSRATFNKIRQNLF
FT                   WAFAYNTVGIPLAAGVLFPSLGFVLNPSGAAALMAFSSVSVVTNSILLRRLARHS"
FT   gene            complement(612840..613211)
FT                   /locus_tag="Npun_R0510"
FT   CDS_pept        complement(612840..613211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tel:tll0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79285"
FT                   /db_xref="GOA:B2J777"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:B2J777"
FT                   /protein_id="ACC79285.1"
FT                   /translation="MGYRIRFLVCPIQHLTGIPCSNCGMTRSFMAIAQGNLLEALAENL
FT                   FDPLLFASFVIVAVHITLKLVTKSRITAFYCHPVKQRKLQIIGLFILLIYYFLLLYKLS
FT                   QTGEMYSYFINSPLGKLFS"
FT   gene            613971..615567
FT                   /pseudo
FT                   /locus_tag="Npun_F0512"
FT   gene            complement(615790..616065)
FT                   /locus_tag="Npun_R0513"
FT   CDS_pept        complement(615790..616065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79286"
FT                   /db_xref="GOA:B2J778"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:B2J778"
FT                   /protein_id="ACC79286.1"
FT                   /translation="MSNLNPSHPTKQLLAGYCGIILGGFGVHKFILGYAPEGFIMLVVS
FT                   VVAGSFTYGIALLIMQLVGLIEGMIYLNKPPEEFVNTYFVNKQGWF"
FT   gene            complement(616671..618245)
FT                   /locus_tag="Npun_R0514"
FT   CDS_pept        complement(616671..618245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0514"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: ana:all3785
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79287"
FT                   /db_xref="GOA:B2J779"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2J779"
FT                   /protein_id="ACC79287.1"
FT                   /translation="MTLKRLVLIFVLTPIAVLLAVSALFGSWQEPQFQSRLELYQTNIA
FT                   LQAQAWQSEDSGDDNLQGIREAILGEQPLESATKQYQEARQSVQANLDKVNNKLAQLRS
FT                   QSEITPIPPKPLPEVPPTTKTSKQGKQQLQQSLKQLQKLLAELDLRLGILQAQQGQTDT
FT                   ALKTWSELQERSDVNPEFGETAAVLSGLWSNPPRLLQNAQERIQKNLEGWFRSTALVQL
FT                   YQLQQRQEALLAVKAAQKETAAQAVLKLAVIGTIPTLAALIGLILLILLFAQRLLKGKA
FT                   SLLAQNADIPWSTPWDGETVLQVFIVGFFFMGQIFVPLVISVLPIPRPIVDVRLQAFSV
FT                   LVSYLLVALGALLVLYFSLKPFFPLPEFWFRFRFQNNWFLWGLGGYCTALPIVVMVSLI
FT                   NQQLWQGQGGSNPLLQLALESQDGVALGIFFFTAAIAAPFFEEILFRGFLLPSLTRYLP
FT                   VWGSIIISSLLFAIAHLSLSEILPLTALGIVLGVVYTRSRNLLAPMLLHSLWNSGTLLS
FT                   LFVLGSN"
FT   gene            complement(618379..618909)
FT                   /locus_tag="Npun_R0515"
FT   CDS_pept        complement(618379..618909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79288"
FT                   /db_xref="GOA:B2J780"
FT                   /db_xref="UniProtKB/TrEMBL:B2J780"
FT                   /protein_id="ACC79288.1"
FT                   /translation="MATANKICSLGRRIYRFAASVSAFIALLVIIWGCTANDFNAGAIA
FT                   WKTYSNSRYGFEFPYPSNWTSSAGPANGDGIAFISPQNKTVEIRGWASQQLLNSIVTEQ
FT                   EPVKNIKPNFQTAQGVSGVLVVEVDQRVASMTLTLTQDQVKYCWQGRSKSQEFQDYYRL
FT                   FYYIAQQYRISKS"
FT   gene            619084..619875
FT                   /locus_tag="Npun_F0516"
FT   CDS_pept        619084..619875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0516"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   ter:Tery_0534 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79289"
FT                   /db_xref="GOA:B2J781"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B2J781"
FT                   /protein_id="ACC79289.1"
FT                   /translation="MYSASQKAELTLELFHFQTNTSLQFPPNLSVISIGKPNDQKPPDI
FT                   DISGLPDSDVASRIHAQIWVNGDEYHITDLDSSNGTYINGAKLQPQVFCPLHPGDRVSF
FT                   GQGDKITFMFRVQQHSASATKNPPSSSAPTKITAPTTSKEEEDQVILASKLIGLGLILA
FT                   GITFLSTSIYVSVYLRSTPGILLCMGGVVALNWGGRDNRKLGWVLIGIGIALFIASGVV
FT                   IGSVSLFSLLVSFAGISCGYQLFTTGKVFNFNPLTLQIVKK"
FT   gene            620122..620475
FT                   /locus_tag="Npun_F0517"
FT   CDS_pept        620122..620475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79290"
FT                   /db_xref="GOA:B2J782"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B2J782"
FT                   /protein_id="ACC79290.1"
FT                   /translation="MQTQTKQKVTLYLSPELHRKLKIRSAVDSEPMSELAERALGFYLS
FT                   NQELVDELEDSSFGRAHRVYSCPTCDSSLVLRDGELVTLGNQPGVVGQEHLSIDEMDGD
FT                   ETNPKGEEELVPC"
FT   gene            620568..622079
FT                   /locus_tag="Npun_F0518"
FT   CDS_pept        620568..622079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0518"
FT                   /product="AAA ATPase, central domain protein"
FT                   /EC_number="3.6.4.6"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: ava:Ava_4767 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79291"
FT                   /db_xref="GOA:B2J783"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J783"
FT                   /protein_id="ACC79291.1"
FT                   /translation="MKEELNILIQAQYPLIYLVTSEEERAEQAVSTIAQLLKPQRRVFV
FT                   WTVTHGIVEYGQPRNVTQHNTVSPEAAIEWIIRQKEPSIFILKDLHPFIDAPATNRSLR
FT                   DAIASFKGTQKNIILMSPMQQVPIELEKEVVVIDFTLPDMAELNKVLTQHVDQNRGRRL
FT                   TTEAREKLLRAALGLTKDEAEKVYRKAQVTTGRLTEDEVDIVLSEKKQLIRRNGILEYI
FT                   EEDETIDAVGGLEELKRWLKQRSNAFTERAREYGLPQPKGMLILGVPGCGKSLIAKTTS
FT                   RLWGLPLLRLDMGRVYDGSMVGRSEANLRNALKTAESISPAILFIDELDKSFAGSGGSS
FT                   DSDGGTSSRIFGSFLTWMQDKKSPVFVMATANRVERLPGEFLRKGRFDEIFFVDLPTPE
FT                   ERQHIFNIHLTKRREDISRFDLEQLAKMSDGFSGAEVEQAIVAAMYEAFAQDREFTQLD
FT                   IIAALKATLPLSRTMQEQVTALRDWARQRARPAASSVAEYQRMEF"
FT   gene            622219..622569
FT                   /locus_tag="Npun_F0519"
FT   CDS_pept        622219..622569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0519"
FT                   /product="protein of unknown function DUF1257"
FT                   /note="PFAM: protein of unknown function DUF1257; KEGG:
FT                   ava:Ava_4766 protein of unknown function DUF1257"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79292"
FT                   /db_xref="InterPro:IPR009666"
FT                   /db_xref="UniProtKB/TrEMBL:B2J784"
FT                   /protein_id="ACC79292.1"
FT                   /translation="MSHFSTLRTKITDAEILKASLRDLGISVKTEADVRGYNGQRVRSD
FT                   IVAMLDGEYDLGWSRNSDGSFDLIADLWGVAKKHNQTELINSINQKYAVNKTLAEVKQR
FT                   GLQNANVKLVLQ"
FT   gene            complement(622698..623273)
FT                   /locus_tag="Npun_R0520"
FT   CDS_pept        complement(622698..623273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79293"
FT                   /db_xref="UniProtKB/TrEMBL:B2J844"
FT                   /protein_id="ACC79293.1"
FT                   /translation="MFKRTYRKEAQQRLRSAVDKYENVCKSLQDAAASLYQKRVKRGVE
FT                   TIKLCESYINTLANSPKEFSKVIAELKFQLKEITGKDWELIDAGNNKNFVAGSTAGAGL
FT                   VAGAGLAFLGPTAAMALLEQIDQDYKTTVANIIATYEKLDNLAQAAFNPSLNVELRLQA
FT                   SIKLAVAYNVHDSNIIHNVDELDLFMFS"
FT   gene            623822..624085
FT                   /pseudo
FT                   /locus_tag="Npun_F0521"
FT   gene            complement(624130..624283)
FT                   /pseudo
FT                   /locus_tag="Npun_R0522"
FT   gene            624531..625277
FT                   /locus_tag="Npun_F0523"
FT   CDS_pept        624531..625277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0523"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.184"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ava:Ava_2801 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79294"
FT                   /db_xref="GOA:B2J845"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J845"
FT                   /protein_id="ACC79294.1"
FT                   /translation="MTTEKRIAVVTGSNRGLGYAISRQLSKIGNRVILTSRNETDGLAA
FT                   KGQLTNKGFDVDYHTLDVTNDGSVQQFTEWLRETYGKVDILVNNAGVNPTTKPEESSLL
FT                   TVQLETMRSTFETNVLAVLRISQALIPLMKVQNYGRIVNISTEMASLTSVPTDYYPLAP
FT                   SYRLSKVGVNGLTVLLAKELQGTNILVNAYSPGWMKTDMGGDDAPFTAEEGAETAVYLA
FT                   TLPDGGAQGLFFAEMRKFGGPIQVQW"
FT   gene            625284..626201
FT                   /locus_tag="Npun_F0524"
FT   CDS_pept        625284..626201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79295"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="PDB:2P4O"
FT                   /db_xref="UniProtKB/TrEMBL:B2J846"
FT                   /protein_id="ACC79295.1"
FT                   /translation="MGDSAGLPPIYADKPIELAPAKIITSFPVNTFLENLASAPDGTIF
FT                   VTNHEVGEIVSITPDGNQQIHATVEGKVSGLAFTSNGDLVATGWNADSIPVVSLVKSDG
FT                   TVETLLTLPDAIFLNGITPLSDTQYLTADSYRGAIWLIDVVQPSGSIWLEHPMLARSNS
FT                   ESVFPAANGLKRFGNFLYVSNTEKMLLLRIPVDSTDKPGEPEIFVEQTNIDDFAFDVEG
FT                   NLYGATHIYNSVVRIAPDRSTTIIAQAEQGVIGSTAVAFGQTEGDCTAIYVVTNGGMFL
FT                   PPPTGVVPANVVRLEVGKPGYPLG"
FT   gene            626339..626905
FT                   /locus_tag="Npun_F0525"
FT   CDS_pept        626339..626905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all0350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79296"
FT                   /db_xref="GOA:B2J847"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:B2J847"
FT                   /protein_id="ACC79296.1"
FT                   /translation="MEMEQDDQFVTVVITQVVKPGCESAYEAWLKEITRVSRTYIGHLG
FT                   TNVIRPQLGVRNEYAIIFRFDGYENLKVWMTSRDREYWLNQGKHLVESDPYVQQICGLE
FT                   AWFSLPGQPLKTPPRYKIALLTWGAVYVLINLLSTFIVPLLRGLPPLIISLIVTITMVL
FT                   LLTYIVMPRVSRLFSFWLYPKSRKV"
FT   gene            complement(627072..627704)
FT                   /locus_tag="Npun_R0526"
FT   CDS_pept        complement(627072..627704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_3826 FdxN element excision controlling
FT                   factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79297"
FT                   /db_xref="GOA:B2J848"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014919"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:B2J848"
FT                   /protein_id="ACC79297.1"
FT                   /translation="MAAKDIFHDAVKRALENEGWLITNDPLFLRFGGLDMYIGLGAEKV
FT                   LAAERNQEKIAVEVKSFVAPSTTTEFSTALGQYLKYQLALEEEQPERLLSLAVPLDTYR
FT                   SFFTLELPRLLIQRYQVGLIVFDPQEETNAYGTLRERKMAKVEQYRQLIQELLLGYSEI
FT                   KASNEEVEAEVIFDRERVGLCPAVGIATKLFMRGGQISVAYMVVFCI"
FT   gene            complement(627751..628377)
FT                   /pseudo
FT                   /locus_tag="Npun_R0528"
FT   gene            complement(628509..630122)
FT                   /locus_tag="Npun_R0529"
FT   CDS_pept        complement(628509..630122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0529"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.5.11"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   ava:Ava_2796 NAD(P)H-quinone oxidoreductase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79298"
FT                   /db_xref="GOA:B2J849"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/TrEMBL:B2J849"
FT                   /protein_id="ACC79298.1"
FT                   /translation="MNAIEFPWLTAIILLPLVAALAIPLIPDKEGRTVRWYGLGVAIAD
FT                   FALMIYAFWYKYDFQSSRLQFVENYPWIPQLGLHWAVGVDGLSMPLLLLTGLINTLAIF
FT                   AAWKVTTKPRLFYGLMLAMYSAQLGVFVAQDLLLFFLMWEIELVPVYLLISIWGGQNRR
FT                   YAATKFILYTAAASIFILIAGFAMAFSGDTVTFDMATLGMKEYPKTLELLVYAGFLIAF
FT                   GVKLPIFPLHTWLPDAHGEASAPGSMILAGVLLKMGGYALIRFNVEMLPNAHVTFAPVL
FT                   AILGVVNIVYGACCAFAQTNLKRRLAYSSIAHMGFVLIGIASYTELGISGAVLQMVSHG
FT                   LIAASLFFLSGVTYDRTHTLMMDKMGGMAKVMPKTFALFTIGSMASLALPGMSGFVGEL
FT                   MVFLGIATSDVYSSSFKIVVVLLSAVGVILTPIYLLSMLRQVFYGEQSQELHLDAVISD
FT                   VKPREIFITACLLLPIIGIGFYPKLATQTYDVKAIELAAHARQVLPVVAHQQPSSMYSR
FT                   IFSAPTLANSQVESSINISE"
FT   gene            complement(630919..631197)
FT                   /locus_tag="Npun_R0530"
FT   CDS_pept        complement(630919..631197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79299"
FT                   /db_xref="GOA:B2J850"
FT                   /db_xref="UniProtKB/TrEMBL:B2J850"
FT                   /protein_id="ACC79299.1"
FT                   /translation="MENTLIDKTFRDSDGKIVLAQMPNLPLIVWIVTSLLALIFTSGKI
FT                   NTVLDVVANGSLFTWAWLELFQGVNYFRRALGLAVLIGIIALKIQYS"
FT   gene            631641..633886
FT                   /pseudo
FT                   /locus_tag="Npun_F0531"
FT   gene            complement(632212..633104)
FT                   /pseudo
FT                   /locus_tag="Npun_R0534"
FT   gene            633873..634514
FT                   /pseudo
FT                   /locus_tag="Npun_F0536"
FT   gene            complement(634599..635132)
FT                   /locus_tag="Npun_R0537"
FT   CDS_pept        complement(634599..635132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0537"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   ava:Ava_1318 protein of unknown function DUF1499"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79300"
FT                   /db_xref="GOA:B2J851"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B2J851"
FT                   /protein_id="ACC79300.1"
FT                   /translation="MFRLLKTYPFPTERSVNGEMRYVQRLLWSIIFVIFFSLTSSFILP
FT                   AATWAATSGLGVDNIHLAPCPPSPNCAVSQDADSKHSIDPIAYHVDLKTARATLLKVLS
FT                   VVPRTEVIQQTDNYIHALSKSRIFQFVDDVEFYFPANESVIHLRSASRLGDSDFGVNRR
FT                   RLEQIRLALRDLKI"
FT   gene            635281..635739
FT                   /locus_tag="Npun_F0538"
FT   CDS_pept        635281..635739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79301"
FT                   /db_xref="GOA:B2J852"
FT                   /db_xref="UniProtKB/TrEMBL:B2J852"
FT                   /protein_id="ACC79301.1"
FT                   /translation="MVMAINYREKIIALWTVFLLGILFHTQLGLIPLFHGLSVIESQKA
FT                   TNINDISGIMWLMLGFFVLPMLAIILTIFTDSKRYRIIHFGLTVFYSIMNLLHVILDLF
FT                   VQPVFWYQIALIGLLFFVGLLLNITAFKWMQMPNRSNKSQKELENSHL"
FT   gene            636094..636954
FT                   /locus_tag="Npun_F0539"
FT   CDS_pept        636094..636954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0539"
FT                   /product="Rhodanese domain protein"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ava:Ava_4507
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79302"
FT                   /db_xref="GOA:B2J853"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2J853"
FT                   /protein_id="ACC79302.1"
FT                   /translation="MNTKALISPQELTSLLAENLSRAVIIDTRSPEDYAISHIPQSINI
FT                   RDFFTYLLESSYPAGLKELQEYFAVIMSKLGISGAERLIVYEDTLNRGYGQSCRAAFLL
FT                   KYLGCAEVSILQGGYRAWLTEGLPTTDEVPLCESSIFRFHPNTDMMVTTPEMLQAIDNP
FT                   AIIKLDVRDRSEWLGLSSSPYNPDFCPRKGRIPNAVWLEWHHLMNSKSEIPTFRSPDEI
FT                   REICQSVGITSESIVYIYCFKGSRAANTLIALEQVGISARNYFGSWNEWSRDFSLPIDS
FT                   RVISM"
FT   gene            637306..637701
FT                   /locus_tag="Npun_F0540"
FT   CDS_pept        637306..637701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr4876 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79303"
FT                   /db_xref="GOA:B2J854"
FT                   /db_xref="UniProtKB/TrEMBL:B2J854"
FT                   /protein_id="ACC79303.1"
FT                   /translation="MAKKSQPNVEQYQDVRLSATTRIWVITVAILGVCVPLSAVTRSGA
FT                   ILPLVAIGGAAVGTVAVWRSDEQKSKTNYLQQQQIELLERRLANLETIVSSDDLNLQMK
FT                   IKQIEARDTFGDSSDVSTIPRQPKRKG"
FT   gene            638114..639877
FT                   /locus_tag="Npun_F0541"
FT   CDS_pept        638114..639877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0541"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ava:Ava_2147 WD-40
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79304"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J855"
FT                   /protein_id="ACC79304.1"
FT                   /translation="MDWISLLKAQQTDFLQRVKKPKTYDLSLLESQVKGCHTEMMAFWG
FT                   EPLARLQELSRQQAEVLAKNPPPTPPEYPEPPDWTIPFPKYFQRQAEDYLLREKIVDLV
FT                   IAERLGKLVKKVSQDTLQNMILDDEGNLCGESKFSYVLKDNPQLSIQVYVADGESFNGI
FT                   KKDKIKWSVTQEDLKNHQVLIFLCLFYPSTGQLGYERQSVITGFLPANQIELTEPKLYI
FT                   SPSNLLYAGGLSWYLESLIAKKDTSPVINEKAIADTIQTLPSEHCLKGIVGDWECWQTL
FT                   QGHNRGINCLAFSFACKNGKALPILASGSRGETKLWDLSKGELIDTLSEYPWVIPGLVD
FT                   EVNSLAFSADGQTLVSCGADSTIKLWHVGALDLIDILHKHNGVVRCAAFTPDGRMLATG
FT                   GDDRKILFWDLMHRQVAIAVSLDDTAAHSLVLSRDGETLVTGSYRKIKVWRTLPQTGIK
FT                   SLKDAQPLHTLMGHSHIVRSLAISADAKLLVSGSWDQTIKIWQLETGELLHTLKGHRDR
FT                   VYAIALSPDGQIIASGSADKTIKLWHLQTGELLGTFTGHGNIVTALAFTASGEMLVSGS
FT                   LDKTIKIWQRS"
FT   mobile_element  complement(640102..641498)
FT                   /mobile_element_type="transposon"
FT   gene            complement(640121..641431)
FT                   /locus_tag="Npun_R0542"
FT   CDS_pept        complement(640121..641431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0542"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: syn:slr0099 putative transposase gene of IS4
FT                   family insertion sequence ISY352f"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79305"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B2J856"
FT                   /protein_id="ACC79305.1"
FT                   /translation="MVEPRSPIKTVKFVDEYCLWYKNLFSDVRNFEAFKYLHIGCISDL
FT                   KRKSLPEIAKIVGLDNYQGLHHFLTTPSWSVEQLRALRLQLILEVLKGRPIILIIDETG
FT                   DKKKGNTTDYVKRQYIVNLGKVENGVVAVTAYGMFCGMTFPLLFEVYKPREKLKPGDKY
FT                   LTKPQIGAMLIRKLQLMGFKFNLVLADSLYGESSTNFIPVLDELDLNYLVAIRSNHSVA
FT                   LLKGQYTQYLNWHKFKRVFSDLSSENRFIREIIHGKRSNHRYWQITTDTLNLPGNSTWY
FT                   VMSKYPDITPREVGNFYGFRTWVEYGLKQSKNQLGWADYRFTCYEDIERWWEIICSAYL
FT                   MVSLHSESLRPYPLDSQSTFASHQRWDNGKGWKNILNNLRLILQPFTLFNLIQPWLSVF
FT                   PIPHLSLGFAKLQSVVYYLTYPTFISLTDPDFYFSSA"
FT   gene            complement(641510..642619)
FT                   /locus_tag="Npun_R0543"
FT   CDS_pept        complement(641510..642619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0543"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   ava:Ava_0315 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79306"
FT                   /db_xref="GOA:B2J857"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2J857"
FT                   /protein_id="ACC79306.1"
FT                   /translation="MGTPRCHTLLNQTHWVQAIHTAVKGRARYKVNGLYHSEALKKYLE
FT                   SRLLEHKIISQARANSYTGNVLVIFHPDNSLNTNAKGGSSTIASLIQEIVLDYRKKVSK
FT                   SLGSNAVIGDSNLHSFGTKENIGFVGGNNRNIFDSAVLSQISMQRQLNQTASQLIPVVC
FT                   ALVCGTALLYAYNLDEAILLSIQKLHTPLRDRIMLGITFMGDPLVMLLSSLGLAISPLY
FT                   SNRRWQATILGIAGVGAILLNCLMKILFGRARPALWKHIINVGQHSFPSGHAMVSIVIY
FT                   GFTGYVLAKQFPEWRFWIYGLTVFLIAAIGFSRLYLGVHWLTDVTAGYAAGLVWLITCI
FT                   PILESEHKYRSSLEKTTFEQDSVLYSSSV"
FT   gene            complement(642863..643507)
FT                   /locus_tag="Npun_R0544"
FT   CDS_pept        complement(642863..643507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all2004 cation transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79307"
FT                   /db_xref="UniProtKB/TrEMBL:B2J858"
FT                   /protein_id="ACC79307.1"
FT                   /translation="MTSIKRSNSGKTASMNLRLPPKKATKSVAKKAASSQKIFYSIVHT
FT                   IPGRIRFRIPLLGRDTEYANQLKLAMESDPRVTNVRANPKAASIVINYKVGVISDNQMR
FT                   EHLVNLIQTAQDVVLPKEVMAKSIVGAIFDALINLIDNTRKINQARNVLVYRRFRTDIW
FT                   ERMLSTSRSIIKRLKSATMFILPNKRWRLRGNGEANSQPLKLKSASEPNLI"
FT   gene            644013..646361
FT                   /locus_tag="Npun_F0545"
FT   CDS_pept        644013..646361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0545"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: ava:Ava_2499 WD-40
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79308"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B2J859"
FT                   /protein_id="ACC79308.1"
FT                   /translation="MQQGLMLLIQLVLEFAPVVAELVQNRNKSSLGLSKYEPIEAIPEI
FT                   LKVFNLSNKKSGYVEDFEKERIFQQQLVADNHQTRLKIAAQERETALKLPEVNKIIDSW
FT                   PLRLYPSQILDHTNYGHTPLKIFIAPPQVDFDQFGDRRDENISQIELMLAEGLRDFLNK
FT                   HYSLHSQVRPTELLAGAWDSKRFHSESSIKVLFGMLKTEPSLILESENDGDYLNFRIAY
FT                   WGLEQDNYYYKTIARLPYREILEESAKRRALEWKKIRDELVALGEKLEEVNQLGKDNLI
FT                   NLEILEKVEKWHEKGIDISKLSLQYQVNRQDYEKLCQVLITYHCLVAGWVADIYHLVDR
FT                   GVPPLLPELLPSLLSDTFDLQSVGVIASGYKQVYQALENERCYWIPELALQLAQSLCHL
FT                   SDAYDGKLRSWAKEQLNYSVSTWLQLRQVSPHDSPNLLQAMQSAVSVKDEEYVKKLREY
FT                   FVAVGDTQSIADVDEILNRIANLKHQVTVQHIFLSHTLTGHSEKVTSVAISPDSETLVS
FT                   GSADKTIKVWNLKTGKLIRTLTEDLGKISSVAISPDGHYFAVGICQHPRSNVKVWNLNS
FT                   DKLLHTLLGHQKPVNCIAISPDGQFLASGSNKIKIWNLHKGDRISTLWHSFTVNAAAIS
FT                   PDGTILASGSSDNKIRLWNPHTGDPLRTLNGHSGEIKSVIISPDGEILFSASADKTIKI
FT                   WHLTTGKVLHTLTGHLEEVRSLAVSPDGEILFSGSTDKTIKIWHLQTGELLQTITEHSG
FT                   TVNSIAISHDGQFLASASSDKTIKIWQIN"
FT   gene            complement(646371..646949)
FT                   /locus_tag="Npun_R0546"
FT   CDS_pept        complement(646371..646949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2002 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79309"
FT                   /db_xref="UniProtKB/TrEMBL:B2J860"
FT                   /protein_id="ACC79309.1"
FT                   /translation="MLTNGYSTYNKMPEILDKNNFKTSPKPISTKVVSSTPGRLRLRVG
FT                   HSHRQLEKMQRIANALSANSHITQVKTNVYHGSIVMNYDGKDGSLENVLATLKDLGIIF
FT                   ADVTEGNTEAAAGVSSALVDLNQRVKQSTHGAFDLRILFPLGLASLSLRQLLNKGLQLE
FT                   VIPWYVLAWYAFDSFIKLHGTSQEESANK"
FT   gene            complement(647163..647468)
FT                   /locus_tag="Npun_R0547"
FT   CDS_pept        complement(647163..647468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_5063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79310"
FT                   /db_xref="GOA:B2J861"
FT                   /db_xref="InterPro:IPR033456"
FT                   /db_xref="UniProtKB/TrEMBL:B2J861"
FT                   /protein_id="ACC79310.1"
FT                   /translation="MAPKISDFVEDAGAPGIIVGIGAVLLAPVLLPIVAGVGKPLVKSV
FT                   IKGGIGLYERSKGTIAEMGETWEDMVAEARAELADEKETPVFEASATNADVADNGA"
FT   gene            complement(647540..649792)
FT                   /locus_tag="Npun_R0548"
FT   CDS_pept        complement(647540..649792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0548"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="7.2.2.9"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: ana:all2004 cation
FT                   transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79311"
FT                   /db_xref="GOA:B2J862"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2J862"
FT                   /protein_id="ACC79311.1"
FT                   /translation="MAKVALQLSSPPKSQFTVLEGNGKASLTDTNGHSQREFPNVTYSI
FT                   VHTTPGRLRFRLPRLRCDADYAKRLEVLLTADALVKNVRVKPAAMSVAVTYKSDKVSDA
FT                   KMRSHLHDLIQAASEVVVLKNSTSLSETEKEPSWPGLQLSAVATALAVLGGPLGLPIPP
FT                   LIVVLPIALATLPVVQRAWEGIRVERKLNIDFLDFMAIAITTFQGQFLTPSLMLGLIEV
FT                   GENIRDRTARSSAQQTLDLLSSLGQFVWVERNGAKQQIPIQDVQRGDTVIVYPGEQVPV
FT                   DGSILRGKALLDEQKLTGESMPVLKKKGQPVFASTLVREGRIYIVAEWIGNDTRAGQSI
FT                   KLMQEAPIHDTRMENYATKFAQKAVVPTLLLGGAVFAATRNPSRTASVLTLDFATGIRV
FT                   SVPTTVLAALTYAARRGILIRSGRALEQLAEVDTIVFDKTGTLTKGEVDVVSVESLNPA
FT                   TSRLRVLELAAAAEQRLTHPVAEAIVRYAEAEQVEILPRSKWDYQLGLGVQAQIDGETV
FT                   YVGSDRFLRSSGIDTEALNGQQKSANSAIYVASNGELQGIIKYSDLLRPESREVITALS
FT                   TVEGVEIHMLTGDNKRTATAVAAQLGILPTHTHAEAFPEQKATVVRQLHEQGKTVAFVG
FT                   DGINDSPALAYADVSVSFANSSEIARETADLVLMQNDLYGLLEAIAIARQAKQLIRQNT
FT                   GIVAVPNLAALAIAVFFGLNPLAATVVNNGSTVVAGVNGLRPILKSPQHKTLPSAR"
FT   gene            complement(649935..650774)
FT                   /locus_tag="Npun_R0549"
FT   CDS_pept        complement(649935..650774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_5065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79312"
FT                   /db_xref="UniProtKB/TrEMBL:B2J863"
FT                   /protein_id="ACC79312.1"
FT                   /translation="MAVLNLESIADLDKKPEPTVTDKINYPATPPSRVVHSIICAFPGQ
FT                   VAFCIPQICEDPKYVERLVALLANEPLVIDRQVNNTMVGSIAITYKSDVVSDVDMRSHL
FT                   ANLIQLAGNEKVVLATANQLKPYSALVATEDRQDRKPTMQPQKQKSATFSLSSADASVS
FT                   KTKNNSVSSAHSVIQQPKKPAKVAYSIAHAIPGRVRFRVPRIACDPKYVQRLEALLKSD
FT                   STVTSERVNSAARSVVITYKTGMMRDSQKRVQSFLSAAISHLASLIESVNDPATAIN"
FT   gene            complement(650812..651900)
FT                   /locus_tag="Npun_R0550"
FT   CDS_pept        complement(650812..651900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_5066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79313"
FT                   /db_xref="UniProtKB/TrEMBL:B2J864"
FT                   /protein_id="ACC79313.1"
FT                   /translation="MAQSTKLQPSGGLQIVHVTTGRVRFRTTDSSLNSILDSIAQDLRS
FT                   LEGVTEVAVNGQTGSLVVNFNEDKLSLPQILALKSDIEIQQPQASSDSPSKTDPFAAWK
FT                   SPLFWKEQGVSLIPMMTGLAVTGGLGIHGWVSIPVYMIAADATRGVIGYLGSQVPTSEK
FT                   NDGNNTSSAISELSKEECQSTIQQEKSTNNLKKASEVAAAAKIDYSVIHAISGRIRFHV
FT                   PKIAQDRAYGRRLERIVKTDAEVTSVRMNFDAASIAIAYQSHDIPLSYWVSLMELALET
FT                   NPPMQPITTANQPLQEVSQMNQITDATTSHQTSLNVSQTPEVINSTTASEINSELSSLW
FT                   TNLKPPAMFFSLGIMANLPLET"
FT   gene            652336..653340
FT                   /locus_tag="Npun_F0551"
FT   CDS_pept        652336..653340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0551"
FT                   /product="ABC transporter related"
FT                   /EC_number="7.3.2.3"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ava:Ava_4230 ABC transporter-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79314"
FT                   /db_xref="GOA:B2J865"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J865"
FT                   /protein_id="ACC79314.1"
FT                   /translation="MIEVEHLSKIYGSTPAITDVTFSVEPGEILGLLGPNGAGKTTTMR
FT                   ILAGYLPATNGNARIAGYDVHENSLAVRQRIGYLPETPPLYPDMTVEGFLHFVAQIKGV
FT                   PAGDRPNKVTAAIKRCNLEDKRRVIIRKLSKGYRQRVGIAQAIVHDPPAIILDEPTVGL
FT                   DPRQIIEVRNLIKSLAGTHTIILSTHILPEVSMTCSRVAIINRGKVVATNTPENLMTQL
FT                   TGGSGYELEIEGEAALAKQVLQNVAGVSLIESIPTAGGHHPQANRAYLRVISQPGKEPG
FT                   KDIVATLVRAGFGLHELRRVNATLEDVFLQLTTEEKNFETEVDLAADNEGEAA"
FT   gene            653341..654153
FT                   /locus_tag="Npun_F0552"
FT   CDS_pept        653341..654153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0552"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /note="KEGG: ava:Ava_4231 putative ABC-2 type transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79315"
FT                   /db_xref="GOA:B2J866"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B2J866"
FT                   /protein_id="ACC79315.1"
FT                   /translation="MGVVLSNIIAIYRRELQSYFVSPLAYAIAGIFWFIAGLFFVMILL
FT                   GPDGILLGVAAIDAQGQQLGVPTPPIDVPYEFVRAFLDRMGWLLLFILPILSMGLYAEE
FT                   RKRGTLELLATSPITNWAVAVGKLLGVLTFFITMVVPMLVFEAIAISGSNPPMALSIPL
FT                   LGHFGLILLAAAILSVGMFISSLTDSTILSAVLTFAVILLLLLIDLIAKIVPGPVGEAL
FT                   GYLSLLKHYNTLTQGIFDTSALILFASYIFLGIFLTAQSIDALRFQRQ"
FT   gene            654192..655868
FT                   /locus_tag="Npun_F0553"
FT   CDS_pept        654192..655868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79316"
FT                   /db_xref="GOA:B2J867"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2J867"
FT                   /protein_id="ACC79316.1"
FT                   /translation="MKIVAKKKLWKYLFWLGPFLIAVGLTVGLVSEQWGLIPLVFLIAG
FT                   VVISGLGIIWQSYETNWWKRRSTQAGTNALVATLAVLAILGLINFLGTRYHLRADLTES
FT                   QLFTLAPQSRELVSVLPQPVKVWVFDINQNPQDRELLENYQRQSSKFKYEYIDPQARPG
FT                   LAEKFGVKDYGEVYLESGDKRQLVQTVNQNERLSEIRLTSRLQQLTNSTTAKVYLLQGH
FT                   GERQLSAGKGAISQAVQGLGDKNFTTSPLNLGETSKVPEDASVVIVAGPKRGLFEGEVK
FT                   ALQEYLNRGGNLLLMIDPNTNPKLNSLLQEWGVRLDNRLAVDVSGESVVGLGPAAPLVT
FT                   EYGQHPITKDFGNGNSFYPIARPLEITSVPGVQATPLLRTKPYPNSWAESDLQSEKLEF
FT                   NADKDLKGPLTLGVALTRKQAAKSASTPQAAPTPSPLPSPTIQRKAPPASPASPALSTP
FT                   TPSSTPSSQTATESRLVVLGNSDFATDGLFQQQLNGDVFLNSVTWLSQQDQQPLSIRPK
FT                   EPKNRRITLTTTQGNLLILSSLLLLPLIGFAIAVIIWWKRR"
FT   gene            655919..656545
FT                   /locus_tag="Npun_F0554"
FT   CDS_pept        655919..656545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr1622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79317"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:B2J868"
FT                   /protein_id="ACC79317.1"
FT                   /translation="MKLPRTTLILILLALGLGGFVYFSEIRGATVREETKEENKQIFSF
FT                   AADDVQSLTVKTKKLTLNLERNPESSSNPKWLIKSPVPGPANDAIVSYLMDLLVKGKSD
FT                   RTLSTPPKELGQFALDEPPATINITLKNRQNHQLILGKANFNGRFLYAQADPAAKPDGN
FT                   INVLLVSTDFANAVNRELSEWKQPVDNSQKLPPLTIPKPTPTNSK"
FT   gene            656569..657426
FT                   /locus_tag="Npun_F0555"
FT   CDS_pept        656569..657426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0555"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: ana:alr1623 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79318"
FT                   /db_xref="GOA:B2J869"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J869"
FT                   /protein_id="ACC79318.1"
FT                   /translation="MMTNPTATLLISCPDQRGLVAKFANFIYSNGGNIIHADQHTDFAA
FT                   GLFLTRIEWQLEGFNLPREFIAPAFNAIAQPLSAKWEIRFSDTVPRIAIWVSRQDHCLF
FT                   DLIWRQRAKEFVAEIPLIISNHANLKVVAEQFNIDFQHVPITKDNKSEQEAQQLELLRQ
FT                   YKIDLVVLAKYMQIVSADFINQFSQIINIHHSFLPAFIGANPYHRAFERGVKIIGATAH
FT                   YATADLDAGPIIEQDVVRVSHRDEVDDLVRKGKDLERVVLARAVRSHLQNRVLVYGNRT
FT                   VVFE"
FT   gene            657547..658392
FT                   /locus_tag="Npun_F0556"
FT   CDS_pept        657547..658392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0556"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ana:alr7336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79319"
FT                   /db_xref="GOA:B2J870"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:B2J870"
FT                   /protein_id="ACC79319.1"
FT                   /translation="MLPDNFIVRTMKRSEIDLAITWAASEGWNPGKYDAESFYQTEKNG
FT                   FLLGELNGEPVGCISAVAYDQHFGFLGFYIVKPQFRGQGLGMKIWKTAIDYLGADRNIG
FT                   LDGVVAQQDNYKKSGFQIAYKNIRYQGVGGGVMPAGIIDLKTVPFEELVAYDCQLFPSK
FT                   RPVFLRHWIEQPESTAFGFLKNGYLVGYGVIRPAYTGFRIGPLFANDEQIAEALFQALL
FT                   AENPHAPVFFDVPDANVQAINLVQRYQFEPVFQTARMYTKEIPNLAIDRVFAVTSLELG
FT                   "
FT   gene            complement(658605..659891)
FT                   /locus_tag="Npun_R0557"
FT   CDS_pept        complement(658605..659891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr3926 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79320"
FT                   /db_xref="UniProtKB/TrEMBL:B2J871"
FT                   /protein_id="ACC79320.1"
FT                   /translation="MLFQFAPAIQAGIETGKYLQVFSNGVPLSMARDAVSGQFIAHAIG
FT                   ATVNNSPLSPLVAASNLLISGAQMYQTQQGFTAVLNGLQTIQTSLGVLQATTALIGVGT
FT                   IAGVALTAVNLHQTMKLRKEVEQMRLEVKNGFIDLKQALKDQGVEIRQIIEQVAQDIKF
FT                   EQHRTALVRAYGVFIQAMNRFRSAMQLQDFSRRNAEIDGVRGMLFAALADYSNPHLLEE
FT                   TCAAGQLRRLECAWAIEQAIVATYQVQSEVSAVSDRLILLQDKIREDALTVINRCESHD
FT                   ELDFLFPEIIRIKNHDLAVLDSWQNHVDWMQSLPSSDLKLLSSADFNSTDTHYSTINLA
FT                   EPVEQLMYESLAEKSHFYSLRDQLLFLFDPELRREYEVYISEQAGITGYKTLVTSHLQQ
FT                   ASDLTVSNLYYYFKIRDESKDETELVSSN"
FT   gene            660034..662601
FT                   /locus_tag="Npun_F0558"
FT   CDS_pept        660034..662601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0558"
FT                   /product="Dynamin family protein"
FT                   /note="PFAM: Dynamin family protein; KEGG: ana:all3927
FT                   unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79321"
FT                   /db_xref="GOA:B2J872"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B2J872"
FT                   /protein_id="ACC79321.1"
FT                   /translation="MDTSLVSSQTVELLSQITGQKLTPKNLTPPVIFLANLVTVLLGVI
FT                   FVDGTVAESEKQRLLTTLYRFSIPESDVRKLTHLMIKGVKENQVYKQVNNLLALAAPLS
FT                   ESEKLLLISFGYEMSAADSEIDTREKKYLDIVAKHLGIKPQHLVVLEAGFTHQINIEPI
FT                   ALNEVHFLLNPAQFQQLDIIFIKAASDMLAALPAKSEHKITKPHRNRSYGELKKFQEYR
FT                   KQVDNCCYQLFQIIQDCTNRGFLPHTLIEEVEEISQKVKFQQFRLAVLGEFSQGKSTLL
FT                   NALLGEEIQPVREIPCSGMVTVLKYGTQKRVVCRYKDGREEEIPFEQYQLKATISEDAA
FT                   LGCLSDELAHDEIDEIVFEHPDLELCSSGVEIIDSPGLNEHPDRTAITQKVLKDTDAVI
FT                   FLTNASRSLTQLERDLLQDVRTQLNHGKENEPANNLFVVGNFIDLVRTEKGREQVQQRI
FT                   ERFVKGQNPIVTGENRVHFISAQAALDAILQGTEDDYLKDFQNFTRSIEKFLTFDSGIV
FT                   KIKHSISQINRVVEKGLDGLYQSQDTLDRKIQISEAEKHKVLEKIGEASGRDVRIRILA
FT                   DQLIYLVFEQIAESWDEWREGLGDRLANKSQRWYSEHSPVFSQDKLIRDYTNQFIRDLS
FT                   TEIDEWGNTKLKEVILQENLKHLDISIAYELDAIQGEFNSLDENIQTNFSKQLKISING
FT                   INDDFTGMGGFGGGVGIGGALAAGLIVFTGLGFIAVIVASVAAAIAGSFGFGMLDFDGI
FT                   KDQIKGKVFELGFEKFDESMDKISEKLDEIVGSVFENRVKSSSRVIAEAIALYENLLEQ
FT                   QEKVHNETLEQRESEKMWIYQKRQELEQIHNELEVILNKCTIV"
FT   gene            complement(662704..664347)
FT                   /locus_tag="Npun_R0559"
FT   CDS_pept        complement(662704..664347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0559"
FT                   /product="Lipoxygenase-like protein"
FT                   /EC_number="1.13.11.33"
FT                   /note="PFAM: Lipoxygenase-like; KEGG: neu:NE1239
FT                   lipoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79322"
FT                   /db_xref="GOA:B2J873"
FT                   /db_xref="InterPro:IPR000907"
FT                   /db_xref="InterPro:IPR013819"
FT                   /db_xref="InterPro:IPR036226"
FT                   /db_xref="UniProtKB/TrEMBL:B2J873"
FT                   /protein_id="ACC79322.1"
FT                   /translation="MKPYLPQNDPDPTKRQILLERNQGEYEFDYDFLVPMAMLKNVPSI
FT                   ENFSTKYIAERTLETAELPINMLAVKTRSLWDPLDELQDYEDYFPVLPKPNIIKTYQSD
FT                   DSFCEQRLCGANPFVLRRIEQMPDGFAFTILELQEKFGDSINLVEKLANGNLYVADYRA
FT                   LAFVKGGSYERGKKFLPTPIAFFCWRSSGFSDRGQLVPIVIQINPADGKQSQLITPFDD
FT                   PLTWFHAKLCVQIADANHHEMSSHLCRTHFVMEPFAIVTARQLAENHPLSLLLKPHFRF
FT                   MLANNDLARKRLISRGGPVDELLAGTLQESLQIVVNAYTEWSLDQFSLPTELKNRGMDD
FT                   PDNLPHYPYRDDGLLLWNAIKKFVSEYLQIYYKTPQDLAEDLELQSWVQELVSQSGGRV
FT                   KGISDRINTLDQLVDIATAVIFTCGPQHAAVNYSQYEYMTFMPNMPLAAYKQMTSEGTI
FT                   PDRKSLLSFLPPSKQTADQLSILFILSAYRYDRLGYYDDKFLDPEAQDVLAKFQQELNE
FT                   AEREIELNNKSRLINYNYLKPRLVTNSISV"
FT   gene            664676..665353
FT                   /locus_tag="Npun_F0560"
FT   CDS_pept        664676..665353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79323"
FT                   /db_xref="GOA:B2J874"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:B2J874"
FT                   /protein_id="ACC79323.1"
FT                   /translation="MSQTTLNLVAISIFLMTLSVLLGPFLNLSPAVPALATFAILGIAT
FT                   LDSFSLQGKGGTIFLDWIAGFSSEHRDRIVHHEAGHFLVAYLLGIPVTGYTLSAWEAWK
FT                   QGQPGQGGVSFDDGELASQLEVGKISAQMLDRYCTVWMAGIAAETLVFDNAEGGSDDKS
FT                   KLIGVLTVLGFSESVYQQKLRFHALQAKTLLQENWSSYEALVNAMRQRASVEDCHAELG
FT                   VGE"
FT   gene            complement(665395..666417)
FT                   /locus_tag="Npun_R0561"
FT   CDS_pept        complement(665395..666417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0561"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ava:Ava_0224 putative diguanylate
FT                   cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79324"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2J875"
FT                   /protein_id="ACC79324.1"
FT                   /translation="MNISILIFGKNNFIATLPDQIRYAAAFSVEVIDNLNQAVSRIKIA
FT                   PPDIMLVQASLDGSMELCNWLKEQTKLSWIYCILFEDRFQQLTDRNKGWHRELEMSAAA
FT                   LKQGADAYIWHLIDEKTGHNLAELTANHGLILAQLTVGLRKAQKYRDLIRTNDMLSAIA
FT                   LADSLTELNNRRALEWDLPRQIQRARTQKTSLSLIILDVDHFKKVNDTHGHLVGDRILQ
FT                   ILCQRLRHNLRCQDTAFRYGGEEFVILLANTTDEEALLVARRLNRVVSDEPFALSNKLT
FT                   INITISLGTASLQADDDEQGESLLNRADQCLLQAKNAGRNRVIHSNYLSHVSHLKVVSS
FT                   "
FT   gene            667601..670243
FT                   /locus_tag="Npun_F0562"
FT   CDS_pept        667601..670243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0562"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase, class IIc; phosphoesterase, DHHA1;
FT                   Threonyl/alanyl tRNA synthetase, SAD; KEGG: ava:Ava_0226
FT                   alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79325"
FT                   /db_xref="GOA:B2J876"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J876"
FT                   /protein_id="ACC79325.1"
FT                   /translation="MSSNPQYLSGNEIRNTFLNFFAQRSHQILPSASLVPEDPTVLLTI
FT                   AGMLPFKPIFLGQRTPEFKRATTSQKCIRTNDIENVGRTKRHHTFFEMLGNFSFGDYFK
FT                   EQAIAWGWEISTQVFGFSPQNLVVSVFEDDDEAFAIWRDQIGVPVARIKRLGEDDNFWV
FT                   SGPTGPCGPCSEIYYDFHPERGDENIDLEDDSRFIEFYNLVFMQYNRDVLGNLTPLQNK
FT                   NIDTGMGLERMAQILQKVPNNYETDLIFPIIQTAAQIAGIDYHSSDEKTKVSLKVIGDH
FT                   VRSVVHMIADEIRASNVGRGYVLRRLIRRVVRHGRLIGISGEFTTQVAESAIALSESAY
FT                   PNVRQREAAIKAELQREESNFLRTLDRGEKLLEEIIQEVKQQGSTQISGESAFTLYDTY
FT                   GFPLELTQEVAEENNLTVDAEGFEAQMEIQKGRGRDAHETIDLTVQGSLDKLAEHIQVT
FT                   EFLGYTQSAATAIIEAILLEGVSQEEAEAGTQVQIVLDKTPFYAESGGQIGDRGYISGD
FT                   GIVVRVEDVKKESDFFVHFGRIERGTLRVGDRVTAQIDPACRRRAQANHTATHLLQAAL
FT                   KKIVDDGISQAGSLVSFDRLRFDFNCPRALTAEEVQQVEEQVNSWIAEAHAAKVEVLPL
FT                   AEAKAKGAVAMFGEKYGDEVRVIDFPNVSMELCGGTHVSNTAEIGVFKIISEAGVASGV
FT                   RRIEAVSGPAILDYLNLRDKVVKDLSDRFKVKPEELPDRITSLQSELRNSQKELETLKV
FT                   QLAIAKSDSLLQTAETVGDHKIIVAQLENVDPESLKTAAERLLQKIGNGAVVLGSVPEA
FT                   DKVSIVAAFSPEVNKKGLQAGKFVGAIAKICGGGGGGRPNLAQAGGRDASKLPDALGQA
FT                   ESDLKSALA"
FT   gene            complement(670555..671223)
FT                   /locus_tag="Npun_R0563"
FT   CDS_pept        complement(670555..671223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0563"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   mac:MA2615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79326"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B2J877"
FT                   /protein_id="ACC79326.1"
FT                   /translation="MAHFEIIEKESLRLVKVTLQNETVRTESGAMYYIRGNVQMQSKAP
FT                   SAGGFLKSLATGENIFRPTYTGTGELYLEPSLAGYHILELDGSEWILDTGAYWASDGSI
FT                   EVGIERNKFVSGLIGGEGLFQTKVKGRGKVVMAAQGPVEVINLQNDRLVVDGNFAIART
FT                   NTLNYRVEKATKSLLGSMTSGEFLVNTFEGTGTVLLAPIPYWKVMMIRQITAALPKTSS
FT                   "
FT   gene            complement(671775..673283)
FT                   /locus_tag="Npun_R0564"
FT   CDS_pept        complement(671775..673283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0564"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase A domain protein; KEGG:
FT                   ava:Ava_0501 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79327"
FT                   /db_xref="GOA:B2J878"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J878"
FT                   /protein_id="ACC79327.1"
FT                   /translation="MYEWILPSLSEILAQNQSSVAECSPGKAERQWRVSLAATEHLLLN
FT                   TLAANSVDTTQGLVLAAPAPLFSQPKLTQNLQTVTFTAKPFNPLALMPFQMPDVIAPID
FT                   EEIAPHESVLPLLPADPLGTEQFCLVFTDKFRLVLVLATHKNGKKTFSFSFEPEVVEQA
FT                   WRSLGARVMLANPEFFARLDVLVQQYSPVAPDCRIMIKFSQLLLQELTEAEETREWAIA
FT                   TGEEAGEQGRRVFSHTQSSLALSGAEGIPNPQSQNPDVELLQAFAHEVRTPLTTIRTMT
FT                   RLLLKRRDLDASVINRLKIIDHECTEQIDRMELLFKAAELETTASTKSAKTQLTPMSLD
FT                   QVLQQSIPRWEQAAHRRNLTLNVVLPQQLPTVVSNPMMLDQVLTGLIENFTRSLPSGSH
FT                   IQVQVIPAGDQLKLQLSPQFGCKDSSKAATPATPPIRKALGQLLMFQPETGTISLNIAA
FT                   TKHLFQAIGGKLIVRQRPHYGEVLTIFLPLEVSSKHKSGAKTWE"
FT   gene            complement(673484..675178)
FT                   /locus_tag="Npun_R0565"
FT   CDS_pept        complement(673484..675178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0565"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ana:alr4586 two-component
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79328"
FT                   /db_xref="GOA:B2J879"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J879"
FT                   /protein_id="ACC79328.1"
FT                   /translation="MKISQKLISGILGMATISVIVGAISAHQQLKIAKYLAQQEAEEVA
FT                   GLLGYFVSHELEYHELRSRKEMLAQLQEHVQSLHKQRQRDLEIVDRNKIILADVVTEDI
FT                   GTRLDRDRNNEVGKTIQDGIPRTYVESSPEYPNGIQLIAVAFKTNKGETIGAVILEYTP
FT                   LYKAALATAEKNIIVTLFISLGCSVFALAAGYLLSKSISKPIKQLQLAVVNLAEGKLDT
FT                   RVSIRSQDEIGELATSFNKMADDLQYSRNELVNANEQLRDEITERQEAEAELQQALKEL
FT                   QKTQIQLIQSEKMSSLGQLVAGVAHEINNPVNFIYGNLEYTDDYTQQMLLLIKLYQKHY
FT                   PYPEPEIQNANQLNDIEYLIEDLPKMLTSMKMGAKRIREIVLSLRIFSRLDKAEFKTAD
FT                   LHEGIDSTLLILQHRLKAQNNRPQIQVVKEYGEMPKIQCFAGQMNQVFMNLLTNAIDAL
FT                   EEAFQKELCPNPLIRISSEQVNENAVIRITDNGSGIPKEIQSRLFDPFFTTKAVGKGTG
FT                   MGLSISYQIITEKHGGSLECISSPGQGAEFVIAIPIRAGKLAQSSIA"
FT   gene            675445..676266
FT                   /locus_tag="Npun_F0566"
FT   CDS_pept        675445..676266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0566"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; Male sterility C-terminal domain; KEGG:
FT                   ava:Ava_1000 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79329"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J880"
FT                   /protein_id="ACC79329.1"
FT                   /translation="MTSFETSAEDLVLVAGATGGVGQLVVGKLLEKGLKVRVLTRNAPK
FT                   AEEMFNQRVEIAVGDIRQPATLPAATQDVTHIISCTGTTAFPSARWEFDQPQNLLEWGI
FT                   TFLNPKSSEAKAKNSPAKVDAQGVSNLVTAAPQNLKRFVFVSSCGILRKDQFPFSILNA
FT                   FGVLDAKQKGEESIINSGLPYTIIRPGRLIDGPYTSYDLNTLLKAKTDGKYGVVIGTGD
FT                   TLSGDTSRIDVANACVECLFQPSSSKKIFEIVNQGQRPPVIDWEALFSRLE"
FT   gene            676862..678766
FT                   /locus_tag="Npun_F0567"
FT   CDS_pept        676862..678766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0567"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: ava:Ava_0295 molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79330"
FT                   /db_xref="GOA:B2J881"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B2J881"
FT                   /protein_id="ACC79330.1"
FT                   /translation="MAKVVGIDLGTTNSCVAVMEGGKPTVIANAEGFRTTPSVVAFAKN
FT                   GDNLVGQIAKRQAVMNPENTFYSVKRFIGRRYDEVSNEATEVSYKVLSSNGNVKLDCPI
FT                   AGKPFAPEEISAKVLRKLVEDASKYLGETVSQAVITVPAYFNDSQRQATKDAGKIAGIE
FT                   VLRIINEPTAASLAYGFDKKSNETILVFDLGGGTFDVSVLEVGDGVFEVLATSGDTHLG
FT                   GDDFDKKIVDFLAEKFKKAEGIELRKDKQALQRLTEAAEKAKIELSSVTQAEINLPFIT
FT                   ATQDGPKHLDTTLTRATFEELCSDLIDRCRVPVENALRDAKLSKGDIDEVVLVGGSTRI
FT                   PAVQQIVKQVLGKDPNQSVNPDEVVAIGAAIQAGVLNNEVTGILLLDVSPLSLGVETLG
FT                   GVMTKIIPRNTTIPTKKSEVFSTAVDGQTNVEIHVLQGEREFSNDNKSLGTFRLDGIPP
FT                   APRGVPQIEVVFDIDANGILNVTAKDKGTGKEQSISITGASTLDKTDVDRMVREAEQNA
FT                   SSDKDRREKIERKNQADSLAYQAEKQLQELGDKVPDADKTKVEGLVKELREAVAKEDDE
FT                   QIKKLTPELQQALFAVGSNIYQQAGAGAAPGAEPQDGGSTSSSGSGDDVIDADFTESK"
FT   gene            678920..679572
FT                   /pseudo
FT                   /locus_tag="Npun_F0569"
FT   gene            complement(680107..681987)
FT                   /locus_tag="Npun_R0570"
FT   CDS_pept        complement(680107..681987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0570"
FT                   /product="ABC transporter related"
FT                   /EC_number="7.3.2.1"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: ava:Ava_4342
FT                   ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79331"
FT                   /db_xref="GOA:B2J882"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2J882"
FT                   /protein_id="ACC79331.1"
FT                   /translation="MSIYQSLKKSYTQPRRRENDWRLFLRLVPYARRNGQLLALSMCLL
FT                   IPIALANAVQPLLIGQVISLIRNEPSAYEFLRNRPLSEGLNILEGLLFVAIAIRLIFTG
FT                   YQGYLVQKLGQQITAAIRQDLFQHVTSLAVRFFDRTPVGKLITRITSDVEVLGDVFSTG
FT                   AIGIVSNLFSMLVILGLMFSIEWQLTCLLLLMLLPVTWLIVYIQQQYRKANYKGREELS
FT                   ILNSQLQENVLGINVVQLFRREKFNAELFRATNSRYTQQMDQTIFYDSFISATLEWIGL
FT                   IAIAAVLCMGGWLLLGKSIAFGTLSAFVLYAQRLFDPLRDFAEKFTVIQAGFTAIERVG
FT                   DILDEPIEIRDRANVRFSIFDAKFGYIDEIVANLESPDTTSPPELGEICFDRVWFAYKN
FT                   DDYVIKDLDFTIRPGEKVALVGPTGAGKTSIIRLLCRLYEPTKGRILIDGVDIREVPQA
FT                   ELRRYMAVILQEGFLFAGDVKSNISLGDGYTIEQIQQAAEQTNIAQFIEELPQGYDTQL
FT                   RERGTNISSGQKQLLAFARAAIRDPQILVLDEATASLDVGTEALVQEALNQLMLRRTAI
FT                   IIAHRLSTIRNVDRIFVLKRGELIEQGSHDQLLEQGGLYATLHNLQMLGS"
FT   gene            complement(682182..683189)
FT                   /locus_tag="Npun_R0571"
FT   CDS_pept        complement(682182..683189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0571"
FT                   /product="aldo/keto reductase"
FT                   /EC_number="1.1.1.65"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pca:Pcar_1098
FT                   putative oxidoreductase, aryl-alcohol dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79332"
FT                   /db_xref="GOA:B2J883"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2J883"
FT                   /protein_id="ACC79332.1"
FT                   /translation="MQKRTLGNSNLEVSAIGLGCMGMSFSYGPPKDTEEMTALLRAAID
FT                   RGITFFDTAEVYGPFLNEELVGEALAPFRDQVVIATKFGFDISPNSDPRGMKGSPGLNS
FT                   RPEHIKEAVEGSLKRLKVEAIDLLYQHRVDPNVPIEDVAGAVKELIQSGKVKHFGLSEA
FT                   GVQTIRRAHAVQPIAALQSEYSLWWRKPEAEVIPTLEELGIGFVPYSPLGKGFLTGKMD
FT                   ESTTFDSSDFRSTLPRFTKEALKANQALIDLLGSIAEQKQATPAQIAIAWLLAQKSWIV
FT                   PIPGTTKLHRLDENIGAVSVELTPDDLRNIDDAASKIAVQGARYPEKLEQMTGR"
FT   gene            complement(683359..684195)
FT                   /locus_tag="Npun_R0572"
FT   CDS_pept        complement(683359..684195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0572"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   hch:HCH_06924 short-chain dehydrogenase of various
FT                   substrate specificities"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79333"
FT                   /db_xref="GOA:B2J884"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J884"
FT                   /protein_id="ACC79333.1"
FT                   /translation="MSKVWFITGAGSGIGTGTAKAALQSGDRVVATGRNLDKVRNALRD
FT                   VASENLAFVQLDVSDEVQAKTAIEEAVNRFGRIDVLVNNAGYSLLGNFEEMTTTDIERQ
FT                   FATNFYGVVYVMRAVLPIMRQQRSGHIINISSVAGVVGFKHCAAYAASKFAVEGISLSV
FT                   AVEVEGFGIKMTLVEPGFFRTDLLDDQNVRWPSNAIEDYAAEGNVQDTWSVYNGTQQGD
FT                   PAKLGDALVKIAGMENPPKLFVAGSDALATIAPAVEERLQATHAHEELSKSTDGSF"
FT   gene            complement(684268..685059)
FT                   /locus_tag="Npun_R0573"
FT   CDS_pept        complement(684268..685059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0573"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mba:Mbar_A0768 4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79334"
FT                   /db_xref="GOA:B2J885"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2J885"
FT                   /protein_id="ACC79334.1"
FT                   /translation="MTNTPQKDKTQSSVRISEAAHKNHEELFPNHKSTLKVTDPELIEV
FT                   FDNFAFDEVIAESKLDTKTRIMLILASIIGNQAVSEYRVMVGAALNVGVTPVEIKEILY
FT                   QSVPYVGMAKAFDFVHATNEVMSSRGIQLPLEGQSTTSPETRYDKGLAIQKAVFGETID
FT                   QMYERSPKDQLHIQRFLSANCFGDYYTRNGVDISVRELITLSILIALGGVESQIKWHIQ
FT                   GNLNVGNGKDILLDLITQLLPWVGYPRTLNVLKCLNEVATE"
FT   gene            complement(685106..685378)
FT                   /locus_tag="Npun_R0574"
FT   CDS_pept        complement(685106..685378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2445 aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79335"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2J886"
FT                   /protein_id="ACC79335.1"
FT                   /translation="METVIWKSRRSGWALNYAYSHTLDKQESISLLQAVVPIPGTTKLS
FT                   RLEENIVAADIELTQDELKSIDEALAQITVEGDRYPEALEKRTGL"
FT   gene            complement(685421..686479)
FT                   /locus_tag="Npun_R0575"
FT   CDS_pept        complement(685421..686479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0575"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /EC_number="1.1.1.255"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sus:Acid_5835 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79336"
FT                   /db_xref="GOA:B2J887"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J887"
FT                   /protein_id="ACC79336.1"
FT                   /translation="MYNTKAYSAASATSPMSSTQIARRDPTEHDVQIEILFCGICHSDL
FT                   HSVRNEWSSIISTVYPIVPGHEIVGRVTEVGSAVTKYKPGDLAAVGCLVDSDGTCLNCK
FT                   AGLENFCPNQILTFNSPDKHLGGVTYGGYSDSIVVDERFVLRVPSNLDLAGAAPLLCAG
FT                   ITTYSPMRHWGVTEGKKVGLVGLGGLGHMGVKFAHAFGAHVVVFTTSPDKKEDALRLGA
FT                   DEVVVSRNADEMQKHAGSFDFILDTVSAKHDINAYLNLLRLDGNITLVGAPEKPLDVAA
FT                   FSLIMARRSLSGSNIGGIPETQEMLDFCGKHNITADVEVIPIQKVNEAYDRLLKSDVKY
FT                   RFVIDMASLKSE"
FT   gene            complement(686707..687450)
FT                   /locus_tag="Npun_R0576"
FT   CDS_pept        complement(686707..687450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0576"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: xfa:XF1744 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79337"
FT                   /db_xref="GOA:B2J888"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J888"
FT                   /protein_id="ACC79337.1"
FT                   /translation="MIKDKVVIITGASSGIGEASAKLLASKGAKVVLGARRDRQLRQLV
FT                   DEIQRDGGQAVYQVMDVVNPSDSAEIVNLAKERFGGIDVIFLNAGIMPNSPLSALKTDE
FT                   WNQTVDINIKGVLNGIAAVLPTFISQKSGHVITTSSVAGLKAYPGGAVYGGTKWFVRDF
FT                   MEVLRMESAQEGTKIRTATIYPAAINTELLNQITNQDMAEKMTELYEQYGISPDRVANV
FT                   VAFAIDQPEDTNVNEFTIGPTTQPW"
FT   gene            complement(687548..688267)
FT                   /locus_tag="Npun_R0577"
FT   CDS_pept        complement(687548..688267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0577"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   ade:Adeh_3211 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79338"
FT                   /db_xref="GOA:B2J889"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2J889"
FT                   /protein_id="ACC79338.1"
FT                   /translation="MKKLIVFLALVSVMIFSLSCMSDAQTMNNDQTLDARQQSIVTIAA
FT                   FTANGDLEDLSAALNEGLDAGLTVNEIKEVLVQLYAYAGFPRSLNALNVFMSVMKAREA
FT                   KGIKDVAGKEASPLSTDKSRLELGTEIQTRLSGSPVAGEIYTFAPAIDQFLKSHLFADI
FT                   FGRDNLDFQSREIATIAALSSMKGVNPQLQAHFRIGMNTGLTKAQMNSLVSVLKSKVGK
FT                   PEADNAAEVLNKVLSNK"
FT   gene            complement(688444..689217)
FT                   /locus_tag="Npun_R0578"
FT   CDS_pept        complement(688444..689217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0578"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mac:MA0415 2,5-dichloro-2,5-cyclohexadiene-1,4-diol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79339"
FT                   /db_xref="GOA:B2J890"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J890"
FT                   /protein_id="ACC79339.1"
FT                   /translation="MTKNENGNYTGKVAFVTGAANGIGRATALAFAREGANVVVADVSE
FT                   QGNQETVRLIEDLGGRVLAVKCDVTRTEDVTAALSKTIETFGRLDFAFNNAGVEQKKAA
FT                   TAELEEAEWDRIVNTDLRSVFLCLKHEIPLMLKQGGGAIVNTSSGAGVIGIKGGAAYTA
FT                   AKHGVIGLTKAAALDYASQNIRINAVCPGYIDTSMMDRFTGGTPEGRQKVVSEEPIGRM
FT                   GQPEEIANAVVWLCSDASSFVVGHALIIDGGQTVQ"
FT   gene            complement(689307..689702)
FT                   /locus_tag="Npun_R0579"
FT   CDS_pept        complement(689307..689702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0579"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rle:RL0775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79340"
FT                   /db_xref="GOA:B2J891"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2J891"
FT                   /protein_id="ACC79340.1"
FT                   /translation="MKARRFPILGASVLTLCLLCACGRAPAEQTQGRMVRLSEIEIDPA
FT                   LLENYKAELREEIEASIRLEPGVLTLYAVSLKDSPTSIRILETYADVDAYKAHIESPHF
FT                   KKYKTNTQQMVKSLKLVETDPVLLGAK"
FT   gene            complement(689772..690320)
FT                   /locus_tag="Npun_R0580"
FT   CDS_pept        complement(689772..690320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_1581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79341"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:B2J892"
FT                   /protein_id="ACC79341.1"
FT                   /translation="MLLKWFPVKGKNCQQRILILVLALVMSLSNSACRADNSMTSSASL
FT                   KMPTEISIKQADSMKINIKVKDKVVTAALIDSKTTQDFVSLLPLTLTMNDLFGREKFAH
FT                   LPRAISEEGERTKTYEVGEVIYWSPGPDVAIYYRHGGEEIPDPGIIVIGKIDSDLEAFN
FT                   LPGSLKVTIELDQTSIAPK"
FT   gene            complement(690320..690721)
FT                   /locus_tag="Npun_R0581"
FT   CDS_pept        complement(690320..690721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0581"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: aba:Acid345_2510 conserved hypothetical protein,
FT                   cupin barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79342"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2J893"
FT                   /protein_id="ACC79342.1"
FT                   /translation="MDIKRSGSQPSAKGPADYFTGTVRIDPLFEAHDPARTSGASVTFE
FT                   PGARTAWHTHPLGQTLIVTAGCGLVQRWGGSIEQIRPGDTIWISLGEKHWHGATATTAM
FT                   THIAIQEWLDGKPVDWMEHVSDKQYGGIS"
FT   gene            690930..691910
FT                   /locus_tag="Npun_F0582"
FT   CDS_pept        690930..691910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0582"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bbr:BB2415 putative AraC-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79343"
FT                   /db_xref="GOA:B2J894"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2J894"
FT                   /protein_id="ACC79343.1"
FT                   /translation="MNAAKTSEKSNIDLMNDPQAKRQVDRAQANRDELKELIAQAIPHD
FT                   GTIEPLKGLHFNRSSSPSECVHSVSIPAFCAIAQGSKEVLLGSERYQYDPMHYLLATVE
FT                   LPIVSQILEASKAQPYLSLRLDLDPTLVGSVMVEAGYPSRRRADVKAIDVSPLNANLLD
FT                   AVVRLVRLLDSPAEAHVLAPLIKREIIYRLLMGEQGNRLRHIAVLGGYTYHIARAVERL
FT                   RKDFNEPIKIESIARELGMSVSGFHHHFKSVTAMSPLQYQKQLRLQEARRLMLGEKLDA
FT                   TSAAYRVGYDDASHFNREYKRLFGAPPMRDVERLREAARETASSI"
FT   gene            692654..693676
FT                   /locus_tag="Npun_F0583"
FT   CDS_pept        692654..693676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0583"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ana:alr1081
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79344"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J895"
FT                   /protein_id="ACC79344.1"
FT                   /translation="MKQPLNQVKEWEQRRDEANRYYQRGKFQESLDLATKNLHLARAIR
FT                   DRAREGHTLNDLGLAHLSCWQPQRALERFNQALSVAIEIGNPPAEATALSNLGSTYSRL
FT                   GRFSQALEYFDKALPIFRRSQDIQSEVSTLNDVALIYTRLGEPKRALLLQHQILRMRRL
FT                   LGDFSGEATTLNGIGFAYNVLGKFEQALEFFEAALPIQRAVKNVLGEATTLNNIASIYS
FT                   DLGKPKQALLLYYQVLLTRQAISDRAGVATTLHNIGFTYSTLAQHRQAMKFYKQGIVIY
FT                   QQLGDNLGEISTLLNMGTLYATTKRKKMARSCYQNAQDLAEQIEHQPLLEKVQQFIDSL
FT                   "
FT   gene            694044..694262
FT                   /locus_tag="Npun_F0584"
FT   CDS_pept        694044..694262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1671 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79345"
FT                   /db_xref="InterPro:IPR040278"
FT                   /db_xref="UniProtKB/TrEMBL:B2J896"
FT                   /protein_id="ACC79345.1"
FT                   /translation="MFINELSPIFREFIQHPASFVGGLFSGVLRLNLADDPVKSWLDQQ
FT                   SRSNSYTSSTTEAHNGKASGPQQISID"
FT   gene            694362..695675
FT                   /locus_tag="Npun_F0585"
FT   CDS_pept        694362..695675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0585"
FT                   /product="aminotransferase, class I and II"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   ava:Ava_3695 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79346"
FT                   /db_xref="GOA:B2J897"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2J897"
FT                   /protein_id="ACC79346.1"
FT                   /translation="MKKDVFRDAQRSKIGVLVTTHACNPWVSPIPNSQFPIPNTQYPIH
FT                   SQGNMESLTSRMQDVQSPIIPVVGELIKNSPGTISLGQGVVHYNPPPEAIEFLSKFLAD
FT                   PANNLYKSVEGIPPLLTAIAGKLQAFNGIEINGENCIVVTAGSNMGFMNAILAITNPGD
FT                   EIILNTPYYFNHEMAIAIAGCRAVLVATDENYQLRPEAIAQAITPKTRAIVTISPNNPT
FT                   GVVYSEAALRQVNQICDTHRIYHISDEAYQYFTYNGVKHVSPGAFGKSKYTISLFSLSK
FT                   AYGFASWRIGYMVIPKHLFVAIKKVQDTILICPPVISQYAALGALQAKEEYLQSNIGAI
FT                   FQVRQLVLDSLNRLEGLCSITPANGAFYFFLKVNTQMDAFELVKRLIQEHKVAVIPGTT
FT                   FGMDDGCYLRVAYGALQKETAKEGIERLVQGLETIVRS"
FT   gene            695746..696183
FT                   /locus_tag="Npun_F0586"
FT   CDS_pept        695746..696183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0586"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   ava:Ava_3696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79347"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B2J898"
FT                   /protein_id="ACC79347.1"
FT                   /translation="MPIINKLIEIETEPKINIYNITPEIQDFLASTSIKNGQVLVFSRH
FT                   TTTALAINENEVRLLEDIKVFLKKIAPESDSYLHNDLHLRDVPEDEPINAHSHLMAMML
FT                   TTSEIIPIVDGKLALGTWQSVLFFELDGPRKRTVFVQISGE"
FT   gene            696370..697446
FT                   /locus_tag="Npun_F0587"
FT   CDS_pept        696370..697446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0587"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /EC_number="1.14.12.7"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   tel:tll1694 Rieske 2Fe-2S family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79348"
FT                   /db_xref="GOA:B2J899"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2J899"
FT                   /protein_id="ACC79348.1"
FT                   /translation="MKNNDNFVLRNTWYYALPSNQIKPGMMISRIFLGEPVLLVRDQNG
FT                   KVSAMRDICPHRAVPLSCGRFDGQEVECCYHGWRFNSAGRCTAIPSLVEEQQMDLSRFD
FT                   VQSYEVREAQGNIWIYMADPDKSQPAASDMEIPVIPGFEERSLRGASPTPQFVEVMKFP
FT                   CFVDHAVVGLMDPAHSPYVHRAWWWRSGQLHEEVKQFDASPYGFTMRRHRLPANGGRLY
FT                   LLIGGGVPETEISFRLPSVRIEETTIGNHRVVNLTAVTPISDTETEVTFVLYSTLPWVG
FT                   FFKPLLHVLAQTFLGQDRTVVEKQQIGLKYNPVLRLIKDSDMQAQWYYQLKREYARSVA
FT                   EGREFVNPVKDQVLRWRA"
FT   gene            complement(697967..699373)
FT                   /locus_tag="Npun_R0588"
FT   CDS_pept        complement(697967..699373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0588"
FT                   /product="cyclic nucleotide modulated signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: cyclic nucleotide-binding; ATP-binding region,
FT                   ATPase domain protein; KEGG: gvi:glr2212 similar to
FT                   two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79349"
FT                   /db_xref="GOA:B2J8A0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A0"
FT                   /protein_id="ACC79349.1"
FT                   /translation="MLCIEELIDLDPFQQLSQEQLEWVCDRAQTVELSAGEVLSHEGDL
FT                   ACRLFILVKGKIKITRRSEGVEIPIGQHEAPSFFGEIPVLTDEPAPVTMRALTNCHLYQ
FT                   LKGEDFRKLLHECRNFERMVFRIMERRLRGLESFIRGREKMAALGTLSAGLAHELNNPA
FT                   SALVRTLGEMPAAILELQRMNLVYGQRNVEEAHTQDWLRIRDQGYDAILNNRLDPVTLS
FT                   DRENVLLEWLEDYGVKQAWKLAEPLAEGGVEVETLDKMMERWRNDETELREMGLHWLSL
FT                   SFEVMSMIKHGLRGAERISELVQAMKSYSYLDQGVQQEVNVHQGLEDTLRLFVHKLKCG
FT                   IQVQRNYDQHLPKILAYGSELNQVWTNLIDNAIDAMDGKGLLEITTYHCDRFAHIDIID
FT                   SGSGIPPEIKTRIFEPFFTTKSVGRGSGLGLETVRRIVENRHHGTLSFESQPGRTCFTI
FT                   CLPKSAPLGN"
FT   gene            complement(699405..701069)
FT                   /locus_tag="Npun_R0589"
FT   CDS_pept        complement(699405..701069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0589"
FT                   /product="response regulator receiver modulated
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; response regulator receiver; HI0933 family
FT                   protein; KEGG: gvi:glr0480 thioredoxin reductase carring
FT                   response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79350"
FT                   /db_xref="GOA:B2J8A1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A1"
FT                   /protein_id="ACC79350.1"
FT                   /translation="MAKPAILTVDDDPEVLQAVSRDLRHQYGDRFRIVRADSGITALDA
FT                   VQQLKLRNEAVALFLVDQRMPQMGGVEFLEQAKVIFPDAKRALLTAYADTDAAIKSINS
FT                   ARLDYYLLKPWNPPEERLYPVLDDLLDDWLAGFRPPFEGIRVIGNRWSPFSHQVKDFLA
FT                   RNQIPYKWLDIELEPDAAKLLEYAQADGRQQLPLVLFPDGSRLIQPSNLEIAAKIGLQT
FT                   QAERPFYDLAIVGAGPAGLAAAVYGASEGLSTVLIEREAPGGQAGTSSRIENYLGFPVG
FT                   LSGSDLARRGVTQARRFGVEILTPQVVTGVKLQDPYRVLQLADGSEISCHALLVATGVS
FT                   YRWLNVPGAEKLTGAGIYYGAAMTEAIACSNEEVYLIGGANSAGQAAMHFSKYASKVIM
FT                   LVRGESLSLSMSQYLIDQIAATANIQVCTGCSVVEVKGDEHLEEIAIAHSKTGQTEIVP
FT                   ARSLFIFIGAIPKTDWLDGVIRRDTQGFIVTGPDLTQNGKSPPGWPLERSPFLLESSVP
FT                   GIFAAGDVRSGSIKRVASGVGEGSIAIQFVHRYLSNV"
FT   gene            complement(701134..701352)
FT                   /locus_tag="Npun_R0590"
FT   CDS_pept        complement(701134..701352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr3389 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79351"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A2"
FT                   /protein_id="ACC79351.1"
FT                   /translation="MKSMAEHPFHDQLGLEEQAEKLGKQAVSLGLIPSFVVHYFPDTWV
FT                   FYIPNESQSEALTPEEAYFRLNQLVRQ"
FT   gene            complement(701826..703562)
FT                   /locus_tag="Npun_R0591"
FT   CDS_pept        complement(701826..703562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0591"
FT                   /product="flavin reductase domain protein, FMN-binding"
FT                   /note="PFAM: beta-lactamase domain protein; flavin
FT                   reductase domain protein, FMN-binding; flavodoxin/nitric
FT                   oxide synthase; KEGG: ana:all4444 flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79352"
FT                   /db_xref="GOA:B2J8A3"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A3"
FT                   /protein_id="ACC79352.1"
FT                   /translation="MSVATLTPNHSRDVQVAEIGKNTLILRSRTWDRLKFEVEYSRQRG
FT                   TTANSYLIQGEKKALIDPPGESFTEIYLEQLAQYLDFISLDYIVLSHVNPNRRATLQVL
FT                   LSLVPQATLICSRPAANALKTAFPELESPIQAVRSGDTLDLGQGHHLSFVTVPTPRWAD
FT                   GLCTYDYATKILYTDKLFGAHICEDTLFDEDWKGLDAERRYYFECLHAPQAKQVEVVLD
FT                   KLSLLGARCYAPAHGPVVRYSLSRFTYDYRQWCQGQKSQELSVALLYASAYGNTAIMAN
FT                   AIAQGLIQNGVNVESINCELADSAEINRIVETCDGLIIGSPTLGGHAPTQIQTALGIVL
FT                   SVAAKTKLAGVFGSYGWSGEAIDLIESKLKDANYQLGFETIRVRFSPTSEILQQCQEAG
FT                   AFFAQNLKKTKKLRSSRQIVTETHVDRTEQAVGRIIGSLCVVTTRDEETHKGVLTSWVS
FT                   QATFNPPGIMIAIANEQNADLMHHPGDKFVLNILKEGRNVRRYFSRHSTLGDNPFANLA
FT                   TKTALNGCLILNEALAYLECTVQNQLECGDRWLIYAVIDRGEVLENDGITALEHRKSGS
FT                   YY"
FT   gene            complement(703714..704226)
FT                   /locus_tag="Npun_R0592"
FT   CDS_pept        complement(703714..704226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79353"
FT                   /db_xref="GOA:B2J8A4"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A4"
FT                   /protein_id="ACC79353.1"
FT                   /translation="MYKSVENTPITMYEINRGRVVRSLEFIQDVIVISLCIGLFSFMVL
FT                   QVRDMFLSLLPPLDFHAVTADILFLLILVELFRLLIIYLQEHRVSIGVAVEVSIVSALR
FT                   EVIVKGVLETSWSQVLATCAFLLVLGVLLFLRVWLPPTFEGIDPEQEVSKRYRSRAKSE
FT                   LIQNNGH"
FT   gene            complement(704336..707524)
FT                   /pseudo
FT                   /locus_tag="Npun_R0593"
FT   mobile_element  complement(705963..707414)
FT                   /mobile_element_type="transposon"
FT   gene            complement(705979..707319)
FT                   /locus_tag="Npun_R0594"
FT   CDS_pept        complement(705979..707319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0594"
FT                   /product="transposase"
FT                   /note="KEGG: ana:all7115 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79354"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A5"
FT                   /protein_id="ACC79354.1"
FT                   /translation="MPDILSLLQCLLPQINATTMRQLNQIILAMLALSGRVTMLGIARW
FT                   AGDGGSYRTMGRFFSTVIPWATLFWLFFRQHLWRKNDVYLLAGDEVVVSKSGKQTYGVD
FT                   RFFSSLASKPINGLSFFVLSLVSVEGRQSFPIGIEQVIKSDAQINNTLPIKKVKAKEKR
FT                   GRGRPKGSKNKNKTEVILTSELLLIKKRINSLFELVANFIPLTYLVVDGHFGNNNALQM
FT                   VRQVNLHIISKLRHDSSLYIPYENPDSNKRSRRKYGEKLDYRNLPEKYLCKSDIEDGIQ
FT                   TDIYQATLLHKEFAQSLNVVILVKTNLKANIRSHVILFSSDLDLTADRIIDYYKLRFQI
FT                   EFNFRDAKQFWGLEDFMNLSQTAVTNAANIAFFMVNLSHHLLADFRKHNPGSGIIDLKA
FT                   YYRGFRYVHEMLKILPQKPEPILLAQIFAKLTSLGRIHPLSTGVEPS"
FT   gene            707745..708719
FT                   /locus_tag="Npun_F0596"
FT   CDS_pept        707745..708719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0596"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="KEGG: ava:Ava_1372 1-aminocyclopropane-1-carboxylate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79355"
FT                   /db_xref="GOA:B2J8A6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A6"
FT                   /protein_id="ACC79355.1"
FT                   /translation="MSVIFFPPPIQQINSEIIRSAGVDLYVLRLDLMHPWVNGNKWFKL
FT                   KYNLLEAKEKNFTTLLTFGGAYSNHIYATAAAGNLFGFRTIGVIRGEERLPLNPTLNFA
FT                   VQQGMQLVYTNREMYRQRNTPVVEEYLQQRFGEVFIIPEGGSNLNGVRGCMEIIGDAMS
FT                   TAVTERSRSAGYAYAFDRICVACGTATTLTGIALSLHQGQRAIAFPVLKNGSFLAQEIE
FT                   SLLTNYLASDLPTPSNSPAFWELVCDYHFGGYAKVNKELLLFSQQFREEHGIPLDYVYT
FT                   AKMFYGVMDLLKQGFFSKGDSLLLVHTGGLQGNVGMEERFQRM"
FT   gene            708866..713440
FT                   /pseudo
FT                   /locus_tag="Npun_F0597"
FT   mobile_element  complement(709999..711336)
FT                   /mobile_element_type="transposon"
FT   gene            complement(710027..711260)
FT                   /pseudo
FT                   /locus_tag="Npun_R0599"
FT   gene            complement(713545..714204)
FT                   /locus_tag="Npun_R0602"
FT   CDS_pept        complement(713545..714204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0602"
FT                   /product="Methyltransferase type 11"
FT                   /EC_number="2.1.1.17"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: sru:SRU_0780
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79356"
FT                   /db_xref="GOA:B2J8A7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A7"
FT                   /protein_id="ACC79356.1"
FT                   /translation="MMTVNQIIGDSQNQINANFGKRFFAWIMAQSSSTYNKIVSDRKRS
FT                   LFANLQGKVLEIGPGTGPNLPYYPKDIHWIGIEPNPHMHSYLQKQAKKLGLNIDLRIGN
FT                   AEWLDAEDNSIDTVVSTLVLCSVPNIDYTLQAILRVLKPGGRFLFIEHVAAPQGTVLRQ
FT                   VQSAIRPTWQVIGDGCHPDRETLIALENAGFASINYERFDAQLPIVSPHIIGVATN"
FT   gene            complement(714605..714865)
FT                   /locus_tag="Npun_R0603"
FT   CDS_pept        complement(714605..714865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl5085 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79357"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A8"
FT                   /protein_id="ACC79357.1"
FT                   /translation="MGRLNPYTLQLQITRMFEQGQSFFATTKVQEWLKERKHNPEDYDI
FT                   LFHKKPAPPGSKEVMVVEIELRRKDGQPVDPWLQEQANLHA"
FT   gene            715346..717430
FT                   /locus_tag="Npun_F0604"
FT   CDS_pept        715346..717430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0604"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ana:all1322 unknown
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79358"
FT                   /db_xref="GOA:B2J8A9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8A9"
FT                   /protein_id="ACC79358.1"
FT                   /translation="MVVMKSKNQAVFALIVKSTIVFLPLLLSVGIANGQSAPSLSPALT
FT                   QISVLSNQEREELARLRAEKRIQQQVQSDFNSAFSRTTILLNVWLVILSLFPVAIIALF
FT                   WLLRRVVIREIVDRAMQQLQGMEKLQNQLATVKQEAENVIQDAKKINDELERETVSLQQ
FT                   KIKSEQENFSTLTSELDLAKSQVLSRLESQLKKSQENIESLESHFATVVSKLELDAQQQ
FT                   TDVALENLGNLASVLTQELSNLKLGVQQQQELAVADLQVSRSEFISQLSGWQSDAQKQK
FT                   DIVFEKLAKLQSEFANQLSELQVDTHDKKENAFESLGKLDNELKSQLSELQADAQEQKN
FT                   KIVESLAALQSEFAEQLSELQLDAQKRKVLIIENLEKSASEFSSQFSELQWNAQQQKII
FT                   ILEKLERLETEFVSQLSELQLDAEERKDLILQELTEITPESILEAVNYEVKEEKEVEEP
FT                   PQQPELTAEEYVKEGDELFSKRRYEDAIAAYNQAVKIQPDEPVAWLKRGLTLGRLKRYK
FT                   DAIASYERAIQIQPDYHQAWCDRGVAFGKLQQHQQAFASFEKATQIKPDDAVAWLNCGL
FT                   SLVALEKYEEAIVSFDKALEFQPNSPKIWDKRGYTLVRLGRDDEAIASFNKTLEIKPDY
FT                   ASAYYNKAACYALQRQVELSLATLKQAIELDPRYKEDAATDLDFDDIADDERFKQLVTA
FT                   "
FT   gene            complement(717449..718231)
FT                   /locus_tag="Npun_R0605"
FT   CDS_pept        complement(717449..718231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_4227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79359"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B0"
FT                   /protein_id="ACC79359.1"
FT                   /translation="MLTTLPDTSANLAIALLINYSFDLSGYTANELVERWQTQYPLNWL
FT                   HLAVIEALYQGRYKAVSVQQILVFWQRRDQATYHFNMEFERMICSKFPQSLTSSPAPSL
FT                   PLVKRNPIVERVTSPQLPPAKIRNGYQNSNTATLQLKSYEQKTSLDEEEAKQEARDNKT
FT                   VLKSPLSGKFASSATLQLSSAVSQRQTLQESSPPPSPPSHHQRQPKLLPPAAIHAPIGQ
FT                   FTPEKSDRSESFTSKLKAMSSEPNPPDMGSGEMREKNQ"
FT   gene            complement(718363..720051)
FT                   /locus_tag="Npun_R0606"
FT   CDS_pept        complement(718363..720051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0606"
FT                   /product="protein of unknown function DUF1565"
FT                   /note="PFAM: S-layer domain protein; protein of unknown
FT                   function DUF1565; KEGG: ava:Ava_4228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79360"
FT                   /db_xref="GOA:B2J8B1"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR011459"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B1"
FT                   /protein_id="ACC79360.1"
FT                   /translation="MRVYNLCVEIICLQEKVTWIYFLYTVILLSKSLLQVVLFMIVIIK
FT                   TIDSQLSMVNSTLVVTLYINPMKGNDTNTGSRLSPFKSLTRALKITKIPTIIHLEPGTY
FT                   SAASGEVFPLIIPEGATVMGNEVNKGADIVICGSGEYQSPSFGIQNITLLLLDDASLLG
FT                   VTVTNPSAKGTGIWIESAAPTLANNTLRDCGREGVFVTGAAKPEILDNIFVQNTASGLV
FT                   IAGHSQGEVLWNLFERNPLGIAISDFATPTIANNKLSENRTAIALSRNAQPVLRQNLIT
FT                   KNTQGGLLVNGNAIPDLGNTQDSADNIFRDNSEFDLYNATKQKLISVGNHLNPFLVKGL
FT                   AELIPANPVAVSTNLSDAPAPAPSQKLPAPVQLDAHWAEPFIQALVSMDLTHRFADGSY
FT                   QPDQPMTRAQYASLVAIAFNPFPKISAPDFTDVPKDFWAYSAIQVAASGGFVGGFSDRT
FT                   FRPNQHVQRLQVIVSLVNGLGLAAIDSDILEIYSDRHTIPDYARKAVATATQQKIIVNY
FT                   PDPQLLAPLRLATRGEVAAMVYQALVAIGRTSAIKSFYVGLHSRS"
FT   gene            720314..722614
FT                   /locus_tag="Npun_F0607"
FT   CDS_pept        720314..722614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0607"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187; KEGG:
FT                   ava:Ava_1769 protein of unknown function DUF187"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79361"
FT                   /db_xref="GOA:B2J8B2"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B2"
FT                   /protein_id="ACC79361.1"
FT                   /translation="MTTQFWEKSIGINATLTNLLLNPVRRCLLLCRSKLRKASDGVAAS
FT                   RQTSPFIHQGWWLLRKRLLPLLFLISFVAVLLLNSFAPAIAQLPPQPRQEIRGVWLSSN
FT                   DFSVFRNRSKVQAAMSQLRQLNFNTVYPVVWNDGYTHYPSAIMQKMGIPFFFKGVDGQD
FT                   VIADIISQAHSQGLLAIPWFEFGFMVPLSSELASQHPDWLTQMRDGTQTSTNAAAEVAW
FT                   LNPFHPEVQKFITELVMEVITQYDADGIQFDDHTGLPVDFGYDKYTISLYTQETGNPPP
FT                   PNPQAQAWIKWRADKITAFMVDLYQTVKSRKPNAIFSVAPDYYNFAYKLYLQDWLNWVR
FT                   LGIVDELVMQVYRKDLESFITQITRPEILETQQIIPTGIGITAGLRNSPVALPQIQSQV
FT                   QAAQQRGLGISFFYYESLWDIAPEPAAQRQSAFAALFPNPALRDISQNPPRKPTFDTIS
FT                   LPLYTKPSLGQRVRGYFLEMAIANGQPKRILLDTGSAGLRVPKEFLGNAPIRRTGQNIK
FT                   EILSDGTILEGELVYTNIRFGLLPATEPVPVQVVTSRQCTAQKPNCSAKNGVPFSGIIG
FT                   VNYFEKSLPYNPLRKLPGNLSNGFIVTGNGGNNNNGSLILGLTADNQAGFKMAPWNKQS
FT                   KINDVPGNRWDSQVSKVCLTIAGSSAKNLCNGKMIADTGTINGLTEFKSASTAGKLKPG
FT                   VLRSANAVKVAINGIFDYSLTPGTRDGFNRWNLSISPQSEVPTFVNTGIAFFDKYDVLF
FT                   DQVNGRQGFRSRR"
FT   gene            complement(722807..723637)
FT                   /locus_tag="Npun_R0608"
FT   CDS_pept        complement(722807..723637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all7259 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79362"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B3"
FT                   /protein_id="ACC79362.1"
FT                   /translation="MVLWLNLRSSTQSISTVVSSPPKSIRYFERTLPQSIAHVLFIPVN
FT                   SKFLVTPALSQKVATVEEFAQKHRAVAILNAGFFDPANQKTTSYVILQRKLVADPKENE
FT                   RLVNNPNLKSYLSQIFNRTEFRRYSCGQTVRYDIVLHSASQPAGCQLVDAIGAGPSLLP
FT                   ELTLEKEGFVDNANKRDALGSNQPNARTAVGITHDGSVVLVMVAQKPSAPANGISLPAL
FT                   ANFMKTLGADKAMNLDGGSSSSLYYNGKTFYGKVDLEGNPIKRPVKSVLLVQEN"
FT   gene            724363..724683
FT                   /locus_tag="Npun_F0609"
FT   CDS_pept        724363..724683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0609"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2767 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79363"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B4"
FT                   /protein_id="ACC79363.1"
FT                   /translation="MLETTNLKNISKKFAIARNFSSFKENEAMRAITYSMDLLLPGLYI
FT                   WLFGFSFRLGGNIPDDIPYKYPGKIHSNTGIALVLPGYRIFTTYQGSYDPKQTSNTGAS
FT                   SF"
FT   gene            complement(724967..727135)
FT                   /locus_tag="Npun_R0610"
FT   CDS_pept        complement(724967..727135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0610"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ava:Ava_1343 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; CHASE3 domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79364"
FT                   /db_xref="GOA:B2J8B5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B5"
FT                   /protein_id="ACC79364.1"
FT                   /translation="MVKKWYRVQKLKAIFVLALAVVFTNAVVSYNNTVKLIHNQQWVTS
FT                   SYKVITQLESIQSLLKDTETAQRNYLITADADDLKTYLAAYQQTNRNIQILRKLTADNH
FT                   QKQQWISLLEPKITSRLNILQKEIYLRQNQGFEAVRQRILSDKDNQSGKEIQQLIHDSL
FT                   EIEQNLLQQGMQQSQASSQKAIVTFFIAAIVDLVLVALLYDLLWRYIRQLQQTELALRQ
FT                   SENRLRAMIDAEPECIKLIARDGTLLEINAEGLAMMEVESPDVLIGKPIDAVIVPEYRA
FT                   AFADLHKSICQGNKGTLEFEIVGFKGTRRYMETYAVPLRNESDGTFIHLALMRDITQQK
FT                   QAEQKIREQGLLLDVSTEGILVRNIYNQILFWNQGAERLYGWKSEEVVGKNVLQLLYKG
FT                   ISPQLEDAYLKVMNTGEWRGELHQLTKEGKVIIVESRWILIRDDRGQTKSILSVNTEIT
FT                   QQKQLEAQLLRSQRLESIGTLAGGIVHDLNNILSPILMSVQLLQKKLPDSQSQQILQTL
FT                   ENNVKRGANLLKQVLSFARGIEGKRTIVQIQPLMAEIEQIIAQTFPKSIICQADIPKNL
FT                   WYVRGDITQIHQVLINLVVNARDAMPNGGILRIAAENLVIGEHSAQINIDAKVGSYVAI
FT                   VVTDTGMGMSSEVQKRIFEPFFTTKEVGKGTGLGLSTALGIIKNHGGFVNVYSHVGRGT
FT                   QFTVYLPASTFRDTSLLSPELESVTGDG"
FT   gene            727418..728587
FT                   /locus_tag="Npun_F0611"
FT   CDS_pept        727418..728587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0611"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.1.1.100"
FT                   /note="KEGG: mxa:MXAN_1171 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79365"
FT                   /db_xref="GOA:B2J8B6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B6"
FT                   /protein_id="ACC79365.1"
FT                   /translation="MTKLPRCIVCKTTFLQGHGFYTGLCVECGNLNFSKRQQSADLRGM
FT                   IAVVTGARVKIGHGVALRLLRDGATVIVTSRFPHDAAKRYAAEPDFREWQHRLQIYGLD
FT                   LRHLHSVEQFTQHICKFYQRLDIIINNAAQTVRRPPAFYHHLIEFESLPFGELPPEIQV
FT                   LVGHNHAVNTENSALLASTEEKEATFTKNSAFLSQIPLIPEDIGDNSAYFPLEGYTDDE
FT                   QQLDLRPFNSWLMKDDEVSILELLEVHIINAIAPFVINSRLKRLMSNYKETNKYIINVS
FT                   SMEGRFNDVDKPWRHPHTNMAKAALNQMTRTCAKEYAKHRIFMNAVDPGWISFQHPYHQ
FT                   AKSMQERGVYPPFDVNDAAARICDPIYLGINQGKTPFARLFKDYTEIDW"
FT   gene            728593..728666
FT                   /locus_tag="Npun_r006"
FT                   /note="tRNA-OTHER2"
FT   tRNA            728593..728666
FT                   /locus_tag="Npun_r006"
FT                   /product="tRNA-OTHER"
FT   gene            728896..730239
FT                   /locus_tag="Npun_F0612"
FT   CDS_pept        728896..730239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0612"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   ava:Ava_2053 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79366"
FT                   /db_xref="GOA:B2J8B7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J8B7"
FT                   /protein_id="ACC79366.1"
FT                   /translation="MANVIVIGAQWGDEGKGKITDLLSRSADVVVRYQGGVNAGHTIVV
FT                   KGQTFKLHLIPSGILYPNTDCIIGCGTVIDPQILIAEIDQLKELNISTDHLLISETAHV
FT                   TMPYHRLIDQASEERRGSYKIGTTGRGIGPTYADKSERTGIRVLDLMDPDGLREQLEWT
FT                   INYKNVILEKLYNLPPLDPQEVIEQYLGYAERLRPHVVDTSLKISDAIQRRRNILFEGA
FT                   QGTLLDLDHGTYPYVTSSNPVAGGACVGTGVGPTMIDRVIGVSKAYTTRVGEGPFPTEL
FT                   DGELGELLCDRGAEFGTTTGRKRRCGWFDAVIGRYAVRINGMDCMALTKLDVLDELEEI
FT                   QVCVAYDIDGQRSEHFPTSSRQFARCRPIYKTLPGWKVSTTECRTLEDLPQQALDYLKF
FT                   LAELMEVPIAIVSLGASRDQTIIVEDPIHGPKRALLHPDGTPATLLSA"
FT   gene            730325..730924
FT                   /locus_tag="Npun_F0613"
FT   CDS_pept        730325..730924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0613"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: gvi:gll0399
FT                   50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79367"
FT                   /db_xref="GOA:B2J8B8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J8B8"
FT                   /protein_id="ACC79367.1"
FT                   /translation="MTITVESLKRPEGSKPRALRRSGLIPANLYGHKGTESISLTIEAK
FT                   TVERLLKRVSVNNTLIELNIADAPWRGKALLRELQIHPAKGTPYHLSFFAVAGHGDTTV
FT                   EVRLRFVGTAVGVKQEGGVLDTVITELQVSCAPENIPDVIEIDVTNLQIGDSLSISDIP
FT                   FPEGVTPLAELERLVVSVLPPQISADDAGTETETAS"
FT   gene            731008..732537
FT                   /locus_tag="Npun_F0614"
FT   CDS_pept        731008..732537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79368"
FT                   /db_xref="GOA:B2J8B9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8B9"
FT                   /protein_id="ACC79368.1"
FT                   /translation="MTEATLPVLIEQMLQPGFYPHAVTEPIELIQTHVSYVLLTGDYAY
FT                   KLKKPVNFGFLDFSTLEKRQHFCHEELRLNQRGAGELYLEVLPITLVGEQYQLGGTVEA
FT                   VEYVLKMRQFPQESLLSTLFEQGKLNEARLDELGRVVAQYHAEAQTNDYIRSFGEVPKV
FT                   RAAFDENYQQTENYIGGPQTQEQFTETKQYTDKFFAERPELFASRIHNNYIRECHGDLH
FT                   LRNIALWNDKILLFDCIEFNEPFRFVDVMYDVAFTVMDLEARQRKDLGNAFLNAYIEQT
FT                   GDWEGLQVLPLYLSRQAYVRAKVTSFLLDDPGVPAAVKEEATKTASEYYKQAWEYTKPK
FT                   VGELILMSGLSGSGKSTTARHLARQQGAIHLRSDAVRKHLGGIPLWEKGGDDLYTPEMT
FT                   EKTYTRLLELGIILAKQGFSVILDAKYDKQHLRQEAIAQATKHEIPLQIIQCTAPLEVL
FT                   KERLNNRTGDIADATADLLASQIKQAEPFTEEEQAYVKILDTTQSQKAQLK"
FT   gene            732754..733260
FT                   /locus_tag="Npun_F0615"
FT   CDS_pept        732754..733260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0615"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_2057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79369"
FT                   /db_xref="GOA:B2J8C0"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C0"
FT                   /protein_id="ACC79369.1"
FT                   /translation="MADKKNDFLSISPSFFSQLLFGAFLTFILIMTGSAPALSIFLGIM
FT                   GGFILSWITNVTDNSPQAPNVASSDGVDTGLKYWLFFMLGFVYLGYPAPTSILLGGIGA
FT                   LAGGWITAWWGSKEETRTQLQVEELEEGEVEPTNDRINKRQTRRNTRRYRRAPGSSINF
FT                   KFWER"
FT   gene            733593..734384
FT                   /locus_tag="Npun_F0616"
FT   CDS_pept        733593..734384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0616"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   ana:alr2467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79370"
FT                   /db_xref="GOA:B2J8C1"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C1"
FT                   /protein_id="ACC79370.1"
FT                   /translation="MFLYLSKLLPLFFYPLGLACVSLVVALVTLWKRPRTAAIAIAFAL
FT                   TLLLFCSNAWIAKSLVRSLEWQNLPLAQIPVAEAIVVLGGATKSAFPPRPTVDLSESGD
FT                   RVIYAAQLYRQKRAPIIILSGGRIDWRGGGSPESADMATILTSIGIPSEAIVQEPESLN
FT                   TYQNAVNVRKILESRGINQVLLVTSAMHMPRSLNIFQRQGINVIPAPTDFLVSQGELQE
FT                   LGGTPKAAILNLLPDTDNLHQFTSALKEYIGSLIYRLRGWL"
FT   gene            734519..734740
FT                   /locus_tag="Npun_F0617"
FT   CDS_pept        734519..734740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asr2468 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79371"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C2"
FT                   /protein_id="ACC79371.1"
FT                   /translation="MSKNLPYIMPSPQPQVEEAFAAYQTTHQFYHEVRSRSEFQRYCEW
FT                   YYATAEQNRQELKRMRGELNIFQWFRRR"
FT   gene            complement(734746..734967)
FT                   /locus_tag="Npun_R0618"
FT   CDS_pept        complement(734746..734967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0618"
FT                   /product="ferredoxin thioredoxin reductase, alpha chain"
FT                   /note="PFAM: ferredoxin thioredoxin reductase, alpha chain;
FT                   KEGG: ava:Ava_0401 ferredoxin thioredoxin reductase, alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79372"
FT                   /db_xref="GOA:B2J8C3"
FT                   /db_xref="InterPro:IPR004207"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C3"
FT                   /protein_id="ACC79372.1"
FT                   /translation="MKVGDRVRVKDSVVVYHHPEHRNQAFDIKGIEGDVVNIATQWQGR
FT                   PVSANLPVVVQFSKKFKAHLRENELEVI"
FT   gene            complement(735499..736287)
FT                   /locus_tag="Npun_R0619"
FT   CDS_pept        complement(735499..736287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0619"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.1.1.100"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: ava:Ava_0311 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79373"
FT                   /db_xref="GOA:B2J8C4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C4"
FT                   /protein_id="ACC79373.1"
FT                   /translation="MDLQLRGKVALITAASKGLGKATARQFAREGAKVAICARSESIDT
FT                   TAAEIASETGTEVLSLRADVTSQADIERVINTTVERFGGLDILVTNAGGPPAGTFDDID
FT                   LATWETSINLTLLSAVRLVKFALPHLRQSTTPAILTITSTSTKQPVENLVLSNSIRLAV
FT                   IGLTKTLSQELGSDKIRVNSILPGWTYTERVEELINARIAKSGETKEAEIARVSATVPL
FT                   GRIGTPEEFANVAVFLSSPAASFVNGVMLEVDGGAIQGTF"
FT   gene            complement(736306..737196)
FT                   /locus_tag="Npun_R0620"
FT   CDS_pept        complement(736306..737196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0620"
FT                   /product="nitroreductase"
FT                   /EC_number="1.6.99.3"
FT                   /note="PFAM: nitroreductase; KEGG: ava:Ava_4035
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79374"
FT                   /db_xref="GOA:B2J8C5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C5"
FT                   /protein_id="ACC79374.1"
FT                   /translation="MCGCMPLQMELVLVIKYRKIWELIMTNPIELLRSRYGEIPFNPEE
FT                   WNDSLTALLSHRSIRSYLSDPLPEGTLELLIAAAQSASTSSNLQTWSVVAVEDPECKEE
FT                   LSKLAGNQAHIKQVPLFLVWLADLARLSYVADSRGISHDALEYLEMFVMATIDATLAAQ
FT                   NAAVAAESLGLGTVYIGGIRNHPQEVAEILNLPSSVYAVFGLCVGYPNPEVEAAIKPRL
FT                   PQSAVLHRETYKLSEQEEAIAHYNDIIKEFYTEQKMNVPGDWSEHSAQRIATVESLRGR
FT                   DRLREVLNHLGFKLL"
FT   gene            complement(737231..738349)
FT                   /locus_tag="Npun_R0621"
FT   CDS_pept        complement(737231..738349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0621"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="KEGG: ava:Ava_4154 ABC transporter,
FT                   substrate-binding protein, aliphatic sulphonates; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; SMART:
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79375"
FT                   /db_xref="GOA:B2J8C6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C6"
FT                   /protein_id="ACC79375.1"
FT                   /translation="MINLIFRRFIAKWISLVKIRNIPFNNQHKLFFSSPLPITGAFVTG
FT                   LCLSVLFAACSSPSTVSSSNPSATSVSNSASSKATVLRFGYQKSNILLRNKGVLEKRLS
FT                   PNGISVEWIEFPAGPQLLEAMNVGSIDFGHVGESPPIFAQAAGASLTYVAGIASSPAGS
FT                   AILVPQNSSIKKLTDLKGKKVAFQKGFSAHLLLVQALEKAGLKYTDIEPKYLPPADARA
FT                   AFVKGSIDAWVIWDPFYAAAQEATKARVLIDGTGINKQGGYYLGTRKFVTENPRTVKAV
FT                   LEEIQSLEEWFKQHREEVAQTLSSVLAIDRVTMGKATSRRTFGIVSIDDNLIALQQKVA
FT                   DTYYQLKLIPKQVNVKDAVLTQEQYAAFSPKI"
FT   gene            complement(738683..739444)
FT                   /locus_tag="Npun_R0622"
FT   CDS_pept        complement(738683..739444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0622"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ava:Ava_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79376"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C7"
FT                   /protein_id="ACC79376.1"
FT                   /translation="MSRYNRPQVPVFERVEDERLHRKQRLAAAFRLFGKFGFSEGIAGH
FT                   ITARDPEFTDHFWVNPLGTYFGHIRVSDLILVNKEGEVVKGDAEVNRAAFAIHSQIHEA
FT                   RPDVIAAAHAHSIYGKAWSSLGRLLDPLTQDSCAFYEDHALFDDFTGVVLETSEGQRLA
FT                   QTLGPKKAIILRNHSILTVGQTVDEAAFWYISLERSCQAQLLAEAAGRPTIIKHETARL
FT                   TQTQVGSRISGWFSFQPLYDRIVREEPDLLN"
FT   gene            complement(739431..740102)
FT                   /locus_tag="Npun_R0623"
FT   CDS_pept        complement(739431..740102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB4575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79377"
FT                   /db_xref="GOA:B2J8C8"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C8"
FT                   /protein_id="ACC79377.1"
FT                   /translation="MTNDTILEPLPEDQWFIESQELRSFVATVREISAITAGDRTQTLA
FT                   RLEPYFQELLAQQQWLPEKFAQINPESKMGGGIGQWLLYRAKDRSLSVFSLVIPPGSTT
FT                   PVHDHLAWGLIGLYKGNQEETVYRRVDNGDTEGHAQLQVTEVRSLQPGDIYRLLPPDGD
FT                   IHAVKTTSQSASVSIHILGNDAGCILRHQFIPESHSVKSFRSGYSNAPCKEEEEKKHVQ
FT                   V"
FT   gene            complement(740200..740409)
FT                   /locus_tag="Npun_R0624"
FT   CDS_pept        complement(740200..740409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0624"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: ava:Ava_C0122 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79378"
FT                   /db_xref="GOA:B2J8C9"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8C9"
FT                   /protein_id="ACC79378.1"
FT                   /translation="MTKVFILDANQEPLYPVRISHARLLLSQGKATVFQRYPFTIILKE
FT                   SLSNLKLEQLGFKIHPSIKIIRNS"
FT   gene            complement(740573..741694)
FT                   /locus_tag="Npun_R0625"
FT   CDS_pept        complement(740573..741694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0625"
FT                   /product="luciferase family protein"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   bur:Bcep18194_B1755 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79379"
FT                   /db_xref="GOA:B2J8D0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D0"
FT                   /protein_id="ACC79379.1"
FT                   /translation="MPIEFIGMIGTRQISELDGPRVAITGGSIDAAYVRKFAQAHENGG
FT                   FDRVLVGYGSTGPDSLTVASFAAAATERLKFLIAHRPGFVAPTLFARKTATLDHFTNGR
FT                   IAVHIITGGSDAEQQRDGDWLDHDTRYRRTDEYLDIVRRVWISETPFDYEGEFYRVKDA
FT                   YSDVKSLQQPHIPVYFGGASGAAVPVGAKHSDVYAMWGEPIVAIKERIREVKAVTPPER
FT                   SPRFSVSLRPILGDTEEKAWQRAHSILSHVKEIRAAKTDNQPPIAPSLNSARPEAVGSS
FT                   RLLQFAQESEIFDKRLWTPIAAATGAYGNTTALVGTPEQVAESLVDYYDAGVTTLLIRG
FT                   FDPLEDAIAYGRDVIPLVRAEVQRRERQAAVIA"
FT   gene            742386..743453
FT                   /locus_tag="Npun_F0626"
FT   CDS_pept        742386..743453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0626"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN1280 endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79380"
FT                   /db_xref="GOA:B2J8D1"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D1"
FT                   /protein_id="ACC79380.1"
FT                   /translation="MVNLEAEDRKQLITLLKELPELATERSRQQILELAGLKQVIPMIN
FT                   LSGASFVAVSEIVSYLSNYGRLTYDHEALGLFLNTLKSLTGAQQQEFLDMLLTKYDMMT
FT                   PIAILPAINEWRGGKTTSDVLEKIIGENTLRPISFLQQGLQVARSVAYIGVITSQERWS
FT                   GTGFLVAEDLLLTNNHVLPSSNLLADTIFRFNYEENFQGEAQPTDEYRPKPNGAFHTNQ
FT                   ALDYTLVQLGGEPGKKWGWLPLASKAINIGSRVNIIQHPSGQPKQISLQNNFVQYVGGN
FT                   VVQYITSTLQGSSGSPVFNDGWQIVALHHAGGNIPEPTTQQHYFRNEGIKMESILADLP
FT                   LELVDLLKAATITSF"
FT   gene            743487..744749
FT                   /locus_tag="Npun_F0627"
FT   CDS_pept        743487..744749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0627"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   ter:Tery_2415 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79381"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D2"
FT                   /protein_id="ACC79381.1"
FT                   /translation="MNIKSQLLELLVKMPNTQTVGERRALLTFTGFDYLNIRINEIQSN
FT                   NLSFFNELIELILSEGQDKLLNFIRALADSEFIGLEFRQKFNAIIIKISSLEPQKFNSE
FT                   FIEQKNTQSVNIISISSRSEESLEEQQDTKLPVPAILGTQSFEFTVVIVDPQGKEIKRS
FT                   RRQNYYLTQDLGNGVSLEMVYIPGGEFWMGSLESEGKRYSNERPQHKVTVKPFLISKYA
FT                   ITQAQWREVATLREVRQNLKLRPSRNGGKSHPVTQVSWFDAVEFCDRLSEKTGKQYRLA
FT                   SEAEWEYACRAGTTTPFHFGETITSDLANYDGRYSYGSERKGIYREITTPIGSLQVANF
FT                   FGLFDMHGNVWEWCLDHWHENYNNAPNNRDSLRDSSDNQIHVMRGGSWRNDPYLCRSSS
FT                   RLQKIASEMSNHIGFRIVCSL"
FT   gene            complement(744789..746123)
FT                   /locus_tag="Npun_R0628"
FT   CDS_pept        complement(744789..746123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpr:CPR_0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79382"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR025280"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D3"
FT                   /protein_id="ACC79382.1"
FT                   /translation="MSLTLLGLLVLVAGLIAALVQALIAESQVREKLRRYDTLADKEGY
FT                   QRQLASNIDLLENQQLSLNTKIINLQQQFSELDAKIYLQSIDYYEPKYEFISSEDYIHR
FT                   LKNIKLQQENMVKNNQAYICDTKWTVGDSTRKGDKMINDILKLVELAFEERCKYAVKEV
FT                   RYNNIDSLKKRINNTFSKYNKCLKTLNSKISEEYLQLKLIELDLQYELEDKKQQERERE
FT                   LEDKKQNKERESIDKATQKAEEAEEREILHQQELNKVRQEIELTEGEKRQQLYLKIQEL
FT                   ERQVAEDRSDQETALSESRRLKSGYIYIVSNIGSLEQDVYRICRTIRNKEDEYIRGMNP
FT                   AVPFQFDVHFKIFSEDAFDTLQRLHQRFDDKKVNTVNPKRDFFKVSMDEIEQAVKEIQK
FT                   ATGVLRIDIFEPVPQAYEYRQTLAARKKHQHLTIDNSSLEENKIA"
FT   gene            complement(746220..747947)
FT                   /locus_tag="Npun_R0629"
FT   CDS_pept        complement(746220..747947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0629"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: pseudouridine synthase; KEGG: ava:Ava_3138
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79383"
FT                   /db_xref="GOA:B2J8D4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D4"
FT                   /protein_id="ACC79383.1"
FT                   /translation="MVVLHALSDFIDCDFAARDLSPSYWYEGRCLQSGERLRLPRTSMS
FT                   EAIAHGLIQQLTKNDCYSREGKMYGILLVELPNGEQRVLKAFSGLLNGCSLVAGWVPPI
FT                   PGRDEVALEEARTLAELDAIKQEILTLKQLTERQQYETLSNEFERQLQAMSDRHRHCKH
FT                   QRQEKRQQICNTLSPEALAIALEQLDEESRQQGIERRQLKRQQNEVLQPLQQLIAAKDA
FT                   RISELKQQRKALSRQLQVQMQASYSLTNFSGRSLSLQQLMPEGSPTGTGDCCAPKLLHY
FT                   AATHNLKPLAMAEFWWGASSVNQDKIPGEFYRACIERCQPLMGFLLSGLRPNPPVPFPA
FT                   FAQRLVGVRLSVSEREASLREEREEVTLPIIYEDEWLIAVNKPPGLLSVPGRYRDRQDS
FT                   VLSRLRHLLPDGMALASVHRLDQETSGILLLARDRQTHKQLSQQFQQRQVHKVYEAILS
FT                   GVAIAEKGVIDLPLWGDPENRPYQKVDWQNGKPSLTQFQVISREQDYTRIEFTPLTGRT
FT                   HQLRVHAADVRGLGITILGDRLYGCDAVTSRLYLHARELDFEHPQLKKTLYLKAITLF"
FT   gene            complement(748297..749625)
FT                   /locus_tag="Npun_R0630"
FT   CDS_pept        complement(748297..749625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0630"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aba:Acid345_3092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79384"
FT                   /db_xref="GOA:B2J8D5"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D5"
FT                   /protein_id="ACC79384.1"
FT                   /translation="MYKNVKRFTAIFLLVFLLIVSINFAAIAQNSSDGPSVNFASPQIC
FT                   SVPPGLKTQQVIADNGRNLVKMGDRIRVRVEGLSAATKNTTANASNSFDPRQLVLYLDG
FT                   YELEDVHGEPVIVMVPGKDQQKIVDDNWLAFRLERTDSSQAAWNTLLGQANRYSINVIA
FT                   GVGCPKKLAIPVSNPVSPPQLKIVLLSWRFWLCLILVLSVVLIFIRYCRSTLRSPGIEG
FT                   VYSKKEVIGGQELLIPEKAELEKEDRKTRIAQFFLGRKKLNKNPFSLSISQLAFWTFLI
FT                   FGSYLIIYGITGDYTNILTQQSLILLGINSITAFGTSLIDGQGNEKKRKGSQRISEGFF
FT                   YDILSDINGVNFHRFQTFIWTVAIGLFFVWEVIKNLAMPEFDETLLTLQGISAATYLGL
FT                   RGQEQHGMTEEPESPTIEEHSSDQPLPPAQDNPPEGDSSIPNS"
FT   gene            749832..750860
FT                   /locus_tag="Npun_F0631"
FT   CDS_pept        749832..750860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0631"
FT                   /product="ATPase/kinase involved in NAD metabolism"
FT                   /note="KEGG: hch:HCH_06994 predicted ATPase/kinase involved
FT                   in NAD metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79385"
FT                   /db_xref="GOA:B2J8D6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D6"
FT                   /protein_id="ACC79385.1"
FT                   /translation="MAGTCGLTLGKYAPLHKGHQLVIETALAEMDEVLVMIYECPEVTA
FT                   IPLTVRANWLRKIYPQILVIEAWDGPTEVGDTSEIKKMHEDYILKQLESKKITHFYCSE
FT                   FYGEHVSQALGAVNRLVDCDRKTFPISGTQVRTDTYAMREYLHPDVYRDLIANIVFLGA
FT                   PSTGKTTIASQLAKEYNTVWMPEYGREYWEKNQINRRLSLLQLVEIAKGHLEREEALLL
FT                   QANQYLFTDTNALTTYQFSLYYHKTVAPELVQLAHQAMSRYDLVFLCDLDIPYDDTWDR
FT                   SGEANRSIFQKQIESDLIVRKIPFFRLSGDLMTRISIVKKVLYYYQKYASLGELFFNKL
FT                   IL"
FT   gene            750926..751513
FT                   /locus_tag="Npun_F0632"
FT   CDS_pept        750926..751513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0632"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: ppr:PBPRA1430 putative nicotinamide mononucleotide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79386"
FT                   /db_xref="GOA:B2J8D7"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D7"
FT                   /protein_id="ACC79386.1"
FT                   /translation="MSYIELLGTVFYLWSIWLISQRKILTWPVGIVSVLLYMALFYQIR
FT                   LYSDFLEQIYYLVVSVYGWWRWSTPDSSKVLQIRYSPPRKIVLIAAITVAISFATGALM
FT                   SQIHLLLPAIFLEKASFPYLDALTTIMSFTAMWLMVQKRIESWYYWIIVDIIGIWLYYV
FT                   KEVKFIAFLYVILLLIAINGSISWLKTAKIVH"
FT   gene            complement(751727..752566)
FT                   /locus_tag="Npun_R0633"
FT   CDS_pept        complement(751727..752566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0633"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD;
FT                   KEGG: rxy:Rxyl_0145 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79387"
FT                   /db_xref="GOA:B2J8D8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D8"
FT                   /protein_id="ACC79387.1"
FT                   /translation="MTMPTKSKTKATVWVVEKGQVRPRLDHLTTEEPLEIRLVPFQKTV
FT                   AVTMRTPGADFELAAGFLYSEGVVSRREDIRRISYCVDELVDGEQRHNIVNVELRDGLI
FT                   PDLQPLERHFYTSSACGVCGKASLEALRLRGCPVIPSGPTVTPEIVYSLPDKLRAAQGI
FT                   FRATGGLHAAAIFDTQGNLLNLWEDVGRHNALDKLIGTAFLSDELPLNNCIVLVSGRSS
FT                   FEILQKSTTAGVPIVCSVSAPSSLAVSVAKEFGITLIGFLRGERFNIYTGLQRINAV"
FT   gene            752712..753893
FT                   /locus_tag="Npun_F0634"
FT   CDS_pept        752712..753893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0634"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: lpp:lpp1119
FT                   D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79388"
FT                   /db_xref="GOA:B2J8D9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8D9"
FT                   /protein_id="ACC79388.1"
FT                   /translation="MNLIFLAFRKILFAIVFVISLGFAGYLVSNNISQRVIEKSFAKQV
FT                   ISTSTVGKSSQLQTLLNEIVAEEKIPGAVMYVSTPNGYWVGASGVNNLSTKTRIKPTDG
FT                   FSIASMSKTFMSVVVLKLVEQRKIELDRAIATYLPRDITPHIVNSDKITVRQLLNHTSG
FT                   VAEYLDTKEFIQATAKRSRSQPWTAREAIQYMYQEQPQANPGEKFIYTDCNYILLELIV
FT                   ENLTRETLAQAIRSQILKPLGLKHTFTELREPTIGEVATGYGDRNKDGKLDSYAEVNDG
FT                   NGLGDGGLVSTAEDLAKFAKALFIKKSLLSSKMMKEMLKFKDNGKSYSYGLGIERFSSP
FT                   LETAIGHSGIAYGFTTLLAYLPNQNTTIVVLLNDQGVDIKSIARTGLEVVSNK"
FT   gene            complement(754045..754377)
FT                   /locus_tag="Npun_R0635"
FT   CDS_pept        complement(754045..754377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79389"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8E0"
FT                   /protein_id="ACC79389.1"
FT                   /translation="MVQTVQTQELTLEQVNQAVDAIITVLGNPDSDLHAQALDAFRRSD
FT                   HQTVKRLASTNLADSYCRALGYLGSALKLTPNTDTILAESARAAADFVREKTLHQLGTA
FT                   IAKALN"
FT   gene            complement(754474..755646)
FT                   /locus_tag="Npun_R0636"
FT   CDS_pept        complement(754474..755646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0636"
FT                   /product="glycosyl transferase, group 1"
FT                   /EC_number="2.4.1.345"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ava:Ava_1362 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79390"
FT                   /db_xref="GOA:B2J8E1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8E1"
FT                   /protein_id="ACC79390.1"
FT                   /translation="MKILQIVPSISLIYGGPSQMVLGLAPALVKEGVEVTILTTDSNGD
FT                   NGQTPLDVPLNRPIKQDGYEIIYFRCAPFRRYKFSLDLLKWLKRHAHEFDLAHIHALFS
FT                   PIISAAAIVCRQQKLPYIFRPLGTLDPADLRKKKQLKQLYVAIIERQNLASAAAIHFTS
FT                   EQEAKISERFGVSTPDLVIPLGVIPRQSSLKNVCSQLEIPKDVPLVLFMSRIDPKKGLN
FT                   LLIPALEKLLAVGYKFHFVLAGTNPQDPDYEQKIISQIQNSPLRSHTTITGFVTGELKV
FT                   SLLQAADLFVLPSYYENFGIAVAEAMVAGVPVVISDQVHICQQIRDSESGWVGATDVQA
FT                   LVELLQAALQNPAERQRRGLNAQKYALENFSWDAIARQTIQAYQKILANK"
FT   gene            complement(755650..756825)
FT                   /locus_tag="Npun_R0637"
FT   CDS_pept        complement(755650..756825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0637"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   ava:Ava_1365 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79391"
FT                   /db_xref="GOA:B2J8E2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8E2"
FT                   /protein_id="ACC79391.1"
FT                   /translation="MKILVASHTYIVDLNCEKLRALSQLESGVEVTVLVPKRWKPGGVQ
FT                   NRIIETEYRDEGTFRIVPVSNFSQNHQGLLTFGADLISLLKEFRPQIIQVEQGSRGLAY
FT                   TQMIALNQLLRLKAKNVFFTWWNLPYQLKLPVALLEKYNLNHSHGIISGNQDGAEVLRQ
FT                   RGYKGAIKVMPQLGVDESLFTPKAQPELAAKFGIHKEDFVVGFVGRFVQEKGLLTLLQS
FT                   LIILKNKPWKLLLLGRGELQTELLKIAAENNIKERLILIESVPHNEVASYINLMSTLVL
FT                   PSETTYKFKTLTSVGWKEQFGHVLIEAMACQVPVIGSDSGEIPYVIGDAGLVFPEGDVQ
FT                   ALANCLVQLMDKPDFAHTLGEMGYQKAMVKYTNKALAKQQFEFYQELVMSK"
FT   gene            complement(756869..757849)
FT                   /locus_tag="Npun_R0638"
FT   CDS_pept        complement(756869..757849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0638"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   ava:Ava_1366 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79392"
FT                   /db_xref="GOA:B2J8E3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J8E3"
FT                   /protein_id="ACC79392.1"
FT                   /translation="MDNYPLISVVIPTYGREEALRDSIVDVLKQDYPNFEVLVIDQTPT
FT                   HQPEIQAYLEEMADVGKIKWLRLDWASLPGARNYAVRRSSGEIILFIDDDVQLTPELLA
FT                   AHAKNYLENPEVGAVAGRVFDRMKLGDSGGDLQIEYLPPEAMDPGIAWYHIDLVHTTKP
FT                   QQVLTARGCNMSFRREIFTKYGLRFDERFRGSAVREESDFCLRVRQTGYKIWYDPEAHL
FT                   VHLGEETGGCHDISMRSLKYQLTFYHNHFLLGLKNLTATQALRLYGRLFDCHVLGRPPC
FT                   HKSGSPIKIATRAIFYILGFFKALGTVIQSLWNDGQIYSRLDEQV"
FT   gene            complement(757986..759143)
FT                   /locus_tag="Npun_R0639"
FT   CDS_pept        complement(757986..759143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0639"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   hne:HNE_1287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79393"
FT                   /db_xref="GOA:B2J994"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2J994"
FT                   /protein_id="ACC79393.1"
FT                   /translation="MAKVIIGGQKHLSIPNLPRNSRHTLIYPKPFPAGRYPIEKIWYPL
FT                   ASFMAWQPVWQRYQAIHSFNRILYTNKPWFLTFEDHRVLYRNPQNKVEAAIYELLNHRL
FT                   ALDNCKKIIAISDYAKLRLIKRIEGWKIEEKVSKKVDVIHPNFPIKVKQSKIYQEQQNL
FT                   QLVFIGNHIARKGGVVALRLAQKAEKLGLPITVHIISGLEHGSGVPTDFPDRSKYVEDL
FT                   KLLKLSNVVFHRNIPNDKVIELLSQSHFQLMATLHDTYGYSIIEGFSVATPVITTNVCA
FT                   LPEFVRNGENGYILELPINEIRHWSNWLHGEKTKTDEYWEIVDSTYDYLAEQALQQIMQ
FT                   FLDRSDKREHYEFLSAGALDQAQLVHNSEKQNELFDNLYAAAAGV"
FT   gene            complement(759155..760834)
FT                   /locus_tag="Npun_R0640"
FT   CDS_pept        complement(759155..760834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all4442 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79394"
FT                   /db_xref="GOA:B2J995"
FT                   /db_xref="UniProtKB/TrEMBL:B2J995"
FT                   /protein_id="ACC79394.1"
FT                   /translation="MLIGYSATMPKIKSKSKTSKKSKKQTSKETSTLSLKEQLAQKRKA
FT                   ALARKELISLLTTATFGGLFVGVVLFFVGGIKAAVPGVLGIIIISLSYKYPRQALYAFI
FT                   IYVPVGGTITYYLGSSPILQLAKDAFYVPALIGLWQTCRKQGLPLIIPQGIKIPLYIVL
FT                   GCSVLTLLFVNGGQQFNPPSVGLLEKAEKEIPLGMGILGLKVFLGYVPLIGCAYYLIRD
FT                   KRDFLFLSRLQIVLILICCVLGCIQYLLLLTGVCQGTRGLEGNALFVTSLEARCYFGGA
FT                   LLYSPEEGVIRLPGTFVAPWQWAWFLISSTFFTFATGFTDPSIIWRLVGLGSLVTVFIN
FT                   AVISGQRIALALVPICFGILLLLTGQIGNLKRFIPIGIGLAIVLGIVMVTNPTVVQERT
FT                   ESFTGRWEASPPQDFIVQQFEENWKNVDGPLGSGLGRATNSARAMGKTKLVETYYPKVL
FT                   FEVGIIGVLAFLGLVTSLTIMGFKTYRSIKNRNFRSYGAALWVFILFISYNTYYYPLDV
FT                   DPVAVYYWFFAGVLFKLPELEKQDKEDANPEQKNKRKRLKTI"
FT   gene            complement(760847..761614)
FT                   /locus_tag="Npun_R0641"
FT   CDS_pept        complement(760847..761614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0641"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79395"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2J996"
FT                   /protein_id="ACC79395.1"
FT                   /translation="MLVFVIPLKSAKVSNSWERVTQLFERCIKSVCNQTSPNFHVIVVC
FT                   HEKPKIEFTHSHITYLTVDFSPPNETNPVAKGDTDKGRKILKGLIYAQQFSPTHTMAID
FT                   ADDCVSKKLAQFIQQHPDSDGWVINKGYKYQEGSKYVYIKRRNFYKMCGSCNIIRYDLN
FT                   YLPESAEYNRGYGYYRYYIDHGKVRDILENKGKAIKSLPFPGAVYILDTGENLFDNSKR
FT                   LKFNIFNRKLLNQSVKDEFGLYNLQQSQNICQV"
FT   gene            complement(762075..763547)
FT                   /locus_tag="Npun_R0642"
FT   CDS_pept        complement(762075..763547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0642"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: ana:alr1900 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79396"
FT                   /db_xref="GOA:B2J997"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2J997"
FT                   /protein_id="ACC79396.1"
FT                   /translation="MVSSITRIPGIPGDSPSEAEGLGKGIESSFGLNLIPLPANPLFGT
FT                   DGIRGRVGELLSAPLALQVGFWTGIVLRNHATQIGPVILGQDSRNSSDMLAMALSAGLT
FT                   AAGLEVWYLGLCPTPCIAYLTSISDAIGGVMISASHNPPEDNGIKVFGANGGKLPQILQ
FT                   AEIEAGLRGKISPIAKVSNCGRHYSRFELVGHYGDALKKPLNSTLNLQGMKIVLDLAWG
FT                   AAVGLAPSVFTEMGAEVICLHNEADGDRINVNCGSTHLDILAATVQEHNADIGFAFDGD
FT                   ADRVLAVDNTGRQVNGDYILYLWGRHLQKNQQLPDNLIVSTVMANLGFEKAWQQIGGKL
FT                   IRTAVGDQYVQAEMQRTGGMLGGEQSGHILCRHYAVTGDGLLTALHMAALVKEAGVSLA
FT                   ELVDQSFQTYPQILRNVRVTDRDRRLGWQDCEPVQQAIALAEAAMGDSGRILVRASGTE
FT                   PVIRVMVEAANAELTNYWTNELVSKVQQHLMD"
FT   gene            764117..764833
FT                   /locus_tag="Npun_F0643"
FT   CDS_pept        764117..764833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0643"
FT                   /product="Haem oxygenase"
FT                   /EC_number="1.14.14.18"
FT                   /note="PFAM: Haem oxygenase; KEGG: ava:Ava_3767 heme
FT                   oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79397"
FT                   /db_xref="GOA:Q9ZHV6"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR018207"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZHV6"
FT                   /protein_id="ACC79397.1"
FT                   /translation="MSSNLATKLRVGTKKAHTMAENVGFVKCFLKGVVEKNSYRKLVAN
FT                   FYFVYSAMEEEMEKHRQHPILSKINFPQLNRKYTLEQDLSYYFGANWKEQIKLSSAGEA
FT                   YVKRIREISATEPELLIAHSYTRYLGDLSGGQILKNIAVTAMNLSDGQGTAFYEFPEIP
FT                   DEKGFKAKYRQILDELPLDDAATDRIVEEANAAFGTNMKMFQELEGNLIKAIGVMVFNS
FT                   LTRRRTRGSTELVTAE"
FT   gene            complement(765104..767191)
FT                   /locus_tag="Npun_R0644"
FT   CDS_pept        complement(765104..767191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0644"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: bja:bll3192
FT                   ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79398"
FT                   /db_xref="GOA:B2J999"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2J999"
FT                   /protein_id="ACC79398.1"
FT                   /translation="MNKIKLEDITLNHIKILKAVDDCGSFSKAAQKLGYSQSLISKKVK
FT                   QIEDYFGVILLNRSPGSICLTNKGKKLISQTFNVVETVENLQEEFQATFSAEGEDLILG
FT                   ATSLILEVWLKQYLQRFQLCFPDRNLKKIAVKDSRFFSNSHLREMELLLNTCSGYKEEH
FT                   HCTRLKTHKMLLFVFGANKYLNEHSLVNINDINLADLVLLDEVYQELSKNVFLRNQLSG
FT                   VHVLNSYKDVLNYASKNQKITILPDFCQAEIIAQYQVFTLTIQDVNEYGIYLHVPRFSE
FT                   LLISAEGLVRSFRLDRDNLESLTNINLILNRYSPKKEKILRIGIQRDSIGQFIAGYGTK
FT                   YISDLQRASSSFEQAIFKNIEITRNFELQILPFDSGEQMNRHIKRGELDICILDDIYLL
FT                   NNGSQFFDDFSFGSKLIGIASYNLLGQDINIVLHKDSSINTVQDLKGKRISTLFGSNAH
FT                   RFIITLFDLYNMDVSKDCRLVNEDPRKASKSLANKTIDAYVCCYTFASILEAYAFVRKL
FT                   PLSQTSSLRIPSIRGIVCRSQFIKENPKIVVAYLHDLVVANYWFNSSPIKAADLLTKVI
FT                   DVRTTQVNQFFNPVFGNRIDPTLKPQWSWLLKTLNRRLEGKYGISLFDVDFWIDDYFLR
FT                   LVYNLLNLDYHFHQVSFASEFSSSYFVEEQFSRHIKVLYNKYDLPLQDEDSDRTAISSL
FT                   G"
FT   gene            complement(767311..768315)
FT                   /locus_tag="Npun_R0645"
FT   CDS_pept        complement(767311..768315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0645"
FT                   /product="luciferase family protein"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: gvi:gll4257
FT                   probable monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79399"
FT                   /db_xref="GOA:B2J9A0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A0"
FT                   /protein_id="ACC79399.1"
FT                   /translation="MRVVNHEANLSTQDLVKLAVQADELGYDFYYIPEHYLNAVHGPNY
FT                   NVADAWITAALASLNTKNIKIVAAVQPGFKLPAVIAKLSANIQNQLSNGRFALSGIAGW
FT                   WKLEVESYGDVWLPHSDRYARLEEYIDVIKGLWTVEDFNYVGKYYNIAGGILTDKPTPT
FT                   PPIFIAGESDRAIDLAARQGDYLFINADEPEKTAALVQKVKRLASDRYGRQIKVAMSAF
FT                   AIVREHTSQAEARLEAIYRSANQQQIKYFQEQIDPNVVAHNKLDIKQTIEANLGLSAQL
FT                   VGDRYTILNRLKEYEAVGVDLIVLKFESMLEDTIRFHELVISKYTQQNILIPL"
FT   gene            769031..770128
FT                   /locus_tag="Npun_F0646"
FT   CDS_pept        769031..770128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0646"
FT                   /product="luciferase family protein"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   rha:RHA1_ro02420 probable alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79400"
FT                   /db_xref="GOA:B2J9A1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A1"
FT                   /protein_id="ACC79400.1"
FT                   /translation="MVDIKFAYWIPNVSGGLVVSKIPQRTDWTYEYNAKLAQTAEEVGF
FT                   EYALAQARFIASYGAEYQLEALTTVSALAPVTKKLKLIAAVHPGLWHPGVVAKIGSSID
FT                   FLSNGRFALNVVSGWFKDEFTIYGEHWLDHDECYRRSEEFIRVLKGLWTEDEFHFKGDF
FT                   YRINGGWVKPKPVNQNPHPEIFQGGNSKAARRMAGRVSDWYFMNGNTIEGVREQIEEVS
FT                   ALARQAGRKIKFGLNSFIIVRDTEAEAHEVLRDIIAQADVEAVKGFGEAVKQAGSSTRE
FT                   RQGMWANSNFEDLVQYNDGFRSGLIGTAEQVAEKIRQFHEAGVDLILGGFLHYTDDLPA
FT                   FGKTVIPIVRELKATRRTADELVGV"
FT   gene            770240..771448
FT                   /locus_tag="Npun_F0647"
FT   CDS_pept        770240..771448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0647"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bur:Bcep18194_C7712 acyl-CoA dehydrogenase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79401"
FT                   /db_xref="GOA:B2J9A2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A2"
FT                   /protein_id="ACC79401.1"
FT                   /translation="MTSVINTGQKAHIIRDDKEAIAIAHELAAEFAKGDSERDQNRRLP
FT                   AEEVEKFSQSGLWGITVPQEYGGAFVSNATLAEVIKIISEADSSLGQIPQNHLYMVEAV
FT                   RLDGTDEQKKFFFDLVLQGKRFGNAFSEVGTKSVNDVQTKLQPDGSDFVLNGRKYYSAG
FT                   ALLAHWVPVIASNPDGKTVVAFVERDAEGLTLLDDWTSFGQRTTASGTTIIENVKVKAE
FT                   HVIPHYLAFERATPMGAIAQIIQAAVDVEIAKAAVRDTIHFVRKYTRPWVDSNLEKGYE
FT                   DPLTLYNLGNVQIQVHASEALLRRAGEFLDIANESGLEELKVVEASIAVAEAKALATEA
FT                   ALLATNKLFELAGTKSTLEEFNYNRHWRNARAHTLHDPVRWKYYAVGNYFLNGVYPPRH
FT                   PWL"
FT   gene            771788..772939
FT                   /locus_tag="Npun_F0648"
FT   CDS_pept        771788..772939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0648"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   ppu:PP_2772 monooxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79402"
FT                   /db_xref="GOA:B2J9A3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A3"
FT                   /protein_id="ACC79402.1"
FT                   /translation="MQLIETKESQNYLDLAKSLAKEFAQTAVERDAQGGTPKHERDRLR
FT                   QSNLLKLIVPTEFGGLGQSWITVLQITREFAKVDSSIAHVFSYHHLGVVIPHIFGSAQQ
FT                   KQRYYSETIHNNWFWCNALNPLDKRTTLTPENDYFRLNGIKSFCSGSQDSDILPITATH
FT                   QETNELNILVIPTQRQGVTVHDDWDNMGQRQTDSGSVTFENVLVYPEEILGSRNKANQP
FT                   FNTIRACLTQLNLANIYLGIAQGVFEAAKTYTSTNTKPWLTSGVESATQDPYILQHYGK
FT                   IWVDLQAAVYLTEQAGELLQAAWEQEWSLTAEQRAECALLVATAKVFATKVGLDITNRI
FT                   FEVMGARATSAKYGFDRYWRNLRTFTLHDPVDYKIQEIGKWAL"
FT   gene            complement(773040..774275)
FT                   /locus_tag="Npun_R0649"
FT   CDS_pept        complement(773040..774275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_R0649"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_1492
FT                   glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_R0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79403"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A4"
FT                   /protein_id="ACC79403.1"
FT                   /translation="MVSWKILPFLLSLGLVLIPQITVAQTVEELEQKATSAEEVKNYQE
FT                   AANIWRSLIERDSKNSYAYIKLADILSSQGKIAETIAAYRQGLQLTPDAAIYLKLGNFL
FT                   VEKGRTAEAIAAFRQAVKLDAKSDTASIILAMNLIAMGNPEEAVVAYRQAIKIEPDDDN
FT                   YNNLADTLFKIGKREEAIAAYREALIINPKSYQAYSSLGDILEYSEAVAIYRQASKNDP
FT                   KNEVYYERLAELSLKRGFVNEAIAAYRQLIKIEPEASRYVELGDVLMTQEKHQEAIALY
FT                   RQAVAAKPTDYYYSKLNEALAQHGNLDEALANCQKVVKIGEGSYDTCSNISLPLYKQKG
FT                   FPAVMEFYQPLANLIPRRQMAELYIKLGRDISYGESGDGSKQEAAAVFREVLQIDPENT
FT                   DAQDALKNLIAS"
FT   gene            774383..775423
FT                   /locus_tag="Npun_F0650"
FT   CDS_pept        774383..775423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Npun_F0650"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobW; PFAM:
FT                   cobalamin synthesis protein, P47K; cobalamin synthesis CobW
FT                   domain protein; KEGG: ava:Ava_3407 cobalamin synthesis
FT                   protein/P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Npun_F0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACC79404"
FT                   /db_xref="GOA:B2J9A5"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2J9A5"
FT                   /protein_id="ACC79404.1"
FT                   /translation="MATKIPVTVITGFLGSGKTSLIRHLLQNNQGRRIAVLVNEFGELG
FT