(data stored in ACNUC7421 zone)

EMBL: CP001043

ID   CP001043; SV 1; circular; genomic DNA; STD; PRO; 3479187 BP.
XX
AC   CP001043; AAUG01000000-AAUG01000055;
XX
PR   Project:PRJNA17409;
XX
DT   23-APR-2008 (Rel. 95, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Paraburkholderia phymatum STM815 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia phymatum STM815
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-3479187
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   "Complete sequence of chromosome1 of Burkholderia phymatum STM815";
RL   Unpublished.
XX
RN   [2]
RP   1-3479187
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   ;
RL   Submitted (11-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f767002a8e1ea1cb0abd8b32ae192414.
DR   BioSample; SAMN02598384.
DR   EnsemblGenomes-Gn; Bphy_R0001.
DR   EnsemblGenomes-Gn; Bphy_R0002.
DR   EnsemblGenomes-Gn; Bphy_R0003.
DR   EnsemblGenomes-Gn; Bphy_R0004.
DR   EnsemblGenomes-Gn; Bphy_R0005.
DR   EnsemblGenomes-Gn; Bphy_R0006.
DR   EnsemblGenomes-Gn; Bphy_R0007.
DR   EnsemblGenomes-Gn; Bphy_R0008.
DR   EnsemblGenomes-Gn; Bphy_R0009.
DR   EnsemblGenomes-Gn; Bphy_R0010.
DR   EnsemblGenomes-Gn; Bphy_R0011.
DR   EnsemblGenomes-Gn; Bphy_R0012.
DR   EnsemblGenomes-Gn; Bphy_R0013.
DR   EnsemblGenomes-Gn; Bphy_R0014.
DR   EnsemblGenomes-Gn; Bphy_R0015.
DR   EnsemblGenomes-Gn; Bphy_R0020.
DR   EnsemblGenomes-Gn; Bphy_R0021.
DR   EnsemblGenomes-Gn; Bphy_R0022.
DR   EnsemblGenomes-Gn; Bphy_R0023.
DR   EnsemblGenomes-Gn; Bphy_R0024.
DR   EnsemblGenomes-Gn; Bphy_R0025.
DR   EnsemblGenomes-Gn; Bphy_R0026.
DR   EnsemblGenomes-Gn; Bphy_R0027.
DR   EnsemblGenomes-Gn; Bphy_R0028.
DR   EnsemblGenomes-Gn; Bphy_R0029.
DR   EnsemblGenomes-Gn; Bphy_R0030.
DR   EnsemblGenomes-Gn; Bphy_R0031.
DR   EnsemblGenomes-Gn; Bphy_R0032.
DR   EnsemblGenomes-Gn; Bphy_R0033.
DR   EnsemblGenomes-Gn; Bphy_R0034.
DR   EnsemblGenomes-Gn; Bphy_R0035.
DR   EnsemblGenomes-Gn; Bphy_R0036.
DR   EnsemblGenomes-Gn; Bphy_R0037.
DR   EnsemblGenomes-Gn; Bphy_R0038.
DR   EnsemblGenomes-Gn; Bphy_R0039.
DR   EnsemblGenomes-Gn; Bphy_R0040.
DR   EnsemblGenomes-Gn; Bphy_R0041.
DR   EnsemblGenomes-Gn; Bphy_R0042.
DR   EnsemblGenomes-Gn; Bphy_R0043.
DR   EnsemblGenomes-Gn; Bphy_R0044.
DR   EnsemblGenomes-Gn; Bphy_R0045.
DR   EnsemblGenomes-Gn; Bphy_R0046.
DR   EnsemblGenomes-Gn; Bphy_R0047.
DR   EnsemblGenomes-Gn; Bphy_R0048.
DR   EnsemblGenomes-Gn; Bphy_R0049.
DR   EnsemblGenomes-Gn; Bphy_R0050.
DR   EnsemblGenomes-Gn; Bphy_R0051.
DR   EnsemblGenomes-Gn; Bphy_R0052.
DR   EnsemblGenomes-Gn; Bphy_R0053.
DR   EnsemblGenomes-Gn; Bphy_R0054.
DR   EnsemblGenomes-Gn; Bphy_R0055.
DR   EnsemblGenomes-Gn; Bphy_R0056.
DR   EnsemblGenomes-Gn; Bphy_R0057.
DR   EnsemblGenomes-Gn; Bphy_R0058.
DR   EnsemblGenomes-Gn; Bphy_R0059.
DR   EnsemblGenomes-Gn; Bphy_R0060.
DR   EnsemblGenomes-Gn; Bphy_R0061.
DR   EnsemblGenomes-Gn; Bphy_R0062.
DR   EnsemblGenomes-Gn; Bphy_R0063.
DR   EnsemblGenomes-Gn; Bphy_R0064.
DR   EnsemblGenomes-Gn; Bphy_R0065.
DR   EnsemblGenomes-Gn; Bphy_R0066.
DR   EnsemblGenomes-Gn; Bphy_R0067.
DR   EnsemblGenomes-Gn; Bphy_R0068.
DR   EnsemblGenomes-Gn; Bphy_R0069.
DR   EnsemblGenomes-Gn; Bphy_R0070.
DR   EnsemblGenomes-Gn; Bphy_R0071.
DR   EnsemblGenomes-Gn; Bphy_R0072.
DR   EnsemblGenomes-Gn; Bphy_R0073.
DR   EnsemblGenomes-Gn; Bphy_R0074.
DR   EnsemblGenomes-Gn; Bphy_R0075.
DR   EnsemblGenomes-Gn; EBG00001013667.
DR   EnsemblGenomes-Gn; EBG00001013669.
DR   EnsemblGenomes-Gn; EBG00001013671.
DR   EnsemblGenomes-Gn; EBG00001013673.
DR   EnsemblGenomes-Gn; EBG00001013675.
DR   EnsemblGenomes-Gn; EBG00001013677.
DR   EnsemblGenomes-Gn; EBG00001013679.
DR   EnsemblGenomes-Gn; EBG00001013681.
DR   EnsemblGenomes-Gn; EBG00001013683.
DR   EnsemblGenomes-Gn; EBG00001013685.
DR   EnsemblGenomes-Gn; EBG00001013687.
DR   EnsemblGenomes-Gn; EBG00001013689.
DR   EnsemblGenomes-Gn; EBG00001013691.
DR   EnsemblGenomes-Gn; EBG00001013693.
DR   EnsemblGenomes-Gn; EBG00001013695.
DR   EnsemblGenomes-Gn; EBG00001013697.
DR   EnsemblGenomes-Gn; EBG00001013699.
DR   EnsemblGenomes-Gn; EBG00001013701.
DR   EnsemblGenomes-Gn; EBG00001013703.
DR   EnsemblGenomes-Gn; EBG00001013705.
DR   EnsemblGenomes-Gn; EBG00001013707.
DR   EnsemblGenomes-Gn; EBG00001013708.
DR   EnsemblGenomes-Gn; EBG00001013710.
DR   EnsemblGenomes-Gn; EBG00001013711.
DR   EnsemblGenomes-Gn; EBG00001013712.
DR   EnsemblGenomes-Gn; EBG00001013713.
DR   EnsemblGenomes-Gn; EBG00001013714.
DR   EnsemblGenomes-Gn; EBG00001013715.
DR   EnsemblGenomes-Gn; EBG00001013716.
DR   EnsemblGenomes-Gn; EBG00001013717.
DR   EnsemblGenomes-Gn; EBG00001013718.
DR   EnsemblGenomes-Gn; EBG00001013719.
DR   EnsemblGenomes-Gn; EBG00001013720.
DR   EnsemblGenomes-Gn; EBG00001013721.
DR   EnsemblGenomes-Gn; EBG00001013722.
DR   EnsemblGenomes-Gn; EBG00001013723.
DR   EnsemblGenomes-Gn; EBG00001013724.
DR   EnsemblGenomes-Gn; EBG00001013725.
DR   EnsemblGenomes-Gn; EBG00001013726.
DR   EnsemblGenomes-Gn; EBG00001013727.
DR   EnsemblGenomes-Gn; EBG00001013728.
DR   EnsemblGenomes-Gn; EBG00001013729.
DR   EnsemblGenomes-Gn; EBG00001013730.
DR   EnsemblGenomes-Gn; EBG00001013731.
DR   EnsemblGenomes-Gn; EBG00001013732.
DR   EnsemblGenomes-Gn; EBG00001013733.
DR   EnsemblGenomes-Gn; EBG00001013734.
DR   EnsemblGenomes-Gn; EBG00001013735.
DR   EnsemblGenomes-Gn; EBG00001013736.
DR   EnsemblGenomes-Gn; EBG00001013737.
DR   EnsemblGenomes-Gn; EBG00001013738.
DR   EnsemblGenomes-Gn; EBG00001013739.
DR   EnsemblGenomes-Gn; EBG00001013740.
DR   EnsemblGenomes-Gn; EBG00001013741.
DR   EnsemblGenomes-Gn; EBG00001013742.
DR   EnsemblGenomes-Gn; EBG00001013743.
DR   EnsemblGenomes-Gn; EBG00001013744.
DR   EnsemblGenomes-Gn; EBG00001013745.
DR   EnsemblGenomes-Gn; EBG00001013746.
DR   EnsemblGenomes-Gn; EBG00001013747.
DR   EnsemblGenomes-Gn; EBG00001013748.
DR   EnsemblGenomes-Gn; EBG00001013749.
DR   EnsemblGenomes-Gn; EBG00001013750.
DR   EnsemblGenomes-Gn; EBG00001013751.
DR   EnsemblGenomes-Gn; EBG00001013752.
DR   EnsemblGenomes-Gn; EBG00001013753.
DR   EnsemblGenomes-Gn; EBG00001013754.
DR   EnsemblGenomes-Gn; EBG00001013755.
DR   EnsemblGenomes-Gn; EBG00001013756.
DR   EnsemblGenomes-Gn; EBG00001013757.
DR   EnsemblGenomes-Gn; EBG00001013758.
DR   EnsemblGenomes-Gn; EBG00001013759.
DR   EnsemblGenomes-Gn; EBG00001013760.
DR   EnsemblGenomes-Gn; EBG00001013761.
DR   EnsemblGenomes-Gn; EBG00001013762.
DR   EnsemblGenomes-Gn; EBG00001013763.
DR   EnsemblGenomes-Gn; EBG00001013764.
DR   EnsemblGenomes-Gn; EBG00001013765.
DR   EnsemblGenomes-Gn; EBG00001013766.
DR   EnsemblGenomes-Gn; EBG00001013767.
DR   EnsemblGenomes-Gn; EBG00001013768.
DR   EnsemblGenomes-Gn; EBG00001013769.
DR   EnsemblGenomes-Gn; EBG00001013770.
DR   EnsemblGenomes-Gn; EBG00001013771.
DR   EnsemblGenomes-Gn; EBG00001013772.
DR   EnsemblGenomes-Gn; EBG00001013773.
DR   EnsemblGenomes-Tr; Bphy_R0001-1.
DR   EnsemblGenomes-Tr; Bphy_R0002-1.
DR   EnsemblGenomes-Tr; Bphy_R0003-1.
DR   EnsemblGenomes-Tr; Bphy_R0004-1.
DR   EnsemblGenomes-Tr; Bphy_R0005-1.
DR   EnsemblGenomes-Tr; Bphy_R0006-1.
DR   EnsemblGenomes-Tr; Bphy_R0007-1.
DR   EnsemblGenomes-Tr; Bphy_R0008-1.
DR   EnsemblGenomes-Tr; Bphy_R0009-1.
DR   EnsemblGenomes-Tr; Bphy_R0010-1.
DR   EnsemblGenomes-Tr; Bphy_R0011-1.
DR   EnsemblGenomes-Tr; Bphy_R0012-1.
DR   EnsemblGenomes-Tr; Bphy_R0013-1.
DR   EnsemblGenomes-Tr; Bphy_R0014-1.
DR   EnsemblGenomes-Tr; Bphy_R0015-1.
DR   EnsemblGenomes-Tr; Bphy_R0020-1.
DR   EnsemblGenomes-Tr; Bphy_R0021-1.
DR   EnsemblGenomes-Tr; Bphy_R0022-1.
DR   EnsemblGenomes-Tr; Bphy_R0023-1.
DR   EnsemblGenomes-Tr; Bphy_R0024-1.
DR   EnsemblGenomes-Tr; Bphy_R0025-1.
DR   EnsemblGenomes-Tr; Bphy_R0026-1.
DR   EnsemblGenomes-Tr; Bphy_R0027-1.
DR   EnsemblGenomes-Tr; Bphy_R0028-1.
DR   EnsemblGenomes-Tr; Bphy_R0029-1.
DR   EnsemblGenomes-Tr; Bphy_R0030-1.
DR   EnsemblGenomes-Tr; Bphy_R0031-1.
DR   EnsemblGenomes-Tr; Bphy_R0032-1.
DR   EnsemblGenomes-Tr; Bphy_R0033-1.
DR   EnsemblGenomes-Tr; Bphy_R0034-1.
DR   EnsemblGenomes-Tr; Bphy_R0035-1.
DR   EnsemblGenomes-Tr; Bphy_R0036-1.
DR   EnsemblGenomes-Tr; Bphy_R0037-1.
DR   EnsemblGenomes-Tr; Bphy_R0038-1.
DR   EnsemblGenomes-Tr; Bphy_R0039-1.
DR   EnsemblGenomes-Tr; Bphy_R0040-1.
DR   EnsemblGenomes-Tr; Bphy_R0041-1.
DR   EnsemblGenomes-Tr; Bphy_R0042-1.
DR   EnsemblGenomes-Tr; Bphy_R0043-1.
DR   EnsemblGenomes-Tr; Bphy_R0044-1.
DR   EnsemblGenomes-Tr; Bphy_R0045-1.
DR   EnsemblGenomes-Tr; Bphy_R0046-1.
DR   EnsemblGenomes-Tr; Bphy_R0047-1.
DR   EnsemblGenomes-Tr; Bphy_R0048-1.
DR   EnsemblGenomes-Tr; Bphy_R0049-1.
DR   EnsemblGenomes-Tr; Bphy_R0050-1.
DR   EnsemblGenomes-Tr; Bphy_R0051-1.
DR   EnsemblGenomes-Tr; Bphy_R0052-1.
DR   EnsemblGenomes-Tr; Bphy_R0053-1.
DR   EnsemblGenomes-Tr; Bphy_R0054-1.
DR   EnsemblGenomes-Tr; Bphy_R0055-1.
DR   EnsemblGenomes-Tr; Bphy_R0056-1.
DR   EnsemblGenomes-Tr; Bphy_R0057-1.
DR   EnsemblGenomes-Tr; Bphy_R0058-1.
DR   EnsemblGenomes-Tr; Bphy_R0059-1.
DR   EnsemblGenomes-Tr; Bphy_R0060-1.
DR   EnsemblGenomes-Tr; Bphy_R0061-1.
DR   EnsemblGenomes-Tr; Bphy_R0062-1.
DR   EnsemblGenomes-Tr; Bphy_R0063-1.
DR   EnsemblGenomes-Tr; Bphy_R0064-1.
DR   EnsemblGenomes-Tr; Bphy_R0065-1.
DR   EnsemblGenomes-Tr; Bphy_R0066-1.
DR   EnsemblGenomes-Tr; Bphy_R0067-1.
DR   EnsemblGenomes-Tr; Bphy_R0068-1.
DR   EnsemblGenomes-Tr; Bphy_R0069-1.
DR   EnsemblGenomes-Tr; Bphy_R0070-1.
DR   EnsemblGenomes-Tr; Bphy_R0071-1.
DR   EnsemblGenomes-Tr; Bphy_R0072-1.
DR   EnsemblGenomes-Tr; Bphy_R0073-1.
DR   EnsemblGenomes-Tr; Bphy_R0074-1.
DR   EnsemblGenomes-Tr; Bphy_R0075-1.
DR   EnsemblGenomes-Tr; EBT00001536813.
DR   EnsemblGenomes-Tr; EBT00001536816.
DR   EnsemblGenomes-Tr; EBT00001536819.
DR   EnsemblGenomes-Tr; EBT00001536823.
DR   EnsemblGenomes-Tr; EBT00001536825.
DR   EnsemblGenomes-Tr; EBT00001536831.
DR   EnsemblGenomes-Tr; EBT00001536833.
DR   EnsemblGenomes-Tr; EBT00001536836.
DR   EnsemblGenomes-Tr; EBT00001536839.
DR   EnsemblGenomes-Tr; EBT00001536843.
DR   EnsemblGenomes-Tr; EBT00001536845.
DR   EnsemblGenomes-Tr; EBT00001536848.
DR   EnsemblGenomes-Tr; EBT00001536852.
DR   EnsemblGenomes-Tr; EBT00001536854.
DR   EnsemblGenomes-Tr; EBT00001536855.
DR   EnsemblGenomes-Tr; EBT00001536857.
DR   EnsemblGenomes-Tr; EBT00001536860.
DR   EnsemblGenomes-Tr; EBT00001536862.
DR   EnsemblGenomes-Tr; EBT00001536867.
DR   EnsemblGenomes-Tr; EBT00001536871.
DR   EnsemblGenomes-Tr; EBT00001536873.
DR   EnsemblGenomes-Tr; EBT00001536875.
DR   EnsemblGenomes-Tr; EBT00001536877.
DR   EnsemblGenomes-Tr; EBT00001536879.
DR   EnsemblGenomes-Tr; EBT00001536881.
DR   EnsemblGenomes-Tr; EBT00001536883.
DR   EnsemblGenomes-Tr; EBT00001536885.
DR   EnsemblGenomes-Tr; EBT00001536887.
DR   EnsemblGenomes-Tr; EBT00001536889.
DR   EnsemblGenomes-Tr; EBT00001536891.
DR   EnsemblGenomes-Tr; EBT00001536895.
DR   EnsemblGenomes-Tr; EBT00001536898.
DR   EnsemblGenomes-Tr; EBT00001536900.
DR   EnsemblGenomes-Tr; EBT00001536902.
DR   EnsemblGenomes-Tr; EBT00001536904.
DR   EnsemblGenomes-Tr; EBT00001536906.
DR   EnsemblGenomes-Tr; EBT00001536908.
DR   EnsemblGenomes-Tr; EBT00001536911.
DR   EnsemblGenomes-Tr; EBT00001536913.
DR   EnsemblGenomes-Tr; EBT00001536914.
DR   EnsemblGenomes-Tr; EBT00001536915.
DR   EnsemblGenomes-Tr; EBT00001536916.
DR   EnsemblGenomes-Tr; EBT00001536917.
DR   EnsemblGenomes-Tr; EBT00001536918.
DR   EnsemblGenomes-Tr; EBT00001536919.
DR   EnsemblGenomes-Tr; EBT00001536920.
DR   EnsemblGenomes-Tr; EBT00001536921.
DR   EnsemblGenomes-Tr; EBT00001536922.
DR   EnsemblGenomes-Tr; EBT00001536923.
DR   EnsemblGenomes-Tr; EBT00001536924.
DR   EnsemblGenomes-Tr; EBT00001536925.
DR   EnsemblGenomes-Tr; EBT00001536926.
DR   EnsemblGenomes-Tr; EBT00001536927.
DR   EnsemblGenomes-Tr; EBT00001536928.
DR   EnsemblGenomes-Tr; EBT00001536929.
DR   EnsemblGenomes-Tr; EBT00001536930.
DR   EnsemblGenomes-Tr; EBT00001536931.
DR   EnsemblGenomes-Tr; EBT00001536933.
DR   EnsemblGenomes-Tr; EBT00001536935.
DR   EnsemblGenomes-Tr; EBT00001536936.
DR   EnsemblGenomes-Tr; EBT00001536938.
DR   EnsemblGenomes-Tr; EBT00001536939.
DR   EnsemblGenomes-Tr; EBT00001536941.
DR   EnsemblGenomes-Tr; EBT00001536943.
DR   EnsemblGenomes-Tr; EBT00001536945.
DR   EnsemblGenomes-Tr; EBT00001536947.
DR   EnsemblGenomes-Tr; EBT00001536949.
DR   EnsemblGenomes-Tr; EBT00001536950.
DR   EnsemblGenomes-Tr; EBT00001536952.
DR   EnsemblGenomes-Tr; EBT00001536954.
DR   EnsemblGenomes-Tr; EBT00001536955.
DR   EnsemblGenomes-Tr; EBT00001536957.
DR   EnsemblGenomes-Tr; EBT00001536958.
DR   EnsemblGenomes-Tr; EBT00001536960.
DR   EnsemblGenomes-Tr; EBT00001536962.
DR   EnsemblGenomes-Tr; EBT00001536963.
DR   EnsemblGenomes-Tr; EBT00001536965.
DR   EnsemblGenomes-Tr; EBT00001536966.
DR   EnsemblGenomes-Tr; EBT00001536967.
DR   EnsemblGenomes-Tr; EBT00001536969.
DR   EnsemblGenomes-Tr; EBT00001536970.
DR   EnsemblGenomes-Tr; EBT00001536972.
DR   EnsemblGenomes-Tr; EBT00001536973.
DR   EnsemblGenomes-Tr; EBT00001536974.
DR   EnsemblGenomes-Tr; EBT00001536976.
DR   EnsemblGenomes-Tr; EBT00001536977.
DR   EuropePMC; PMC4029289; 24883196.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001043.
DR   SILVA-SSU; CP001043.
DR   StrainInfo; 302139; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002725
CC   Source DNA and bacteria available from Michelle Lizotte-Waniewski
CC   (mlizotte@bio.umass.edu)
CC   Contacts: Michelle Lizotte-Waniewski (mlizotte@bio.umass.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3479187
FT                   /organism="Paraburkholderia phymatum STM815"
FT                   /chromosome="1"
FT                   /strain="STM815"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391038"
FT                   /type_material="type strain of Paraburkholderia phymatum"
FT   gene            362..1918
FT                   /locus_tag="Bphy_0001"
FT   CDS_pept        362..1918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bxe:Bxe_A4462 chromosomal replication
FT                   initiator protein, DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69198"
FT                   /db_xref="GOA:B2JJ97"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJ97"
FT                   /protein_id="ACC69198.1"
FT                   /translation="MNEFWQHCSALLERELTPQQYVTWIKPLAPVAFDADANTLSIAAP
FT                   NRFKLDWVKSQFSGRITDLARDFWHSPVDVQFVLDPKAGMRTAPAAPSRPPSAGVRNAA
FT                   AAVDAAVGAVQAAHSARGGGMPGLGMPTNAAQLTDDAADLDLPSLDANEAAAARRTWRP
FT                   GAAAQAAGGESDSTYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISYNPLFLY
FT                   GGVGLGKTHLIHAIGNQLLMDKPGARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLD
FT                   LLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSG
FT                   LTVAIEPPELEMRVAILMRKAQSEGVNLNEDVAFFVAKHLRSNVRELEGALRKILAYSK
FT                   FHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYSIKVADMYSKKRPANIARPR
FT                   QIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERGKDAQLNHELHVLEQTLK
FT                   G"
FT   gene            2175..3278
FT                   /locus_tag="Bphy_0002"
FT   CDS_pept        2175..3278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bxe:Bxe_A4461 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69199"
FT                   /db_xref="GOA:B2JJ98"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJ98"
FT                   /protein_id="ACC69199.1"
FT                   /translation="MQLVKTERDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGESVATTVAARKLLDILRAMPDGQVTLTLNDKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDFGANLAVPQKTFRQLLGMVHFAMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAYSSMKIEGSFARQEVIIPRKTILELQRLLEDIDDVLKIDIAPT
FT                   QVKFTFGGVELVSKLVEGKFPDFQRVIPKSHKNTFVIGREELQRSLQRAAILTSDKFKG
FT                   VRCIVEPGQLKIMSTNADQEEAQEELEIPYQGDSIDIGFNVTYLLDVLANLKVDMLEIS
FT                   LGDASSSALITIPENDEFKYVVMPMRI"
FT   gene            3392..5863
FT                   /locus_tag="Bphy_0003"
FT   CDS_pept        3392..5863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: bxe:Bxe_A4460 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69200"
FT                   /db_xref="GOA:B2JJ99"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJ99"
FT                   /protein_id="ACC69200.1"
FT                   /translation="MTDTNNSQPDNSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGHCDDIQVIIHADNSISVTDNGRGIPTGIKRDDKHDPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSSWLRLTVRRDGKKHFMEFHRGVVQ
FT                   NRVIEQVDGESLSPIPVVGETENRGTEVHFMADETIFGNVEYHYDILAKRIRELSFLNN
FT                   GVRIRLTDQRSGKEDDFAFVGGVKGFVEYINKTKSVLHPTIFHIVGEKEGVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADHEIAKKAKVETSGDDMRE
FT                   GLSCVLSVKVPEPKFSSQTKDKLVSSEVRAPVEEVVAKALEEFLLETPNDAKIICGKIV
FT                   DAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLITALGCGIGKEDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYIYIAQPPLYKVKAGKDERYLKDTAELN
FT                   AHMLRLALNGSELVAAEGATPIAGDALGELARSYLLAQAVVDRLSRLYDEAALGAVMDG
FT                   VSIDLSSEQSTEASARALEAKLRDDPLKPEINVFAMYDPVRELRSLRVERRHHGNVKVS
FT                   VIDEEFQLTADYQQLVNTANTFKGLIGEGAVIKRGERSMAVGDFKSAMKWLIADAERNV
FT                   SKQRYKGLGEMNPEQLWETTMDPNVRRLLRVQIEDAIAADGIFTTLMGDEVEPRRAFIE
FT                   SNALRAGNIDV"
FT   gene            complement(5956..6237)
FT                   /locus_tag="Bphy_0004"
FT   CDS_pept        complement(5956..6237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC4351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69201"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA0"
FT                   /protein_id="ACC69201.1"
FT                   /translation="MDRAMFDLRRVGMRGAMKRYRDLSGRSGVVAYELSETWVSVKFSD
FT                   GTLYRYDYAATGRKDVEEMKSLAIAGRGLSTYISQVVKDRYARKWRND"
FT   gene            complement(6240..7009)
FT                   /pseudo
FT                   /locus_tag="Bphy_0005"
FT   gene            7331..8734
FT                   /locus_tag="Bphy_0006"
FT   CDS_pept        7331..8734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0006"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: bxe:Bxe_A4445
FT                   ethanolamine transporter, EAT family, APC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69202"
FT                   /db_xref="GOA:B2JJA1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA1"
FT                   /protein_id="ACC69202.1"
FT                   /translation="MKQASTTQHKGNVTHHELKQTLGTWQLWGIAVGLVISGEYFGWSY
FT                   GWASAGTLGFVITALFIAAMYTTFIFSFTELTTSIPHAGGPFAYARHAFGPTGGYIAGA
FT                   ATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAAAFELCV
FT                   TLLAIFELLVFMGVVSPGFQWSNFAKGGWAGSDAFNMGSFHGMFAAIPFAIWFFLAIEG
FT                   VAMAAEEAKNPKRSIPIAYVTGILTLVVLAIGVMVFAGAAGDWTKLSNINDPLPQAMKY
FT                   IVGENSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALARAGYLPEWLSKVHPRFKTPH
FT                   RAILAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIISMLALFKLRRIEPN
FT                   MERPFRAPLFPYFPAFALVAAVISLGTMIYFNLLVALVFAAFLALGYGYFLMTRHQREA
FT                   APADVLLEE"
FT   gene            8816..10210
FT                   /locus_tag="Bphy_0007"
FT   CDS_pept        8816..10210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0007"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: bxe:Bxe_A4444 putative ethanolamine ammonia lyase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69203"
FT                   /db_xref="GOA:B2JJA2"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA2"
FT                   /protein_id="ACC69203.1"
FT                   /translation="MSYMETIGSRTYRFADLKSLMAKASPLRSGDQLAGIAAASEEERV
FT                   AAKMALADVPLRTFLNEALIPYESDEVTRLVIDTHSPEAFAPIAHLTVGEFRNWLLSSE
FT                   TDTDTLTRVTKGLTPEMVAAVSKLMRNQDLILAARKRPVITRFRNTVGLPGHMSVRLQP
FT                   NHPTDDVKGIAASMIDGLMYGCGDAMIGINPASDSLSAITNLLLMIDDFRTRYHVPTQS
FT                   CVLTHVTNTISAIEKGAPVDLVFQSIAGTEKANAGFGISLALLQEAYEAALALKRGTVG
FT                   DNVMYFETGQGSALSADAHHGVDQQTCEVRAYAVARHFNPFLVNTVVGFIGPEYLYDGK
FT                   QITRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDNLLTLLGVAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDALYVREVLGLRRAPEFEEWLESMQITDTRGALLNAPTGQPLLEGAS
FT                   EWMGIA"
FT   gene            10207..11001
FT                   /locus_tag="Bphy_0008"
FT   CDS_pept        10207..11001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0008"
FT                   /product="Ethanolamine ammonia-lyase"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   bxe:Bxe_A4443 ethanolamine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69204"
FT                   /db_xref="GOA:B2JJA3"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA3"
FT                   /protein_id="ACC69204.1"
FT                   /translation="MSDSIEKNAWQALRAFTNARIALGRAGNSLPTAPLLAFNLSHAQA
FT                   RDAVHHPLDVDVLHEQLRTLGFSTLDVHSAAPDRAHYLRRPDMGRRLSDESREALTHAA
FT                   ASEAPDVVFVIADGLSAFAASKQSVPFLQAVTKRLAGWKIGPVVVARQSRVALGDEIGE
FT                   LLRSKLVVMLIGERPGLSSPDSLGVYLTYAPKVGCSDAQRNCISNVRPEGLDYEAAAHK
FT                   LHYLLTHARRLGLTGVGLKDDSDALLQAPETKPTIADDSKTR"
FT   gene            complement(11042..11434)
FT                   /locus_tag="Bphy_0009"
FT   CDS_pept        complement(11042..11434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0009"
FT                   /product="protein of unknown function DUF779"
FT                   /note="PFAM: protein of unknown function DUF779; KEGG:
FT                   bxe:Bxe_A4442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69205"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA4"
FT                   /protein_id="ACC69205.1"
FT                   /translation="MNEQGVARVVATDAAIKLIQRLSAEHGPIIFHQSGGCCDGSAPMC
FT                   FPSNEFLVGGSDVRLGEIAGVPFYMSESQFEYWQHTQLIIDAVPGNGGMFSLERPTGLR
FT                   FLTRSRLFADDENAWLEKHPVSKVDA"
FT   gene            complement(11514..13034)
FT                   /locus_tag="Bphy_0010"
FT   CDS_pept        complement(11514..13034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0010"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bxe:Bxe_A4441
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69206"
FT                   /db_xref="GOA:B2JJA5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA5"
FT                   /protein_id="ACC69206.1"
FT                   /translation="MNHAEMKFLTTEFPYKKQYANFIGGEWVKPTGGEYFDNISPITGE
FT                   PFTSIPRSREADIELALDAAHRARAAWGKTSTTDRANILNKIADRLEANLQRLAVAESI
FT                   DNGKPLRETMAADIPLAIDHFRYFAGAVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIP
FT                   WNFPILMAAWKLAPALAAGNCVVMKPAEQTPASLLVLAELIQDLLPPGVLNIVNGFGLE
FT                   AGKPLASNKRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVLDKDDS
FT                   FFDKALEGFAMFALNQGEVCTCPSRVLIEESIYDRFMERALKRVAAIQQGHPLDTKTMI
FT                   GAQASREQLEKILSYIDLGKQEGAQCLIGGEQNKLDGELSKGYYVKPTVFRGHNKMRIF
FT                   QEEIFGPVVSVTTFKTEEEALEIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSEKPLGFF"
FT   gene            13381..14397
FT                   /locus_tag="Bphy_0011"
FT   CDS_pept        13381..14397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0011"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_A4440 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69207"
FT                   /db_xref="GOA:B2JJA6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA6"
FT                   /protein_id="ACC69207.1"
FT                   /translation="MPHMTTDHHSLSAYPPACRVETCVAHDADEQARNLHGWTQTYDQL
FT                   TAGHFVGRLTGLHLDDMHVFCETTSQTLRQTCEVPSDAYWFGVPADDVSIGRIGAQPIN
FT                   GDSLAFQRGGVEFELLTPGGYAIFGVVVRGATLRRHAASVEHADLLDRATHTGVIPIAM
FT                   EHKVRICGLLRSMLDDTARAALSEGARRNLQGSVLSSLFDLCATTALEPVAMPARPRRQ
FT                   WIVSQARDYVIANRERPVGVPELCEHLHVSRRTLQYCFQDVLGLAPASYLRAIRLNGAR
FT                   RQLCGATPGELTVQDVAAAWGFWHLSQFATDYRKLFGVRPSETLKTVPAPPSPRLAH"
FT   gene            14834..15019
FT                   /locus_tag="Bphy_0012"
FT   CDS_pept        14834..15019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69208"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJA7"
FT                   /protein_id="ACC69208.1"
FT                   /translation="MFTCINQSCGAQWELSDVTIKNEGQGLLFRCPMCGARNYVERFDA
FT                   DDGTIVYEQIEGRPYN"
FT   gene            15034..16425
FT                   /locus_tag="Bphy_0013"
FT   CDS_pept        15034..16425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0013"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bte:BTH_II0214
FT                   ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69209"
FT                   /db_xref="GOA:B2JJS2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS2"
FT                   /protein_id="ACC69209.1"
FT                   /translation="MTTQARPFSELPLSQAVLANLTQLGYADMTPIQAASLPIALAGHD
FT                   LIAQAKTGSGKTAAFSLALLARLDARRYAVQAMVLCPTRELADQVTQEIRRLARAEENI
FT                   KVLTLCGGTPMRPQTASLEHGAHIVVGTPGRIMDHLERGSLSLDALNTLVLDEADRMLD
FT                   MGFFDDIAKVARQCPKERQTLLFSATYPEGIAKLSQQFLRNPKEVKLEERHDDSKIRQR
FT                   FYEVTEDERLHAVGQLLNHYRPVSTIAFCNTKNQCRDLLDVLCAQGFHALALHGELDQR
FT                   ERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGRADQ
FT                   EGWALSLASMNEMGRVGAIEEAQGRDVEWHPLAELNAASDEPLLPPMETLQILGGRKEK
FT                   IRPGDVLGALTGDAGFNGSQIGKINVTEFSTYVAVERGIARDALRKLNAGKIKGKKVKV
FT                   RLMDE"
FT   gene            16752..17906
FT                   /locus_tag="Bphy_0014"
FT   CDS_pept        16752..17906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0014"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bxe:Bxe_A4435 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69210"
FT                   /db_xref="GOA:B2JJS3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS3"
FT                   /protein_id="ACC69210.1"
FT                   /translation="MQSALQARSKLPDVGTTIFTVIGQLAAEHNALNLSQGAPNFAPDE
FT                   ALVDGVTKAMRAGHNQYAPMAGIGALRSALAAKIETLYGVHYDPSTEVTVIASASEGLY
FT                   STISALVHPGDEVIYFEPSFDSYAPIVRLQGAKPVPIKLSAPSFRVNWDEVSAAITPKT
FT                   RMIIVNTPHNPTATIFSDADIERLKAVTRNTDIVILSDEVYEHVVFDGAKHHSMARHRE
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAALMDEIRKIHQFMVFSADTPMQYAFVEALS
FT                   DPQSYLGLSDFYQRKRDLLASELRESRFELLPSEGSFFMLARFRGFSDESDSDFVLRLI
FT                   RDAKVATIPLSAFYTDATDAGVIRLSFSKDDDTLIEGARRLRSI"
FT   gene            17921..18763
FT                   /locus_tag="Bphy_0015"
FT   CDS_pept        17921..18763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0015"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bcn:Bcen_0256 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69211"
FT                   /db_xref="GOA:B2JJS4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS4"
FT                   /protein_id="ACC69211.1"
FT                   /translation="MMQQSIKAAVVQMSSSADVQQNLGEARRWVQQAAREGATLICLPE
FT                   YFCWIGDGEMQRVALAESFGDGPIQRTLSELARETGTWLIGGTVPIRPAHGPQVGTHAY
FT                   NTSLVFDPAGQCAARYDKIHLFSFNQGAEQHAEGDTMVGGDSISTARGPFGTLRLSVCY
FT                   DLRFPELYRAGPDADIIAVPAAFTHTTGLAHWELLLRARAVENQAFVLASGQCGTHSNG
FT                   WRTFGHSMIVGPWGEVLARRDDEPGIALATLTQSALDEARDRLPVLAHRRIATPSDVR"
FT   gene            18797..19588
FT                   /locus_tag="Bphy_0016"
FT   CDS_pept        18797..19588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0016"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bxe:Bxe_A4434 ABC amino acid transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69212"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS5"
FT                   /protein_id="ACC69212.1"
FT                   /translation="MKLVKSLLMLSCGFASVAAVSAIAADATSLRYGLEAQYPPFESKG
FT                   ANGELQGFDIDIGNAVCKTANLKCSWVETSFDGLIPALQGRKFDAINSAMNATEKRRQA
FT                   IDFTNVIYRVPTQLIARKDSGLQPTPESLKGKRVGVLQASIQETYAKAHWESAGVAVVP
FT                   YQDQNQVYADLVAGRLDATLVLAPAGQTGFLSRPDGKDFAFVGEPVRDDKILGSGIAFG
FT                   IRKGDTALRNQLNAAIAKVQSEGTVKTLAQKYFGNIDVSAK"
FT   sig_peptide     18797..18871
FT                   /locus_tag="Bphy_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            19749..20486
FT                   /locus_tag="Bphy_0017"
FT   CDS_pept        19749..20486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0017"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: bxe:Bxe_B1670 predicted transmembrane
FT                   transcriptional regulator (anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69213"
FT                   /db_xref="GOA:B2JJS6"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS6"
FT                   /protein_id="ACC69213.1"
FT                   /translation="MSRTFPPSDTPLTEADMQAFADGNLSPERAAHVRKYLGSRPVEAE
FT                   RIAFYRQLNMQMRSVFESAFAPRVHVRRADPEHGATVRSTLRGSVIRRVGVALLGVVLA
FT                   VLVASGWLVASRVSPEMLDAAAVMAWMRASGQPVSQASAAVPGDPYAVDLVPVGFKLVA
FT                   ARTRHPHAFASIDVLDYRNADGEPVVLLSAPAPFAANQPHWTAQRIGHLRLLSWTVDGR
FT                   RYVIAGHATTHGLMRAADALTSR"
FT   gene            20605..21123
FT                   /locus_tag="Bphy_0018"
FT   CDS_pept        20605..21123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0018"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_B1671 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69214"
FT                   /db_xref="GOA:B2JJS7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS7"
FT                   /protein_id="ACC69214.1"
FT                   /translation="MDIRNELMDHVPRLRRYARALISNRDLADDLVQDTLERALSRTKM
FT                   FEAGTDLRAWLFTIMHNVFVNQVRKSSSRAVHVSVDDESIVESEFAVSGEQTRSLEVRD
FT                   LDYALQRLPADQREVVLLVGLEEMSYAEVAIALDIPVGTVMSRLSRGRERLRALMAGAQ
FT                   PGAKLKVVR"
FT   gene            21120..21953
FT                   /locus_tag="Bphy_0019"
FT   CDS_pept        21120..21953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0019"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: bxe:Bxe_B1672 predicted transmembrane
FT                   transcriptional regulator (anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69215"
FT                   /db_xref="GOA:B2JJS8"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS8"
FT                   /protein_id="ACC69215.1"
FT                   /translation="MSDQQTPISEEEIHAYVDGTLSDERREQVERAIELNPALAARISD
FT                   YFSLNNMFHERYDRVLSEPVPVRLRVPEKRRWMGAANWPQFAGMAAALVLGIGIGVGTN
FT                   MGKDVAAPWTVGPSATSNTRPVSADASEVFAQKAALAHVVYMPAVDRPAQIGEDHEQDF
FT                   VQYLANKLGTDVHPPMLTKNGFELAGGRVLPGDDGPVAQFMYHNAKGERVTLCISHRKA
FT                   SANTTAFKLYQDGPVNVFYWVDGDFGYAVSGGIDRKVMLQIAHDVYAQLTAATPG"
FT   gene            22125..22394
FT                   /locus_tag="Bphy_0020"
FT   CDS_pept        22125..22394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69216"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJS9"
FT                   /protein_id="ACC69216.1"
FT                   /translation="MKMLALLAVSVAALGSTNVFAQGKTRAQVYQELIEAQQNGLNYVT
FT                   DASYPDVSPAFQGTVEYLKKQALANADNANRMAKAASDATVPGN"
FT   sig_peptide     22125..22190
FT                   /locus_tag="Bphy_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            22697..23020
FT                   /pseudo
FT                   /locus_tag="Bphy_0021"
FT   gene            23411..25324
FT                   /locus_tag="Bphy_0022"
FT   CDS_pept        23411..25324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0022"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   bmn:BMA10247_A2177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69217"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT0"
FT                   /protein_id="ACC69217.1"
FT                   /translation="MTKPHQPPADPELLEYYTRELMYTIALAQEFAAQHPKIAARLGMQ
FT                   AGEIGDPYVERLVQGASFMNARTQMRIDAAFPELMQPMLETVYPNYIRQTPSIGVARLY
FT                   PGHESGHLGQGFHIPRGTAFTSHTPAGENTSCVFRSSQDVTVYPLRIKVARVTLIPPDI
FT                   PSLGHYVADGQQVRGAVRLTLETTNGASIATLEELDRLPLYLAGDERIASHLFELIHAA
FT                   GIATVMAAPGRFADGPLYGVTRGAVVHEGIDLEQAVLPDVPRTLHGHGLLQEYFACPAR
FT                   FWFLALTGLAQGLKAIEGNAVEIVILLNRAPGVLADTVDASHFALFCTPVVNLFPMRTK
FT                   NLPIDREQSEHRLVPVPDAPADFDLRSVDAARGQVSEEDSEEVRFEPRDRPLGGGGSGE
FT                   GHYFALRRQLNLVQGGGRQYGTRRPFTETQTFISLVNSQGRPDDSGIRFLSLDAWLTNR
FT                   DLPSLLECNGLNDLTLAGSKPVVSVGFVRAPSAPKPPLARGDLAWQLMGQLKLDYQMFD
FT                   DRYSEPQPGEGVRRRLRLYVMPDAGALGRQVESLVSATATPVNEMLAGNGPIVFGRGIE
FT                   CEFTFDESGFDGVSPYTLALVLEHYVARHVSMHSFTTTVLHSKQRGLIAQWPPRMGTRE
FT                   VC"
FT   gene            25363..28020
FT                   /locus_tag="Bphy_0023"
FT   CDS_pept        25363..28020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0023"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bxe:Bxe_B2595
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69218"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT1"
FT                   /protein_id="ACC69218.1"
FT                   /translation="MSWLDQPRTLEIVSAGLPKWQDECLFTVSRLTGTEKLGRLYDYTV
FT                   EIATKDDIGLTVHEARAMVKVDELVGKQVTVKIATEGSGTYETGTIGVSPSINIGAGVR
FT                   EITGLIVSAECVGSDTRRAFYRLRIRPWLFLATLNQDSRIFQDLTVKEISETILKKYPF
FT                   HYELRLAGPGFGRQYPKRDYQRMYWESDWGYLNRLWQEWGITFFYDGPTLVLCDSTAAY
FT                   KKHGPAYATLQYQDRDGQRIDEEHVHQFEIARALTTGKVSVTDYDYTQSRANLAAKDSD
FT                   YRERANDNIEHYAWGDYSQPLAGAMGTAAQPNEVDFEGEHLARVRLEAKRAKSLRGKGR
FT                   GNMRGLRVGYTFHLEGYPLAPGNGEYLVVATKIEIVNNDTVTNRGALQRQYTCDTQFTV
FT                   QPANTYFRTPQKAKKPRSHGEVAIVTGYSDSKIWTDRYGRAKVWFPWDREGQQDQDSSC
FT                   WVRVSSPWQGANYGAIYIPRAGHEVVIGYQDNDPDKPYIAGRHVNQFHEPPWPLPANQA
FT                   LSGWLSEDLEGPTTNSVVTDDTPGKLQVQVASDHAQSRLVLGSNTRIDRHQGRSEARGE
FT                   GFELATEAHGVARANRGLLLTTETRAGAGAPVKDMGETVQRLTQARELHEDMAQFARRH
FT                   KAQDAQVSQGDATAGMKAQNDAIKGGAKSTANPSPEMTRPDLVLASAAGIAVTASDSTH
FT                   LHSQNDHAITAGRDVSIASGRSWLASVRGALSFVTGLGIRLFAAKGKVEIQAQSDAMAL
FT                   GALKDLTISSTNGRIIITAAKEIWIGAGGSYIQINGSGIVNGSPGPILEKTSKWSKSGV
FT                   DSMKMRLLAMPTSESGFDDRFQLIDQKTKTPLANVEYAIVRSDGAIEHGVTDEQGHTHL
FT                   LSQTATSESVAIYA"
FT   gene            28054..28971
FT                   /locus_tag="Bphy_0024"
FT   CDS_pept        28054..28971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69219"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT2"
FT                   /protein_id="ACC69219.1"
FT                   /translation="MCDFSSSEFESVVITSPSGRKLCRVSHRDTTVSSDQVAKKVLISD
FT                   KSVRLQITTEKTGFTLQKVYGHPNTSGNFQKFWDWQPAVVVPTYRANLTVYDPKKEDRV
FT                   VSQLDLTRDATYYLGRDSSGRDWCRNIAFEPQDANNNVYITDEVHFPPLADPIIKGYIL
FT                   MELEKNNKPSRSLHAEPVSMKNPYGPELTIRPLGNIAHDCLFHIGGFYEARISAGHAKW
FT                   LGGSEGCFAFIPKESVSKTENDAAKVAANTEFYSNKKWVSVTDSIDAHRKLDSKNRFFV
FT                   ELAKRSSFSRDSCVEIIKIARAFP"
FT   gene            29288..29647
FT                   /locus_tag="Bphy_0025"
FT   CDS_pept        29288..29647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69220"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT3"
FT                   /protein_id="ACC69220.1"
FT                   /translation="MTDFIRLGDTTDHGGKVNTESDRAWVVRANEPKGKKSMGKALVCN
FT                   GDETTTVGHVIAKASTMFDGERRIALDRGDLSQVSGRASDSRYGNGDGRGRACERTRRR
FT                   PGAVSMRGQSRQGES"
FT   gene            29667..30656
FT                   /locus_tag="Bphy_0026"
FT   CDS_pept        29667..30656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpn:lpg1269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69221"
FT                   /db_xref="InterPro:IPR025487"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT4"
FT                   /protein_id="ACC69221.1"
FT                   /translation="MSAPLTLDDMQRLAARHGGRCISTDYRNIHTELRWRCVRGHEWEA
FT                   TPFSVRQGKWCATCAHDEHSAVWLPAMHTLARERGGKCLSETYVNSRTKLWWECHQGHT
FT                   WEATPASIRVAGAWCPACAADSRKGTMNDMHALAARHRGHCLSTDYAGPTGKLRWRCAE
FT                   GHEWVTSPARVRNGFWCAICAKQGRRSSRLEDMHLLAASRGGKCLSDTYETSARLLRWE
FT                   CCRGHRWLAAPANIKGGTWCPKCARAERSNHTIGEMNEIARERGGRCLSDAYVNVTTKL
FT                   EWECARGYAWSTSPMAVLAGCWCPACKYLDQCVSDEARRKYLAVAGCP"
FT   gene            complement(30900..30975)
FT                   /locus_tag="Bphy_R0020"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(30900..30975)
FT                   /locus_tag="Bphy_R0020"
FT                   /product="tRNA-Lys"
FT   gene            31178..31582
FT                   /locus_tag="Bphy_0027"
FT   CDS_pept        31178..31582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0027"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bxe:Bxe_A4425 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69222"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT5"
FT                   /protein_id="ACC69222.1"
FT                   /translation="MDDNEVRELLDRVLAPWVRALSLTPVKVDDESATLRLPFSGELRH
FT                   SGGVICGQVFMAAADTAMVVAISAALGGFKPMTTVSLNISFMRAVRKGDVLIMARVLRM
FT                   GRNLVFGEVELIDEDGKMAVHATTTYALLN"
FT   gene            31634..32500
FT                   /locus_tag="Bphy_0028"
FT   CDS_pept        31634..32500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0028"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: bxe:Bxe_A4424 putative
FT                   patatin-like phospholipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69223"
FT                   /db_xref="GOA:B2JJT6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT6"
FT                   /protein_id="ACC69223.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVIQPELDIKPRVITGISAGAATA
FT                   CMLYTRDADWVMRYYENALRNNRKNAYWGNLLRGESVFPHYRIYRQALLDIYGEKFAQL
FT                   AKAPEIRIGVSHVPRWLGARGAVAAGLIAYNIEKYIRKTLHPTLGQSIGFRPEFVRAQD
FT                   CANVEELADLILQSSCTPPFTPVLRRNGRPVLDGGMVDNVPVGALDPTPGTVLVMVTRI
FT                   YPRPQMFVVPHGGQQRLYVQPSSKVPISSWDYTSPSQMLHAYNLGRTDGEQFLQRMPEL
FT                   LHAAARE"
FT   gene            complement(32555..33568)
FT                   /locus_tag="Bphy_0029"
FT   CDS_pept        complement(32555..33568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0029"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bxe:Bxe_A4423 putative
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69224"
FT                   /db_xref="GOA:B2JJT7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT7"
FT                   /protein_id="ACC69224.1"
FT                   /translation="MKIAILDDYQDAVRKLDCFQLLADHEVKVFNNTVRGLGQLASRLS
FT                   EVDALVLIRERTRISSQLLDKLPHLRMISQTGKAGSHIDMAACTDRGIAVLEGVGSPVA
FT                   PAELTWALIMAAQRRIPQYVANLKQGAWQQSGLKTSALPPNFGLGQVLRGQTLGIWGYG
FT                   KIGRMVAGYGKAFGMNVLVWGREHTREAAVADGYQVAQSREALFEDSDVLSLHLRLHDD
FT                   TRGIVKQDDLMRMKPTALFVNTSRAELLEENALMGALSHNRPGMVAIDVYESEPILQGY
FT                   SLLRMENVICSPHIGYVEKESYELYFSAAFKNILAFDQGDTASVANPEALQGGRRK"
FT   gene            33920..35776
FT                   /locus_tag="Bphy_0030"
FT   CDS_pept        33920..35776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0030"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   bxe:Bxe_A4422 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69225"
FT                   /db_xref="GOA:B2JJT8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJT8"
FT                   /protein_id="ACC69225.1"
FT                   /translation="MNHPAFAAHSTLEAPAWVKHKKLIEWVQRVAALAKPERIVWCDGS
FT                   QEEYDRLTAQMVAAGTLRRLNPAKRPNSYLACSDPSDVARVEDRTFICSQRREDAGPTN
FT                   NWIAPAEMRATLDGLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVSNMRIM
FT                   TRMGRKVYDVLGEDGEFVPCVHSVGAPLAAGQKDVAWPCNDTKYIVHFPESREIWSYGS
FT                   GYGGNALLGKKCFALRIASTMGRAEGWLAEHMLVLGVTSPEGKKHHVAAAFPSACGKTN
FT                   FAMLIPPQGMNGWKITTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTSEKTNFNAMA
FT                   TLKENVIFTNVALTDDGDVWWEGMTDEPPAHLIDWQGRDWTPAIAKETGRKAAHPNARF
FT                   TAPASQCPSIDADWENPAGVPIDAFVFGGRRSTTVPLVTEARDWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFAHWLKTGVKLEQMSVRTPKIFCVNWFRKGD
FT                   DGKFVWPGFGENMRVLRWMVDRIEGKAKGEEHAFGVSPRYDDLDWSGLDFTREQFEQVI
FT                   SVDDAAWRKELALHSELFDTLKQGLPVALQDTRSALEKKLTA"
FT   gene            36108..37196
FT                   /locus_tag="Bphy_0031"
FT   CDS_pept        36108..37196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0031"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4420 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69226"
FT                   /db_xref="GOA:B2JJT9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJT9"
FT                   /protein_id="ACC69226.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQTYAERYPKVIPDVTLVDRQVDLVEEGFDVGVVIARHMRSASIVTRRLTTGC
FT                   MTVCATPAYLDKHGTPTRPEQLLEHPCLSLPSEYWGDERVFTGPDGEVRVRPTNVIVAN
FT                   NTEMLRQFALLGMGIAILPSYLIGRDTTRGKLVRLLSDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFNQTPNSKLGEQWVKDGVERAPAMRESTAMSMAPEAFDGAEPLSSLLD
FT                   GDIPAKPTRTLNRSRGVASPTH"
FT   gene            complement(37341..40067)
FT                   /locus_tag="Bphy_0032"
FT   CDS_pept        complement(37341..40067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0032"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bxe:Bxe_A4419 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69227"
FT                   /db_xref="GOA:B2JJU0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU0"
FT                   /protein_id="ACC69227.1"
FT                   /translation="MGTKPGWENPRYRPESTNLFSVMSKALIIAEKPSVANDIARALGG
FT                   FTKHDEYFESDDFVLSSAVGHLLEIAAPEEYEVKRGKWSFANLPVIPPHFDLNPIAKSE
FT                   SRLKVLNKLIKRKDVDRLINACDAGREGELIFRLIAQHAKAKQPVQRLWLQSMTPAAIR
FT                   EGFAQLRTDAEMQPLADAARCRSEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPT
FT                   LSIVVEREEKIRRFVPRDYWEVKAEFVCASGFYEGRWYDPKFKKDEFDPEKRDSRLWSL
FT                   PAAETIVAACRGQTGNVTEESKPSTQLSPALFDLTSLQREANGRFGFSAKNTLGLAQAL
FT                   YEKHKVLTYPRTDARALPEDYLETVKHTMEMLKESNNYLPHAKQVLDKGWVKPNKRIFD
FT                   NSKISDHFAIIPTLQAPKALSEPEQKLYDLVVKRFLAVFFPAAEYRVTTRITEVVGHHF
FT                   KTEGKVLVEPGWLQVYGRETGGEDANLVPVQKDEKVKTDKIAAQQLVTKPPARYNEATL
FT                   LSAMEGAGKLVEDDELREAMAAKGLGTPATRAAIIEGLLGEKYLVREGRELIPTAKAFQ
FT                   LMTLLRGLDVKELTAPELTGEWEYKLSQMERGKLPRDAFMQEIARMTQTIVKRAKEYDS
FT                   DTIPGDYATLQTPCPNCGGQVKENYRRFACTKCEFSMSKIPGGRQFEIEEVEELLQKKQ
FT                   IGPLSGFRSKMGRPFSAILKLSFDDETKNFKLEFDFGQDQGGEDGEAPDFSEQQPVGAC
FT                   PKCSGKVFEHGMSYVCENSVANPKTCDFRSGKVILQQEIAREQMAKLLENGRTDLLTNF
FT                   KSSRTGRNFKAFLVKQNDGKIGFEFEKKEPKEGAAKTAAAKAAAKAAPESATGEAANEA
FT                   TPVKKAATKTAAAKKAPAKKAAAKTSAAKSAARKTGS"
FT   gene            complement(40305..40682)
FT                   /locus_tag="Bphy_0033"
FT   CDS_pept        complement(40305..40682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0033"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: bxe:Bxe_A4418
FT                   putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69228"
FT                   /db_xref="GOA:B2JJU1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU1"
FT                   /protein_id="ACC69228.1"
FT                   /translation="MPALNLDTDSKRIAERVSDRDTLFVACLCAEWCGTCREYRAAFDA
FT                   LADRHPDVCFAWIDIESHADRFDDLDVENFPTILIEDGITTRFFGTVLPQASIVERMLV
FT                   DLTAVPGIKGAPKMRPALLEA"
FT   gene            complement(40737..41906)
FT                   /locus_tag="Bphy_0034"
FT   CDS_pept        complement(40737..41906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0034"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: bxe:Bxe_A4417 smf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69229"
FT                   /db_xref="GOA:B2JJU2"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU2"
FT                   /protein_id="ACC69229.1"
FT                   /translation="MQTLPLTDTELAAWLRLAAAPGLNPAALRRLLVAFGLPEAVLSQT
FT                   FAAIAEATDQATAQAALAPPSADFAAQFDAVRAWRALPGNALVTLDDPAYPPSLLTMPD
FT                   PPPLLYVKGRMELLQAPSVAVVGSRSATPQGIEDASRFARALSDAGMTVVSGLAAGVDG
FT                   AAHRGALQGRGSTVAVIGTGADIVYPASHHALAHQIANHGAILSEWPLGTPARSANFPQ
FT                   RNRLIAGIVRGVLIVEAAMRSGSLITARLANEMGRDVFAIPGSIHAPLARGCHRMIKQG
FT                   AKLVETPEDILEDLGFPVPQTESVPRRCASPQTHSGDIDSRRENGPDLPDDARRLLDAL
FT                   GHSPTTLEILAERTDMDDTLLQSTLLRLELAGELCALPGGRYVRAVHSA"
FT   gene            42162..42665
FT                   /locus_tag="Bphy_0035"
FT   CDS_pept        42162..42665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0035"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: bxe:Bxe_A4416 formylmethionine deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69230"
FT                   /db_xref="GOA:B2JJU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU3"
FT                   /protein_id="ACC69230.1"
FT                   /translation="MALLNILNYPDKRLHKVAKPVEKVDDRIRKLVADMAETMYAAPGV
FT                   GLAATQVDVHERVIVIDVSDTHEELRAFINPEILWSSDERKIHEEGCLSVPGIYDNVER
FT                   AEKVRVRAMNEKGETFELDCEGLLAVCIQHEMDHLMGKVFVEYLSPLKQTRIKSKMKKL
FT                   AHAM"
FT   gene            42691..43674
FT                   /locus_tag="Bphy_0036"
FT   CDS_pept        42691..43674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0036"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: bxe:Bxe_A4415
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69231"
FT                   /db_xref="GOA:B2JJU4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJU4"
FT                   /protein_id="ACC69231.1"
FT                   /translation="MSHTLRVIFAGTPEFAAAALAAIHEAGFPVPLVLTQPDRPAGRGM
FT                   KLQASPVKRYAQEHGIEVAQPPSLRRNGKYPAQATAAIEQLRATPHDVMVVAAYGLLLP
FT                   QEVLDIAPHGCINIHASLLPRWRGAAPIHRAIEAGDAETGITLMQMDAGLDTGAMISEV
FT                   RTAIAGTDTTATLHDRLAEAGAKLIVDALVELERSGKLASIPQPAAGATYAEKIAKHEA
FT                   ALDWRRPAAELARQVRAFDPFPGGAATLDGAVLKLWSAAAVDASCKAEPGTIVEVSPEG
FT                   VVVACGDGALRITQLQKPGGKRLPVRDFLAGSTLAAGQRFELAQPQ"
FT   gene            43774..44418
FT                   /locus_tag="Bphy_0037"
FT   CDS_pept        43774..44418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0037"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_A4414 amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69232"
FT                   /db_xref="GOA:B2JJU5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU5"
FT                   /protein_id="ACC69232.1"
FT                   /translation="MFGITHFGFFVVAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHSLACAFGLTALLAASATAFTVIKFVGAMYLVYLGVRLILTKPESGQAAGE
FT                   ARACAGAPRSLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVSAGSGNKTVAFLTLGVVFV
FT                   VMSMAWNSFVAWIAGSVTRRFSGNPGVKKWVDRTVGSAFVGLGVRLATATR"
FT   gene            44522..45379
FT                   /locus_tag="Bphy_0038"
FT   CDS_pept        44522..45379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0038"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bte:BTH_I0131 heat
FT                   shock protein HtpX, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69233"
FT                   /db_xref="GOA:B2JJU6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJU6"
FT                   /protein_id="ACC69233.1"
FT                   /translation="MFNWVKTAMLMAAITALFIVIGGMIGGRSGMMFALLIALGMNFFS
FT                   YWFSDKMVLRMYNAQEVDETSAPQFYRMIRDLATRANLPMPRVYLIDEDQPNAFATGRN
FT                   PEHAAVAATTGILRVLSEREMRGVMAHELSHVKHRDILISTISATMAGAISALANFAMF
FT                   FGGRDENGRPANPIAGIAVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASA
FT                   LDKIHRYANGIPFPTAEAHPATAQMMIMNPLAGGGIANLFSTHPSTEERIARLMEMART
FT                   GRFE"
FT   sig_peptide     44522..44644
FT                   /locus_tag="Bphy_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.334 at
FT                   residue 41"
FT   gene            45662..47023
FT                   /locus_tag="Bphy_0039"
FT   CDS_pept        45662..47023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0039"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; KEGG: bxe:Bxe_A4412 Fmu, rRNA SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69234"
FT                   /db_xref="GOA:B2JJU7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU7"
FT                   /protein_id="ACC69234.1"
FT                   /translation="MLHLAPESLGFALDCAAQAVGAVRQGAALPAALHSIFVSLPEGVA
FT                   TASRGAVQDIAYRTMRRLGTAEWLVAKLVRKAPPPHVAHVLACALALLVDEASNAAYTP
FT                   FTVVDQAVNAIGARRESSFAKGLTNAVLRNFLRERETLLGDAQKDAVAHWNYPVWWIDA
FT                   VRNAWPDAWQDILTAGNNQGPLTLRVNARRATVDAYLQTLREHQISATQAGDQAVRLET
FT                   PMPVDRIPGFNEGVASVQDAGAQLAAQWLGVRDGMRVLDACAAPGGKTGHLLELADIDL
FT                   IALESDATRARRIGENLQRLGLSAHVRVGDAGSPEQWHDAADAPFDRILADVPCSASGI
FT                   VRRHPDIRWLRRASDIPVLVEEQRRILEALWTLVKPGGELLYVTCSIFPEEGELQAQWF
FT                   GNRHADAVRLDAPGQLLPAVARAPADVSAGSRAGQSTGSSLDHDGFFYARFQKR"
FT   gene            47020..47610
FT                   /locus_tag="Bphy_0040"
FT   CDS_pept        47020..47610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69235"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU8"
FT                   /protein_id="ACC69235.1"
FT                   /translation="MIIKRFLPLRLAAALWIALAFWLTAAGPARAESIAVQRASLQSDG
FT                   SGWSLDARFEFELNSNLEDAVNKGIPLYFTTDFELSRPRWYWFDEQPVSVSQSIRLSFQ
FT                   PLTREYRVSTGGLQLGFASLNEALAVIKHVTSWHVIDRNQVHVGETYNASVRMQLDIAL
FT                   MPKPFQIDAVNNRDWNLASDWKRFTFTVTERAK"
FT   sig_peptide     47020..47115
FT                   /locus_tag="Bphy_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            47612..50023
FT                   /locus_tag="Bphy_0041"
FT   CDS_pept        47612..50023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0041"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bxe:Bxe_A4410 multi-sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69236"
FT                   /db_xref="GOA:B2JJU9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJU9"
FT                   /protein_id="ACC69236.1"
FT                   /translation="MRRATSAGSLVVRLLVSTVAVTAVLLLVLLAAASANTEFFDRYYG
FT                   WLYAANVAVALIFMLIVAVLVVIIVTRLRKGKFGTRLLAKLAFFFALVGVVPGGIIYIV
FT                   SYQFVSRSIESWFDVNVETALTSGLNLGRGMLDASLSDLQTKGRLMAEQLASADSAGTT
FT                   LTLLRLRDQFGVQDATIVEPSRSISGATPDMHVVAQATSNYASLVPGDLPTSIMIEQAR
FT                   GRGFASIEGEVDGDPKARGAKGALRLRIVQRIPDANASQLQPTERFLQLTQPVSQSLAR
FT                   NADAVQRAYREYQEKAIGRTGLRKMYIGTLTLALFLATFIAMMLALALGNQLARPLFLL
FT                   AQGTKEVTEGDYTPKREIKSRDELGFLTQSFNAMTRQLSEARLAVEANRIALEHSKSYL
FT                   ESILANLTAGVFVFDRQFRLTTANRGAERIFRQPFVSLLGSPLDRIGVLSEFGPMVRKA
FT                   FADLEAAGGNDQGDTGHWQQQMALQVPGEADPLTLLARGARLVSAAGNDSDDEETSGYV
FT                   VVFDDISDVISAQRSIAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADKLMPSDAEVL
FT                   KRGATTIVNQVAAMKQMVDDFRDYARTPPAVLANLQLNELVSEVLTLYGIEEGKSAIVV
FT                   EMADLPVIRGDATQLRQVIHNLLQNAQDAVADVQHPRVLLETRTVEYGDPDADGKVSVA
FT                   VRLTVSDNGPGFPARILTRAFEPYVTTKAKGTGLGLAMVKKIVDEHGARIDIRNRLKAG
FT                   DVIEGAQISILFLQLADDKAAAPGSGPQAAHDSSGTSQGKTKATVQTRAA"
FT   sig_peptide     47612..47719
FT                   /locus_tag="Bphy_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.385 at
FT                   residue 36"
FT   gene            50024..50713
FT                   /locus_tag="Bphy_0042"
FT   CDS_pept        50024..50713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0042"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: bxe:Bxe_A4409 two component transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69237"
FT                   /db_xref="GOA:B2JJV0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV0"
FT                   /protein_id="ACC69237.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEVAENAQEARDYRQRLA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGTLTMPVIMMSGHATIDTAVEATKIGALNFLEKP
FT                   IALQKLLKAVEQGLARGSAAPAAGGMAAKPPMAANASAVASAAALPMMSADSLGGGMLS
FT                   AQTASISFDIPLRDARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVD
FT                   LGKNKGE"
FT   gene            50800..50875
FT                   /locus_tag="Bphy_R0021"
FT                   /note="tRNA-Phe1"
FT   tRNA            50800..50875
FT                   /locus_tag="Bphy_R0021"
FT                   /product="tRNA-Phe"
FT   gene            51253..51984
FT                   /locus_tag="Bphy_0043"
FT   CDS_pept        51253..51984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0043"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: bxe:Bxe_A4407 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69238"
FT                   /db_xref="GOA:B2JJV1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJV1"
FT                   /protein_id="ACC69238.1"
FT                   /translation="MTRKDAKSSALVLFSGGQDSATCLAWALDRYETVETLGFDYGQRH
FT                   RVELECREGFRSAVARTFPEWGERLGDDHMIDLSVLGSISETAMTREIEIHAASNGLPN
FT                   TFVPGRNLMFMTIAAAIAYRRGLRVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDS
FT                   RFVLETPLMWIDKADTWRLAHELGGDELVELIRVETHTCYLGERAELHAWGFGCGECPA
FT                   CRLRKRGYEAYLSGEQVTEPA"
FT   sig_peptide     51253..51330
FT                   /locus_tag="Bphy_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.403 at
FT                   residue 26"
FT   gene            52054..52686
FT                   /locus_tag="Bphy_0044"
FT   CDS_pept        52054..52686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0044"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bvi:Bcep1808_3202 organic radical activating enzyme-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69239"
FT                   /db_xref="GOA:B2JJV2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR030977"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV2"
FT                   /protein_id="ACC69239.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRADAV
FT                   CKFCDTDFVGTDGENGGKFRTPEELAAKIASLWPEGEDQRFVVCTGGEPMLQIDQPLVD
FT                   ALHAQGFEIAIETNGSLPVLDTIDWICVSPKAGAPLVQTKGNELKVVVPQDNQRLADYA
FT                   KLEFDYFLVQPMDGPSRDINTKLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   gene            52693..53139
FT                   /locus_tag="Bphy_0045"
FT   CDS_pept        52693..53139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0045"
FT                   /product="queuosine biosynthesis protein QueD"
FT                   /note="TIGRFAM: queuosine biosynthesis protein QueD; PFAM:
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein; KEGG: bxe:Bxe_A4405 putative 6-pyruvoyl
FT                   tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69240"
FT                   /db_xref="GOA:B2JJV3"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV3"
FT                   /protein_id="ACC69240.1"
FT                   /translation="MLTITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLQGDLVETE
FT                   GAPDRGMVMDFADVKALANEHLVDKWDHAFLVYEGDTQVRGFLETMAGHKTVVLDRIPT
FT                   VENLAAVAFDILANVYDAHYGVNLRLHKLRLYETPNCWADVVRD"
FT   gene            53327..54109
FT                   /locus_tag="Bphy_0046"
FT   CDS_pept        53327..54109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0046"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: bxe:Bxe_A4404
FT                   2-dehydro-3-deoxyglucarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69241"
FT                   /db_xref="GOA:B2JJV4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV4"
FT                   /protein_id="ACC69241.1"
FT                   /translation="MSTFTNPLKLRLKDPDPLFGLWLSLGSDNAAEALAHAGFDWLLID
FT                   MEHAPNDSVDVTGQLRAIAAAHLPTEPVVRLPAVEPWLVKRVLDAGARTLMFPNIETAD
FT                   EAAYAVRLTQYATSDAPEGLRGVASVVRAAAYGMRRDYLQNANAQIATIIQIESQQALE
FT                   NLEQIATTPGVDCLFVGPADLAASLGHLGDSRHPEVQEAMKHIQDVAHRARVATGIFAI
FT                   DVASARQYRSEGFRFIALAADVMWLLRTTRQALQEVRS"
FT   gene            54106..54816
FT                   /locus_tag="Bphy_0047"
FT   CDS_pept        54106..54816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0047"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bxe:Bxe_A4403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69242"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV5"
FT                   /protein_id="ACC69242.1"
FT                   /translation="MKQLSLYAMRMVTRAIVLTALTAGAVTNAQSKTPPAPDSETQTAV
FT                   ADYNAGNYTSALAEFRKAAQRGNRLAEFNYAMMLLNGEGGPANVEEGKKWLRKAADANM
FT                   SHAQYVYGKMYDDGEFVARDPVEAHQWFLKAAQQGHIQAELALANQFLDGRGTARDNQQ
FT                   AFVWYKKAAEGGDMTAQYVTGSFYERGGDGVAQNLNVARAYYAAAAAQGDPAARLKYQQ
FT                   LSTQLRESHEAKPQ"
FT   sig_peptide     54106..54201
FT                   /locus_tag="Bphy_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.706 at
FT                   residue 32"
FT   gene            complement(54875..56023)
FT                   /locus_tag="Bphy_0048"
FT   CDS_pept        complement(54875..56023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0048"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: bxe:Bxe_A4402 putative rod
FT                   shape-determining protein, RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69243"
FT                   /db_xref="GOA:B2JJV6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV6"
FT                   /protein_id="ACC69243.1"
FT                   /translation="MQIDKRAWLERFKKMFAGFDRPLALIVFLLLCVGIVTLYSASLDV
FT                   PGRVEDQLRNIILTFALMWVLANIPPTTLMRFAVPLYTFGVALLIAVALFGLTRKGAKR
FT                   WINVGVVIQPSEILKIATPLMLAWYYQRREGNIRWWDYIVGLLILAVPVGLIAKQPDLG
FT                   TAVLVFAAGFFVIYFAGLSFRLIVPVLVAGVIAVGAIATFQDKICQPEVQWPLMHDYQK
FT                   HRICTLLDPTSDPLGKGFHTIQAVIAIGSGGPLGKGWLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLVGGLVLLTLYMALIARGLYIAANGATLFGRLLAGSLTMAFFTYAFVNIGMVS
FT                   GILPVVGVPLPFMSYGGTALTTLGFAIGLIMSVARQKRLMQS"
FT   sig_peptide     complement(55901..56023)
FT                   /locus_tag="Bphy_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.772) with cleavage site probability 0.621 at
FT                   residue 41"
FT   gene            complement(56034..58436)
FT                   /locus_tag="Bphy_0049"
FT   CDS_pept        complement(56034..58436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0049"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: bxe:Bxe_A4401 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69244"
FT                   /db_xref="GOA:B2JJV7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV7"
FT                   /protein_id="ACC69244.1"
FT                   /translation="MTEFKDTQQQLTKFRLRVAAAGLFVFVCFGLIAFRFLFLQVWHYS
FT                   KYSLQANENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLNDTLDNVIDNLA
FT                   TVISIDARDRRRFRKLQEDSKNFESLPIRTRLTDDEVARFTAQRFRFPGVEVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISQRDQDRIDDASDQNDSDPDHYDPRLDANNYKGTDYIGKIGV
FT                   EQSYETELHGLTGFEEVEVTAGGRPVRTLSRTQATPGNNLVLSIDIGLQQVAEQAFAGR
FT                   RGALVAIEPSTGDVLAFVSAPSFDPNSFVDGIDQQTWDELNNSPDHPLLNRPLHGTYPP
FT                   GSTYKPFMALAALTLHKRTPQWGFQDPGSYTFGGHTFRNDVPQGQGWIDMNRAIMVSND
FT                   TYFYMLAHDLGVNAIANFMKPWGFGQITGIDIAGEARGILPSTDWKRKAYRKPEQQKWY
FT                   EGETISLGIGQGYNSYTILQLAHATATLANNGVLMKPHLVKEIENPITRALRATVPKDD
FT                   GRVDVKQSDIDVVKRGMENVTMNPSGTAYQVFRNAAYLSAGKTGTAQVFSLQGAKYHGH
FT                   ALAEHLRDHALFIAFAPADNPKIAIALIVENGGWGAQAAGPIARRVLDYYLVDKAKPGV
FT                   EAAAVTAAASATEETSAPVIGSAPTAPSGEVQPISVAAGFTPLPLPAGASAPRVAAASD
FT                   ASGAAAAGAASGAGPASAPAAASASTPRFASTAKSAKAPRAASGTAALSPAASDATAAA
FT                   PVKASDARKSPRKPRPASESRPVAAAPSRNEETQAAPRGPVSGGIDE"
FT   gene            complement(58558..59070)
FT                   /locus_tag="Bphy_0050"
FT   CDS_pept        complement(58558..59070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0050"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: bxe:Bxe_A4400 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69245"
FT                   /db_xref="GOA:B2JJV8"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV8"
FT                   /protein_id="ACC69245.1"
FT                   /translation="MNRPQYILQPVNPYFIAFSLAAAFLLNMMPWGRLIGVPDFVALVL
FT                   LFWNVHQPRKVGMGIAFTLGLLMDVHNASLLGEHALAYTLLSYGAITIHRRVLWMSIGV
FT                   QVFAVMPLLVVAQLVPFVIRLLTGASFPGWGYLIDGFVEAALWPIASILLLMPQRRPAD
FT                   PDDTRPI"
FT   gene            complement(59067..60170)
FT                   /locus_tag="Bphy_0051"
FT   CDS_pept        complement(59067..60170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0051"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: bxe:Bxe_A4399 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69246"
FT                   /db_xref="GOA:B2JJV9"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJV9"
FT                   /protein_id="ACC69246.1"
FT                   /translation="MEYSPPPLFKQGPSALARLIFFVVVALALLISDARFRTLEIVRGV
FT                   LGAGLYPLQRAALVPRDIFMGAADLAVTSATLRGENDKLRARNLQLSQQANEAAQLGAE
FT                   NTHLRNLLQLSQRMTTQSIPAEIQYDTRDPFTQKVVIGRGSQQGIKDGSPVVNEDGVIG
FT                   QVTRVFPLQSEVTLLTDKDQAVPVQIVRTGLRSVIYGTPKGDALDLRFVPISADVLAGD
FT                   ELVTSGLDGVYPPGLPVAKVMRVDKQADTAFARVVCQPIAPVRGARDLLVLHYEHNVPP
FT                   RPADEPDPATAAKEAKKKNAKTPDKGKDAKPASSPTAASAPAAAAAAPKPASSVKLTGK
FT                   ASTERKPAAEKGAKPQGSQGATQGAKQ"
FT   gene            complement(60289..61332)
FT                   /locus_tag="Bphy_0052"
FT   CDS_pept        complement(60289..61332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0052"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: bte:BTH_I0146 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69247"
FT                   /db_xref="GOA:B2JJW0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW0"
FT                   /protein_id="ACC69247.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            61712..62011
FT                   /locus_tag="Bphy_0053"
FT   CDS_pept        61712..62011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0053"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: bxe:Bxe_A4397 glutamyl-tRNA(Gln)
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69248"
FT                   /db_xref="GOA:B2JJW1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJW1"
FT                   /protein_id="ACC69248.1"
FT                   /translation="MALTLTDVKRIAHLARLELPDADAEHTLIQLNDFFGLVEQMQAVD
FT                   TTGISPLAHPIEQIEDVALRLRNDAVTENVNRDDYQRSAPAVQDGLYLVPKVIE"
FT   gene            62165..63658
FT                   /locus_tag="Bphy_0054"
FT   CDS_pept        62165..63658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0054"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: bxe:Bxe_A4396
FT                   glutamyl-tRNA(Gln) amidotransferase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69249"
FT                   /db_xref="GOA:B2JJW2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJW2"
FT                   /protein_id="ACC69249.1"
FT                   /translation="MHEKSLTELRAALDAKQCSAVELAQTYLKRIEDRKALNAFVHVDA
FT                   QQTLAQAQAADALIAAGNAGPLTGLPIAHKDVFVTRNWRSTAGSKMLENYTSPFDATVV
FT                   DRLAQAGMVCVGKTNMDEFAMGSSNENSYFGPVQNPWDRKAVPGGSSGGSAAAVAARLA
FT                   PAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQTAADCALL
FT                   LNAMGGFDERDSTSLTHDHEDYTRYLGQDWSGAGNARDKPLAGLRVGLPKEYFGAGLAD
FT                   DVRASIDAALKQYEALGATLVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRYGHRA
FT                   AEYRDLLDMYKKSRAEGFGPEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQEA
FT                   FRHCDVIMGPVAPSVAWDIGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANA
FT                   QRPVGLQIIGNYFNEARMLQVADAFQRATDWHRMAPAGV"
FT   gene            63660..65135
FT                   /locus_tag="Bphy_0055"
FT   CDS_pept        63660..65135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0055"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: bte:BTH_I0149 glutamyl-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69250"
FT                   /db_xref="GOA:B2JJW3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJW3"
FT                   /protein_id="ACC69250.1"
FT                   /translation="MATQWEVVIGLETHAQLSTVSKIFSGAATQFGAAPNTQACPVDLA
FT                   LPGVLPVMNKGAVERAIQFGLAIDATIAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQITIQVPANEKAGKEAYEKTINLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKALHGLVVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRAE
FT                   IKNLNSFRFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIDASWVERVKGELPELPAAMQKRFVDQYGLTPYDAGVVTAGKAMAAYYE
FT                   AVVAKVGAAQAKVAANWLMGEVSSQLNREGLDIADSPVSAAQLALVLQRIADGTISNKI
FT                   AKEIFLAIWEEKATDEAAADRIIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPQQVNELLKKKLG"
FT   gene            65270..66106
FT                   /locus_tag="Bphy_0056"
FT   CDS_pept        65270..66106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0056"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bxe:Bxe_A4394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69251"
FT                   /db_xref="GOA:B2JJW4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW4"
FT                   /protein_id="ACC69251.1"
FT                   /translation="MAKKNGLDEYRVPFFDEDGKSKFSLAGVDPSAKPFSTGSKDSDRE
FT                   RLAEIGAALDAQQERLHAQRVQRVLLVLQGMDTSGKDGTIRAVFHEVDPLGLRIVPFKA
FT                   PTLNELAHDFLWRVHSQAPAAGELTIFNRSHYEDVLVPYVLGTLSKDERDRRFGHIREF
FT                   ERMLADHGTTIIKCMLHISKDEQRERLQARIDDPTKHWKFDVSDLDARKLWDKYQAAYE
FT                   DALAATSTEYAPWHVVPANSKTHRNVMIGELLLRSFESLKLEFPPAKESLKGVIVE"
FT   gene            66149..66928
FT                   /locus_tag="Bphy_0057"
FT   CDS_pept        66149..66928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0057"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: bxe:Bxe_A4393 exodeoxyribonucleaseIII xth;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69252"
FT                   /db_xref="GOA:B2JJW5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW5"
FT                   /protein_id="ACC69252.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFDWFGEQKADVVCVQEIKCSQDDMT
FT                   PEFLAPHGFTGYFQHAVKKGYSGAGLYTRHEPDEVVIGFGSEEFDPEGRYVEARFGNLS
FT                   VISVYVPSGSSGDERQQAKYRFMDEFMPHLAELSREREVIVCGDVNIVHKEIDIKNWKG
FT                   NQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGVAATAKRVDVFRDIKFSDHAPVTVDYAHKLAK"
FT   gene            complement(66953..68167)
FT                   /locus_tag="Bphy_0058"
FT   CDS_pept        complement(66953..68167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0058"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_A4392
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69253"
FT                   /db_xref="GOA:B2JJW6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW6"
FT                   /protein_id="ACC69253.1"
FT                   /translation="MVFASRRAAIDRAWRAVSRRLPAYRMRVHARALHVAVLATCVGFG
FT                   VASPWQANAAEPTSNVSSPTSANAPASPSAPSVPSAPSAPSAPKSESAPTATSGASAQS
FT                   NTGSLTPQTPVTARPSAAPPVSPAISPTPFQPNQQLRYGGYAVFRNLIPSPMLEAQSAE
FT                   EFDQIARGAEHMNRLYSPSDPHVKRVQSIVDKLIPYSLKWNDRAKSWKWDVAVLRSPDI
FT                   RAYCLPGGKIVVYGGMLDKVKLSDNELGVLLGHEIAHALREHARERLGEQQAAQLGSGS
FT                   IPQLFGLADLGAAPLGIGTQLVEMKYERADETEADVIGSEIASRAGFDPRAAVTLWDKL
FT                   AVATRSNRDQGFIYVHPYNAERRADIMKRLADMLPLYAKAVGKTVDALPDYAGIGRPRR
FT                   TAVSD"
FT   sig_peptide     complement(68003..68167)
FT                   /locus_tag="Bphy_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.809 at
FT                   residue 55"
FT   gene            complement(68167..69561)
FT                   /locus_tag="Bphy_0059"
FT   CDS_pept        complement(68167..69561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0059"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4390 putative major facilitator superfamily
FT                   (MFS)muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69254"
FT                   /db_xref="GOA:B2JJW7"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW7"
FT                   /protein_id="ACC69254.1"
FT                   /translation="MSNPPHEAPALTAHEEHPGWRAFLNARMLICVFLGFTSGLPLFTL
FT                   VSLVQVWLRSEDVNLKEIGLFALIQFPYTWKFVWAPLMDRYVPRLPGWRPGRRRGWMLV
FT                   TQILVATAIASLGLVSPRDAIWTVAALTALVAFFGASQDIVIDAYRRELLHDAEQGLGN
FT                   AVHVNAYKIAALVPGSLALILSDHLPWSTVFMVTAAFMLPGMIMTLVVKEPEMHGAPPK
FT                   NLREAVIEPFHEFIVRDGWRGALFVLGFIFLYKLGDTMATTLSTSFFLDIGFTRTQIGV
FT                   IAKATAFTASLAGGIIGGVLLLRIGIARGLWIFGFLQMVSTLGFAWLASVGPASPGLSV
FT                   VYDIAVALSTATSNVLSLLGIDWTVKPDPMSVALAIVYGFETFTTGLTLAAFTAYIAST
FT                   TDPRYTATQFALFTSLAAVPRTLASAASGFLVTKIGWFDYFVVCTALAVPGMLLLFRIA
FT                   PWRKQS"
FT   gene            complement(69575..70183)
FT                   /locus_tag="Bphy_0060"
FT   CDS_pept        complement(69575..70183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0060"
FT                   /product="methionine biosynthesis protein MetW"
FT                   /note="TIGRFAM: methionine biosynthesis protein MetW; PFAM:
FT                   Methionine biosynthesis MetW protein; Methyltransferase
FT                   type 11; KEGG: bxe:Bxe_A4389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69255"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJW8"
FT                   /protein_id="ACC69255.1"
FT                   /translation="MNQRALDYLATRPDFRAIARWVEPRATVLDLGCGDGSLLSLLTEE
FT                   LEVSGYGIEINDAGVLASTKNGINVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAA
FT                   ILRETVRVGKECIVSFPNFGYWAHRLSVLQGRMPVSKSLPYQWHNTPNVRVLTIKDFEA
FT                   LAPEVGIEILDRVVLHGGQQVRWGVNWRGSLAVYRVKKS"
FT   gene            complement(70180..71325)
FT                   /locus_tag="Bphy_0061"
FT   CDS_pept        complement(70180..71325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0061"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: bxe:Bxe_A4388 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69256"
FT                   /db_xref="GOA:B2JJW9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJW9"
FT                   /protein_id="ACC69256.1"
FT                   /translation="MESIGIVSPQTMHFSEPLRLQNGSSLANYDLVVETYGKLNAARSN
FT                   AVLVCHALNASHHVAGVYADDPKNVGWWDNMVGPGKPLDTNRFFVIGVNNLGSCFGSTG
FT                   PMSIDPSTGRPYGASFPVVTVEDWVNAQARVADEFGIEKFAAVMGGSLGGMQALAWSMM
FT                   YPDRLEHCIVVASTPKLSAQNIAFNEVARSSILSDPDFHGGDYYAHGVKPKRGLRVARM
FT                   IGHITYLSDDDMAAKFGRALRRAEGAEKAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAYDGDLTAALAHTKAKYLIASFTTDWRFAPARSRELVKALLDHK
FT                   RQVTYGEIDAPHGHDAFLLDDARYHNLMRAYYERIAAEVNA"
FT   gene            complement(71569..72267)
FT                   /locus_tag="Bphy_0062"
FT   CDS_pept        complement(71569..72267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0062"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bps:BPSL0198
FT                   TetR family transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69257"
FT                   /db_xref="GOA:B2JJX0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX0"
FT                   /protein_id="ACC69257.1"
FT                   /translation="MQPIRKHDDVTEDQPAAPRATRLKPGERRVHILQTLAAMLEAPKN
FT                   EKITTAALAARLGVSEAALYRHFASKAQMFEGLIEFIEQTLFGLINQIIAKEPNGVLQA
FT                   RAIALTLLNFSAKNPGMTRVLTCEALVGEHERLTERVNQLLERVEASLKQCLRLGLMDA
FT                   SRQAGQAAPVAGTGHAESDTIPLPVDYDPVARASLLLSYIIGRWHRFVRSGFSRAPVEQ
FT                   ADAQLRLILQ"
FT   gene            complement(72304..73062)
FT                   /locus_tag="Bphy_0063"
FT   CDS_pept        complement(72304..73062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0063"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: bxe:Bxe_A4386
FT                   HAD-superfamily hydrolase, subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69258"
FT                   /db_xref="GOA:B2JJX1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX1"
FT                   /protein_id="ACC69258.1"
FT                   /translation="MMRPSRPKRRRPQIHAGTPVWLFDLDNTLHHASHAIFPAINAAMT
FT                   QYIVDTLQVERDEANRLRTGYTQRYGAALLGLTRHHPVDPHDFLKYVHTFPDLRAMLRS
FT                   ERGLKRLVDALPGRKIVLTNAPEVYAMDVLRELGIERLFERVIAIEHMRDRRLWRAKPD
FT                   HAMLRRAMRDAHVRLADAVLVEDTRSHLKNYRRLGIRTVWIVGHLPRTVRADGTRARLP
FT                   GTGRPHYVDRRIRSLKSLRLGNRPEGRSVP"
FT   gene            complement(73262..74161)
FT                   /locus_tag="Bphy_0064"
FT   CDS_pept        complement(73262..74161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0064"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: bxe:Bxe_A4385 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69259"
FT                   /db_xref="GOA:B2JJX2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJX2"
FT                   /protein_id="ACC69259.1"
FT                   /translation="MSESPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKLLMPDRDNPGQYIDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGTLLTDLSAREIDALFADGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   gene            74476..74751
FT                   /locus_tag="Bphy_0065"
FT   CDS_pept        74476..74751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69260"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX3"
FT                   /protein_id="ACC69260.1"
FT                   /translation="MFESSDRFHPAVMNPSPSESLETSVTSSVRCPLCRRVFDCGARGD
FT                   RSACWCASMPALPAEALEPGTGCLCPECLAGVIARSRAEEGGPAQG"
FT   gene            complement(74789..76426)
FT                   /locus_tag="Bphy_0066"
FT   CDS_pept        complement(74789..76426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0066"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bxe:Bxe_A4384
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69261"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX4"
FT                   /protein_id="ACC69261.1"
FT                   /translation="MLNTSLDPHQVLLDSFQTFLRHAVAAQDQNDGAARDIWLRAAAHL
FT                   FPMDAGSLAELNLQLLTGQHAVEAEAIARACAALAPRDPKTHFQLGLTLQLMNRHSDAI
FT                   APYREALAIDPDLPSLRNNLAAALMSANPASPEVAVLLTAAIERSPDDANAWINLAKSR
FT                   LAGFDLDGALEAEQRAILLQPDTPVALGNHGQTLREAQQWEDAERFTSAAHRAAPSNAS
FT                   FMSNLSMLHLLRGNYADGWLEHEARWDGSKELAGKRPVMPGPKWCGESLAGKTLLLWGE
FT                   QGMGDLLQFCRYVPLLAERVHRQGGRLAWNSFPQMGPLLARTLAQYADEFTLGGSVESL
FT                   PKFDYEISLLSLPLLFDTREETIPSTVPYLRADPQRVDAWREQLAGEKRLKVGLVWTGS
FT                   HGHQRNPYRRVGLERYVDYFRELDNAAFYSLQPGAGAEVAAARTAGLDIADHTAAFKTF
FT                   DDTAAYVSALDLVITVCTSVAHLSGALGQRTWVLLDVNPHWVWLLDRADSPWYPSATLY
FT                   RQAQFAQWEPVFDKLTRDLAALADSRRP"
FT   gene            76529..77833
FT                   /locus_tag="Bphy_0067"
FT   CDS_pept        76529..77833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0067"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bxe:Bxe_A4383
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69262"
FT                   /db_xref="GOA:B2JJX5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX5"
FT                   /protein_id="ACC69262.1"
FT                   /translation="MHRITITGRVNLGHLFWLRSLAIIGQLVTIAFVQIFVGVKLPLPA
FT                   MLLIIGLEVIFNGLTWLRVASQKPESNLELFGQLWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWRLMAWLAAFAVACYAVLGFESVPLNLDNPANLFDYYRAGMWVNFMV
FT                   SVGLIAWFVARMSRALRQRDTALGDAQQRLLRDERAVALGVQAATVAHEIGTPLSTIAM
FT                   LTEELRDAARSDEGLKPYAADLDILDQQMTLCTSALARLRSRASTQGSRQRVDEWLDSF
FT                   AGQWRLRHPHVKFERLGEPPAEVSLDDTVAVSQILTILLDNAARASRDHVTLAAKLVEP
FT                   ASIEFEVCDAGPGVPATLRGLLGAAPVDSTQGGHGVGLYLAFSAAARLGGSIELTDVNE
FT                   TKPRGTRAVLRLPLAREQTDAGRHGAASSNTEKQA"
FT   gene            77830..78372
FT                   /locus_tag="Bphy_0068"
FT   CDS_pept        77830..78372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0068"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: bxe:Bxe_A4382 two component transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69263"
FT                   /db_xref="GOA:B2JJX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX6"
FT                   /protein_id="ACC69263.1"
FT                   /translation="MSDKNFLVIDDDEVFSGILARGLTRRGFTVSEAHNADEAIRLANQ
FT                   QKFGQITVDLHLGNDSGLNLVAPLRDLQPDARMLVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVETILSALQTEASALQAEEAIENPTPLSVARLEWEHIQRVLAENGGNISATARALN
FT                   MHRRTLQRKLAKRPVKQ"
FT   gene            complement(78455..79798)
FT                   /locus_tag="Bphy_0069"
FT   CDS_pept        complement(78455..79798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0069"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: bxe:Bxe_A4381 heat shock protein HslU;
FT                   TIGRFAM: heat shock protein HslVU, ATPase subunit HslU;
FT                   PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69264"
FT                   /db_xref="GOA:B2JJX7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJX7"
FT                   /protein_id="ACC69264.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQNRAKKAVAVALRNRWRRQQVDEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKMRTKAEDLAEDRILDILLPGARTVGFGSGTSEASGDESNTTRQTF
FT                   RKRLREGALDDKEIELDIEMQAPAMDIMGPPGMEDMTEQIRSMFANLGGGKKTRRKVKV
FT                   KEALKLLTDEEASKMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRSEAGGGEVSRQGV
FT                   QRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSLS
FT                   VKDFESILVATDASLVKQYQALLATEDVHLEFADDGIRRLAEIAFSVNEKTENIGARRL
FT                   YTVIEKLLEEVSFSAGNHTGKSVLIDAAYVDRALNDVAQDEDLSRYVL"
FT   gene            complement(79808..80344)
FT                   /locus_tag="Bphy_0070"
FT   CDS_pept        complement(79808..80344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0070"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   bvi:Bcep1808_3174 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69265"
FT                   /db_xref="GOA:B2JJX8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJX8"
FT                   /protein_id="ACC69265.1"
FT                   /translation="MEQFHGTTIVSVRRGDKVALGGDGQVTLGNIVMKGGAKKVRRIYN
FT                   NKVLVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLITA
FT                   DATTTLVITGNGDVLDPEGGICAIGSGGAYAQAAAKALADNTDLSPREIVEKSLEIAGD
FT                   MCIYTNHNRVIETIE"
FT   gene            complement(80718..81137)
FT                   /locus_tag="Bphy_0071"
FT   CDS_pept        complement(80718..81137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0071"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger DksA/TraR C4-type; KEGG: bxe:Bxe_A4379
FT                   transcriptional regulators, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69266"
FT                   /db_xref="GOA:B2JJX9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJX9"
FT                   /protein_id="ACC69266.1"
FT                   /translation="MTTKRLLTEAEILKMSDKDYMNEDQLAFFKNRLEQLQADILRNAG
FT                   QTTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSIARIESGEYGWCEE
FT                   TGEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            complement(81752..82840)
FT                   /locus_tag="Bphy_0072"
FT   CDS_pept        complement(81752..82840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0072"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bxe:Bxe_A4377
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69267"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY0"
FT                   /protein_id="ACC69267.1"
FT                   /translation="MANNMIPVTILTGFLGSGKTTLLKRILNEKHGMKIAVIENEFGEE
FT                   NIDNDILVQDTGEQIIQMSNGCICCTIRGDLARVLGDLAAQKQEGKLDFDRVVIETTGL
FT                   ANPGPVAQTFFMDNQIADEFLLDAIITLVDAKHGNHQLDEHEVVQRQVGFADRLFITKS
FT                   DLVDEAVLGDLRHRLLHMNPKAQIRVVNFGEADIKEIFDLRGFNLNAKLEIDPDFLAED
FT                   EHDHAHHHHDHDHDHDHANCNHDHGQCDHEGHDHGHHHAHHDDKIKSFVFRSDRPFDPN
FT                   KLEDFLGGILQIYGERLLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWQPIEKKTNK
FT                   MVFIGIELPQDLITDGLEACLV"
FT   gene            complement(83006..84208)
FT                   /locus_tag="Bphy_0073"
FT   CDS_pept        complement(83006..84208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0073"
FT                   /product="PUA domain containing protein"
FT                   /note="SMART: PUA domain containing protein; KEGG:
FT                   bxe:Bxe_A4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69268"
FT                   /db_xref="GOA:B2JJY1"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY1"
FT                   /protein_id="ACC69268.1"
FT                   /translation="MNTVTLKPSKEKSLLRRHPWVYANAIERVDGKPAAGATVLVRAHD
FT                   GRFLARAAYSPHSQIRARVWSFDESEPVDHAFFKRRVQRALEHRQTMVHNTGATRLIFG
FT                   EADGLPGLIVDYYIQDDATKRGQLVCQFMAAGVEAWKDAIVQALMGATGCPNVYERSDV
FT                   SIREKEGLDQTVGVLAGDAPPETLIASENGVRYHVDVRDGHKTGFYVDQRDNRALVQEL
FT                   SKDRDVLNCFCYTGGFSLAALKGGARRVVSIDSSGEALALAQQNVTANGFEPARATWLD
FT                   ADAFKTLRRLYEEGERFDLIVLDPPKFAPSREHVDRAARAYKDINLTGLKLLRPGGLLF
FT                   TYSCSGAIDAELFQKIVAGAAADARVDARILRRLGAGVDHPLLTAFPEGEYLKGLLLQI
FT                   A"
FT   gene            complement(84294..85217)
FT                   /locus_tag="Bphy_0074"
FT   CDS_pept        complement(84294..85217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0074"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: bxe:Bxe_A4375 putative
FT                   integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69269"
FT                   /db_xref="GOA:B2JJY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY2"
FT                   /protein_id="ACC69269.1"
FT                   /translation="MTSADPIATYLSSLEHERRLSAHTLRAYTHELGELKTLANGRPLE
FT                   SLTATDIRGAVARAHAGGLSARSIGHRLSAWRAFYRWLAGRVDLPANPVATVRAPKRAK
FT                   TLPKALSVDDTHKLMETPATATAEGLRDHAMLELFYSSGLRLSELVGLDAQYADADGYR
FT                   SQGWLKLDDAEVEVLGKGNRRRVVPVGSKALEALRAWLAVRGELVKHDPHPLFVSVRGN
FT                   RMSPNVVRDRVKRAALTAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASIAAT
FT                   QVYTGLDFQHLARIYDQAHPRAKKRD"
FT   gene            complement(85228..85947)
FT                   /locus_tag="Bphy_0075"
FT   CDS_pept        complement(85228..85947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0075"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   bxe:Bxe_A4374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69270"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY3"
FT                   /protein_id="ACC69270.1"
FT                   /translation="MNDREVADYLLANPEFFAEHAELLASVRLANPHGKAAVSLQERQM
FT                   DMLREKNKHLERRLAELLRYGHENDSIASKFGRWTTRVMAERDPGALPRTISTGLRDVF
FT                   DVPQAALRVWDVSEPYSHADFTRHVGEEVRIFANSLATPYCGANTGFEAAQWLTPAVSA
FT                   VAGDAAGSAEGAAANGTESIALIALRDPEASDNACAFGLLVMGSPDARRFHDGMATDFL
FT                   TQIGALASAALSRLLPR"
FT   gene            complement(86034..86894)
FT                   /locus_tag="Bphy_0076"
FT   CDS_pept        complement(86034..86894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0076"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: bxe:Bxe_A4373
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69271"
FT                   /db_xref="GOA:B2JJY4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJY4"
FT                   /protein_id="ACC69271.1"
FT                   /translation="MKLKFTKMHGAGNDFVVLDGYTQPLNLTETQVRALANRHFGVGAD
FT                   QLLVVEKPTVDGVDFRYRIFNCDGGEVEHCGNGARCFVKFVRDSRLTDKRSVRVQVQKG
FT                   VITLTMQDNGEVVVDMGAPVFEPVQVPFDASGVEARREGNDTLYALEVNGETRWVSVVS
FT                   MGNPHAVQVVDDVEAFPVLVDGPVIETHPRFPQRVNAGFMQIVGRSEVKLRVYERGAGE
FT                   TLACGTGACAAVAAGIRRGLLDAPVKVHTHGGTLTITWNGESASSLMMAGPAATVFEGE
FT                   IELAD"
FT   gene            complement(86949..87833)
FT                   /locus_tag="Bphy_0077"
FT   CDS_pept        complement(86949..87833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0077"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   bxe:Bxe_A4372 putative lipid A biosynthesis
FT                   lauroylacyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69272"
FT                   /db_xref="GOA:B2JJY5"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY5"
FT                   /protein_id="ACC69272.1"
FT                   /translation="MLSRLGVTLAIGLLKLFALLPYGFVARLGDGLGWLLYQIPSRRRR
FT                   IVHINLKLCFPEWSDERREEVAQKHFRHAIRSYLERSVQWFGSAKKLEKLIQLDSEIDL
FT                   TDPNLPPTLFLGFHFVGIEAGSIFLNYSLKRPCGSLYQPMSNPQLEEVAKAQRGRFDAE
FT                   MASRADSARIVLRWLRERKPVMLGADMDYGMRNSTFVPFFGVPTCTLTAVGRLAKVGRA
FT                   QVVPFIGEVLPNYQGYRLRVFKPWDNYPTGDDDVDARRMNAFLEEQIPHIPEQYYWVHK
FT                   RFKTRPPGDPSFY"
FT   gene            88106..89293
FT                   /locus_tag="Bphy_0078"
FT   CDS_pept        88106..89293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0078"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   bxe:Bxe_A4371 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69273"
FT                   /db_xref="GOA:B2JJY6"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JJY6"
FT                   /protein_id="ACC69273.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQVARETIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACDETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTIRYVDGKPHSIDTVVLSTQHSPDIDLGQLREAVIEEIIKPTLPAELIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRALIQVSYAIGVAQPTSVMVNTFGTGRVSDATITRLVQEHFDLR
FT                   PKGIIQMLDLLRPVYEKTAAYGHFGREEPEFSWEATDKALALAEAAGTEPVAALA"
FT   gene            complement(89507..89803)
FT                   /locus_tag="Bphy_0079"
FT   CDS_pept        complement(89507..89803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69274"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY7"
FT                   /protein_id="ACC69274.1"
FT                   /translation="MVRALRHHSARTRALAGQLREAKPVDSVRFWFRAFFSALRVQGAT
FT                   PRLALRTLLRTPSPVRMLGVSPRAAKQANVPHPTSRRPRRLSATSAGWFAFAR"
FT   gene            90294..91055
FT                   /locus_tag="Bphy_0080"
FT   CDS_pept        90294..91055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0080"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: bxe:Bxe_A4369
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69275"
FT                   /db_xref="GOA:B2JJY8"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY8"
FT                   /protein_id="ACC69275.1"
FT                   /translation="MSVHSKKEQIQVLREQGFVVVPSLVTPERCDEMKQIARQQLQIAA
FT                   DPVEFEADLRYPGAPESKEAPGGHTVRRLLDAYARHPRFAEWGTAPEIRGWMELYFGEE
FT                   PRLSRAHHNCMMTKHPAYGSLTGWHRDVRYWSFERDDLVSVWLALGDEIVDNGALWFVP
FT                   GSHAAAFTSDRFDEAKFFRSDVPENAALIQKAVSPALKAGDVVFFHCNTLHSAGKNLSE
FT                   QVKFSLVFTYHGASNVPLPGSRSASKPEVAF"
FT   gene            complement(91100..91300)
FT                   /locus_tag="Bphy_0081"
FT   CDS_pept        complement(91100..91300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69276"
FT                   /db_xref="GOA:B2JJY9"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJY9"
FT                   /protein_id="ACC69276.1"
FT                   /translation="MTKAISLALIAGGVVLLYFGGQSFHSFSDDVSRVFTGSPTSKTIF
FT                   LIAGGIVATLAGLIGLASNRR"
FT   sig_peptide     complement(91214..91300)
FT                   /locus_tag="Bphy_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.963 at
FT                   residue 29"
FT   gene            91610..92653
FT                   /locus_tag="Bphy_0082"
FT   CDS_pept        91610..92653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0082"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_A4367
FT                   putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69277"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ0"
FT                   /protein_id="ACC69277.1"
FT                   /translation="MAYEAASARYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   RDILRTSFDLGITHFDLANNYGPPYGSAETNFGRIFKDDFRPYRDELLISSKAGWDMWP
FT                   GPYGQGGGSRKYILASLDQSLQRMGLDYVDIFYSHRFDVDTPLEETAGALASAVQQGKA
FT                   LYIGISSYSAQKTREMAKLLAEYKVPLLIHQPAYNMLNRWIESELLNALEETGSGAIAF
FT                   TPLAQGLLTGKYLNGVPQDARVNKAGGGSLKQEHLSEQNIERVRKLNDIAQRRGQSLAQ
FT                   MALAWTLRDSRVTSALIGASKAEQVRENVAALKNLSFTAEELAEIDRYATEGSVNLWEK
FT                   PSTDQHI"
FT   gene            complement(92765..92947)
FT                   /locus_tag="Bphy_0083"
FT   CDS_pept        complement(92765..92947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69278"
FT                   /db_xref="GOA:B2JJZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ1"
FT                   /protein_id="ACC69278.1"
FT                   /translation="MHYFTIGDFILVIPMALAGALFLGALPCKTEFRHNTLRVLGALLG
FT                   VVFAVVLVEGLPALV"
FT   gene            complement(93217..94488)
FT                   /locus_tag="Bphy_0084"
FT   CDS_pept        complement(93217..94488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0084"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4365 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69279"
FT                   /db_xref="GOA:B2JJZ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ2"
FT                   /protein_id="ACC69279.1"
FT                   /translation="MTASSDPSRPADSSSFASSSPSPSGAPYLERGTRAYWRASLALLF
FT                   AGYATFSLLYCVQPLLPAFSASFNVSPAQSSLSLSLTTAALALAVFVAGFVSEGWSRHR
FT                   LMTASLTASSLLTLAVAVTPQWHALLLLRALEGLALGGVPAVAMAYLAEEVHPEGLGLA
FT                   MGLYVGGTAIGGMAGRVITGVVADLFSWRAAIGTIGVLGILSMLAFRSLLPPSRHFVPR
FT                   RGLGFAHHRSALAGHFGRSGLPLLFLMGFVLMGSFVTLYNYIGYRLLAPPFGLSQTAIG
FT                   GIFVVYLTGVVASPWSGRMADTFGRGRVLTGSIVIMLCGLLLTTTQSLSLIACGIACVT
FT                   FGFFAGHAVASGWVGRIAKEAKGQAAALYLLAYYLGSSIVGSYGGRVWAAYTWTGVAAL
FT                   VGALLLLGIIASTRLWARERIGAA"
FT   gene            complement(94454..95173)
FT                   /locus_tag="Bphy_0085"
FT   CDS_pept        complement(94454..95173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4362 cation/multidrug efflux pump,
FT                   AcrB/AcrD/AcrF family, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69280"
FT                   /db_xref="GOA:B2JJZ3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ3"
FT                   /protein_id="ACC69280.1"
FT                   /translation="MPTLRLSLSSPSLTAHELYDYGYNLLPKTQLASGPRASTREIVDG
FT                   IRIMMPALHNLLPDSRVAHYLFIPLAEAVVFAISRRPSRGRTPVPTLAKYPLHNHRRPA
FT                   DFHHSQVARNPFMQVHLAFERSFESVRTRYRAFLAARVARPRISLPADEPLTHPEEAGQ
FT                   PASAPASMRDERRLSTHRGRSGPRLAAELDDVRRAMGVSLSPCASVSVARFAATFATPH
FT                   HFREFCCDRIVGPESAR"
FT   gene            95551..95763
FT                   /locus_tag="Bphy_0086"
FT   CDS_pept        95551..95763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69281"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ4"
FT                   /protein_id="ACC69281.1"
FT                   /translation="MQVGSIVRSVHIAVPQGARGIVMRILGDMAMVAWYAGEPGTSKML
FT                   NTEPFFLEDLIDTGEFVRPAGAQVH"
FT   gene            95889..96911
FT                   /locus_tag="Bphy_0087"
FT   CDS_pept        95889..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0087"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bxe:Bxe_A4360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69282"
FT                   /db_xref="GOA:B2JJZ5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ5"
FT                   /protein_id="ACC69282.1"
FT                   /translation="MNEDTPISQDGHAVPFARLAPEVVLDALDSVLDTVGVRTDGRMLP
FT                   LNSYENRVYQVGVEDGPPVVAKFYRPERWTDQAILEEHAFVAELAAREIPAVPARTFNG
FT                   ATLHTFDGFRFSVFERRGGRAPDLDRKDTLEWLGRFIGRIHAVGQTANYAARPTLEIHT
FT                   FGYEPRDYLLAQDFIPADVRTAWEAAVNLALEGVEQAFERAGDVRQIRMHGDCHPSNVL
FT                   WTDAGPHFVDFDDSRMGPAIQDLWLLLPGERQEASRALTDLLAGYEDFCEFDQRELHLI
FT                   EALRTLRLIHYSAWLARRWDDPAFPVAFPWFNTQRYWEDRILELREQIGAMQEGPLWPV
FT                   "
FT   gene            97214..97378
FT                   /locus_tag="Bphy_0088"
FT   CDS_pept        97214..97378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69283"
FT                   /db_xref="GOA:B2JJZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ6"
FT                   /protein_id="ACC69283.1"
FT                   /translation="MSVGWVLLIDTIAGSLILLSLTGVLLWTELNRRRTAGAVLIARSI
FT                   VAAVACGLM"
FT   gene            complement(97489..98517)
FT                   /locus_tag="Bphy_0089"
FT   CDS_pept        complement(97489..98517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0089"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   bxe:Bxe_A4357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69284"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ7"
FT                   /protein_id="ACC69284.1"
FT                   /translation="MDSVDLEVLKTSARWLEQGHRALLVTVVKTWGSSPRPEGAMLVVR
FT                   DDGAVVGSVSGGCIEDDLIDRVRQAGIEQARPEAVKYGITAEEAHRFGLPCGGTIQLVL
FT                   EPLTKASGIAELCEAVENGRLVARTLDMQTGVARLGPAQATDGVDFDDKRLLTIHGPRY
FT                   RMLVIGAGQLSRYLCNIAVGLDYQVTVCDPREEYTDEWDVPGTKVVRTMPDDTVLDMKL
FT                   DERCAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNAARRERLKEFDLTEAQLAR
FT                   LHGPVGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTLLQVEGAKAAREIAAGGGAACRI
FT                   PE"
FT   gene            complement(98490..99071)
FT                   /locus_tag="Bphy_0090"
FT   CDS_pept        complement(98490..99071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0090"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   bxe:Bxe_A4356 putative carbon monoxide dehydrogenase, CoxG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69285"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ8"
FT                   /protein_id="ACC69285.1"
FT                   /translation="MELTETYTLPVPQQRAWEALNDTEVLRASIPGCDSIEPDGDNAYA
FT                   VALSAAVGPVKARFKGRMELTDIDAPNTYTIVFEGQGGAAGFGKGQTHVKLEPDGDEAT
FT                   KLTYTANAQVGGKLAQIGSRLVDGAARKLAGEFFRRFTEQVSGGGDTAQAEIADSGDTA
FT                   SQSAGGESAGEGGGEEPKRKKSWTAWISKS"
FT   gene            complement(99062..100297)
FT                   /locus_tag="Bphy_0091"
FT   CDS_pept        complement(99062..100297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0091"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor type A; KEGG: bxe:Bxe_A4355 putative
FT                   carbon monoxide dehydrogenase, CoxE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69286"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2JJZ9"
FT                   /protein_id="ACC69286.1"
FT                   /translation="MFPVHDTGPATLARNVVHFVRLLRGAGLPMSPAQAVDALDALRWI
FT                   DLDRRDDVRAALAALLVRAPDERDLFNAAFDLFWRDPDWEGKLRALLLPKVTSGVPPPK
FT                   RNNRLADALAESKQRKPVAQPGDNDKHELHAHVTFSAEERLRHRDFDTLTADEWRTLRH
FT                   LIRGQRLPLAMEPTRRLKAASHGTHADLRASARHAVRAGGDWTVWKYRAVVARKPPLVL
FT                   LLDISGSMSSYSRAVLYFCHALLQSRERLQVFLFGTRLTNATRALKERDPDVAIAALAD
FT                   QVLDWSGGTRIGAALAEFNRRWARRVLTGRATVLLVTDGLDHEAIDVLETEMARLRRFA
FT                   HRIVWLNPLLRYREFSPKARGVQAMLPFVDAHKPVHNLDSLAAFGRDLAQLTRVPRDAA
FT                   RTAISGGATSWS"
FT   gene            complement(100303..101193)
FT                   /locus_tag="Bphy_0092"
FT   CDS_pept        complement(100303..101193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0092"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: bxe:Bxe_A4354
FT                   putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69287"
FT                   /db_xref="GOA:B2JK00"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK00"
FT                   /protein_id="ACC69287.1"
FT                   /translation="MQPASIDDTLAQLTAQGYFASRELATALFLALRMERPLFVDGEPG
FT                   VGKTELAKAAAGLLGTSLLRLQCYEGLDTASALYEWDYPRQIMALRLAEAAGEKPDSST
FT                   LYRSEFLLKRPLLQALLPDDHHPGARRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEF
FT                   GTVRAEHPPLVVMTSNRTREVHDALKRRCLYQWIGYPERERELAIVAARAPETGEALQR
FT                   RAVDFVHRLRGMDLFKAPGIAETIDWCRALAALSVTELDPQSVQDTLGVLLKYQDDLAR
FT                   FDAEQIRQCLAAAAE"
FT   gene            complement(101327..102124)
FT                   /locus_tag="Bphy_0093"
FT   CDS_pept        complement(101327..102124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0093"
FT                   /product="Carbon-monoxide dehydrogenase (acceptor)"
FT                   /EC_number="1.2.7.4"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   bxe:Bxe_A4353 putative carbon monoxide dehydrogenase,
FT                   medium subunit (CoxM)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69288"
FT                   /db_xref="GOA:B2JK01"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK01"
FT                   /protein_id="ACC69288.1"
FT                   /translation="MYSFDYQRAADPQSAVDGLAADSEAKFLAGGQSLLPTMRLRLAQP
FT                   SKLIDITRIPQLKEIRVEPQKVTVGAAVCHADVANSADVQRVLPALAFLAAHIGDPQVR
FT                   SLGTIGGSIANNDPAADYPAAVLGLDGTVVTDRRRLDAADFFVGMYETALQPDELIVAV
FT                   EFLVPEKAAYEKFRNPASHFALTGVFVAKTASGVRVAITGAAPSVFRATDMENALNADF
FT                   TEAAARGVTIAPDDLNTDMHASADYRAHLIPVLTARAVRAANG"
FT   gene            complement(102137..104524)
FT                   /locus_tag="Bphy_0094"
FT   CDS_pept        complement(102137..104524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0094"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bxe:Bxe_A4352 carbon-monoxide
FT                   dehydrogenase form II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69289"
FT                   /db_xref="GOA:B2JK02"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK02"
FT                   /protein_id="ACC69289.1"
FT                   /translation="MNAPDSHRMVGMPVKRKEDYRFLTGNGQYTDDIVLPAQTYAVFLR
FT                   SPHAHARIKNIDTSAAKQSPGVVAVFTGADLAAENVGGLPCGWLIHSVDGKPMSEPPHP
FT                   VIAHTKVRHVGDQVALVIADSVKAAKDAAELIEVDYEELPAVIDTAHAADAGQPAVHDE
FT                   VPDNTCYTWGHGDKAATDAAFANAHHVTTLDIVNNRLIPNAIEPRAVNASYSPQDDSYT
FT                   VYVANQNPHVERLLMAAFVLSLPESKVRVVAPDVGGGFGSKIFLYAEDVALTWASKKIR
FT                   RPVKWTAERSEAFLSDAHGRDHVTKAELAMDANGKFLALRVHTIANMGAYLSTFASSVP
FT                   TILYATLLAGQYATPAIYAEVKAVFTNTVPVDAYRGAGRPEATYVVERLVETAAREMNM
FT                   DPAAIRRLNFIRSFPYATPVGLTYDTGDYEACLSRALELADVKGFAARRQESEKNGKRR
FT                   GLGYSCYIEACGLAPSNIAGALGARAGLFEAGEVRVHPTGSVTVFTGSHSHGQGHETTF
FT                   AQVVSDRLGVPLDNIEIVHGDTGRIPFGMGTYGSRSIAVGGSAIMKALDKIESKAKKIA
FT                   AHLLEASADDIEFKDGTFRVAGTDRTKTFADVSLAAYVPHNYPLDKLEPGLDESAFYDP
FT                   TNFTYPAGAYICEVEVDVDTGETRIERFTAVDDFGNVINPMIVEGQVHGGLGQGIGQAM
FT                   LERCVYDNESGQLLSGSYMDYAMPHASDLPSFTVETAKGTPCTHNPLGVKGCGEAGAIG
FT                   SPPAVINAIVDALAPLGVKDLQMPATPHRVWSAIHAAQHSRP"
FT   gene            complement(104536..105036)
FT                   /locus_tag="Bphy_0095"
FT   CDS_pept        complement(104536..105036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0095"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_A4351 putative carbon-monoxide dehydrogenase,
FT                   small subunit (CoxS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69290"
FT                   /db_xref="GOA:B2JK03"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK03"
FT                   /protein_id="ACC69290.1"
FT                   /translation="MAISISLTVNGSPVTANVEPHTLLVQFLREQLRLTGTHVGCDTAQ
FT                   CGACTIHLNGRAIKSCNMLAVQAEGQEVTTIEGLSKDGELHPMQAAFRECHGLQCGFCT
FT                   PGMVMSATALVATNPNLTEDEVRDQLDGNLCRCTGYHNIVKAVVQGAQGMKAGASSKAA
FT                   ATA"
FT   gene            complement(105421..106821)
FT                   /locus_tag="Bphy_0096"
FT   CDS_pept        complement(105421..106821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0096"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bxe:Bxe_A4348 basic amino acid transporter, CAT family, APC
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69291"
FT                   /db_xref="GOA:B2JK04"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK04"
FT                   /protein_id="ACC69291.1"
FT                   /translation="MSLFRKKNVEHMIAGAQAAGLKKALGALDLTFLGVGAIIGTGIFV
FT                   LTGTGAVQAGPALMLSFIIAAIACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAWI
FT                   IGWDLMLEYGLATSAVSVGWSGYLQSLLSGFGVSLPVALTAAPGALPGHETLFNLPAFL
FT                   VMMAITTLLSVGVRESTRVNNLMVAIKVTVVLLVIAVGVFHVKPANWHPFMPNGMSGVF
FT                   GAAAVMFFAFIGFDSVSSAAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPSA
FT                   QFANVSHPVSYALQVAGQNWVAGFIDLGAVLGMLTVILVMAYGQTRVMFAMSRDGLLPA
FT                   ALSKVHPRFATPFATTWLVGIVFGLIGALVPLNVLAELINIGTLAAFSMVSIAVLVLRR
FT                   THPDLPRAFRCPGVPVVPVLAVASCLFLMANLSTVTWTAFVIWLLVGMVVYFGYSRRHS
FT                   KLAHSGRS"
FT   gene            complement(106959..107615)
FT                   /locus_tag="Bphy_0097"
FT   CDS_pept        complement(106959..107615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0097"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bxe:Bxe_A4347 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69292"
FT                   /db_xref="GOA:B2JK05"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK05"
FT                   /protein_id="ACC69292.1"
FT                   /translation="MNLRILIAEDHAVVRQGVRQLLIDRGVADDVAEAQTGAEVLAEAS
FT                   KHVFDVILLDISLPDMNGVEVLKRLKRKLPRIPVLMFSMYREDQYAVRALKAGAAGYLS
FT                   KTVDAAQMIAAIQQVAAGRKYVSPAMAEALADYVSFDGEQLPHEKLSDREYQTLCMLAS
FT                   GKRLTDIAVALSLSVKTVSVYRTRLLEKMKLRNNAELTFYVMSNRLVDLNPAMTA"
FT   gene            complement(107677..108543)
FT                   /locus_tag="Bphy_0098"
FT   CDS_pept        complement(107677..108543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0098"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: bxe:Bxe_A4346 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69293"
FT                   /db_xref="GOA:B2JK06"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK06"
FT                   /protein_id="ACC69293.1"
FT                   /translation="MRGHGTAARKGDAQRASGARATRSAKAATPSGTATRATSTDEITR
FT                   LKARVRELASELTRTQEATRRRVAQELHDSLGAEVTAARFALAGVETWLPADAPPQCTA
FT                   ALQTAQRSLDAVTQAAQEAVAELHAPTLDKGIVCALSHWINTFAARTGLRMSFVCAADA
FT                   RLTRLSADASLAVFRVAQEALNNVAKHARASGADMRIEATAQHLSIVVSDDGIGIPPHA
FT                   GQDERQFGLAGMRARCNAFDGELKVAATCDKTHGETRGTTVNARFAWKALMGNATRPRA
FT                   RRTAIRL"
FT   gene            complement(109090..109860)
FT                   /locus_tag="Bphy_0099"
FT   CDS_pept        complement(109090..109860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0099"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   bxe:Bxe_A4345 ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69294"
FT                   /db_xref="GOA:B2JK07"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK07"
FT                   /protein_id="ACC69294.1"
FT                   /translation="MSNLNPQTVLSVHHWTDTLFSFTCTRDASFRFENGQFTMVGLEVD
FT                   GKPLIRAYSMASANYEENLEFLSIKVPDGPLTSRLQHLKVGDQVLIGKKPTGTLMADNL
FT                   LPGKTLWLLSTGTGLAPFMSIIKDPDVYDRYERVVLTHTCRFVDELAYKEYITDHLPAH
FT                   EHIGELIQEKLVYYPTVTREPFANRGRITDLIETKKLFDDLDLPHFSLENDRVMLCGSP
FT                   HMLRDTRELLDSMGFQEGSNNNPGHYVVEKAFVG"
FT   gene            complement(110381..111022)
FT                   /locus_tag="Bphy_0100"
FT   CDS_pept        complement(110381..111022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0100"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bam:Bamb_3097 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69295"
FT                   /db_xref="GOA:B2JK08"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK08"
FT                   /protein_id="ACC69295.1"
FT                   /translation="MHHYLPILLQIAIVYLVALISPGPNFFMITQLSLAGRRGLGAASA
FT                   LGVGTGSTIWASLAMLGFATVLQRIDWLYNGIRIAGAVYLVWFGIKLVCASTKRGEAII
FT                   VTVETPLANDRAAYWRAWRSGALTCLTNPKSCAFWTSIFATLFPAHPPLWFYGVALAMI
FT                   GCMSVGWYGSVALMFATERTQRGYRRLRRPIDGVCGAVLVGLGAKLAAES"
FT   gene            111526..111951
FT                   /pseudo
FT                   /locus_tag="Bphy_0101"
FT   gene            complement(111967..112764)
FT                   /locus_tag="Bphy_0102"
FT   CDS_pept        complement(111967..112764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0102"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   bxe:Bxe_A4337 putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69296"
FT                   /db_xref="GOA:B2JK09"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK09"
FT                   /protein_id="ACC69296.1"
FT                   /translation="MRNPEELIRENLGPKDFIAVSWNLHKGRSPLGFQAWEAMQRWVES
FT                   VHADAYFLQEAMARRMPGPVLASSFGARMGDYDNDVWHCQATEIADSLQLQIALGPNVF
FT                   KPSWRHGNAILSPHPLDLGGRWDISAHRFERRGLLVARATFGGHSVSLLCAHLALTRQA
FT                   RLRQMHWIAHWISKEAPAGPLVLAGDFNDWRNDSVPLFREHGLEEVATLLGEPGRTFPA
FT                   FSPALALDKMFVRGMKPIEWIQPAQETAWLSDHLPYMARLRVE"
FT   gene            complement(112793..113299)
FT                   /locus_tag="Bphy_0103"
FT   CDS_pept        complement(112793..113299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69297"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK10"
FT                   /protein_id="ACC69297.1"
FT                   /translation="MWKTSLVAALLGATLIAQPGAAQAQQRSAPPVVKWELQVVRDGQQ
FT                   IDSFDGTTTVGQARTDTHHHVVQNSVGCKDVPAGNIDLARTLTVSPTQADATGVTFAID
FT                   AQETLQEPGMRTTAAGCKLPPQPRQVSANHPGLKVPPGDWTSWTIVDKDPNLVYRLRAS
FT                   VANNP"
FT   sig_peptide     complement(113225..113299)
FT                   /locus_tag="Bphy_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 25"
FT   gene            113629..114606
FT                   /locus_tag="Bphy_0104"
FT   CDS_pept        113629..114606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0104"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: bxe:Bxe_A4335 putative ATP-dependent
FT                   protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69298"
FT                   /db_xref="GOA:B2JK11"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK11"
FT                   /protein_id="ACC69298.1"
FT                   /translation="MTTAMVKQEIAVASFSKVYDLEQVETALNELSEGASEALRSTYEK
FT                   MLKVGNLRFCVKPNRMPSIDDLIGSLPNFTEPLDDIRKQVALCLETDDRLELMPILLLG
FT                   DPGIGKTHFAKQLARMLGTAYHYVAMSSLTAGWILSGASSQWKNAKPGKVFDALVHGSY
FT                   ANPVIAVDEIDKATGDSQYDPLGALYALLEHDTAQSFIDEFAEIPINASHVIWIATAND
FT                   ERSIPEPIMNRMNVFEIPPPDRDGSRRIAQSIYDEIRSAHGWGQHFPAELGGAALDALA
FT                   QASPREMRRAILNGFGSARIAGRDHIGAGDIRLDYNSRRKPIGF"
FT   gene            114837..115124
FT                   /locus_tag="Bphy_0105"
FT   CDS_pept        114837..115124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69299"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK12"
FT                   /protein_id="ACC69299.1"
FT                   /translation="MKKLSLAALLISAAVAAPAFASGYSPAPTQTPSGVNGPKTRAEVR
FT                   ADLAQARANGELSLNPNAPAYPQQFATGGYTVPIAHVDVRHLFKRTTATD"
FT   sig_peptide     114837..114902
FT                   /locus_tag="Bphy_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            115417..116523
FT                   /locus_tag="Bphy_0106"
FT   CDS_pept        115417..116523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0106"
FT                   /product="2-hydroxyglutarate dehydrogenase"
FT                   /EC_number="1.1.99.2"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_A4334 putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69300"
FT                   /db_xref="GOA:B2JK13"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK13"
FT                   /protein_id="ACC69300.1"
FT                   /translation="MDQIECVVIGAGVVGLAVARALAARGREVIVLEAAQAIGVGTSSR
FT                   NSEVIHAGIYYPRGSLKATLCVRGREMLYDYCAERGVPHQRCGKLLVATARNQVPQLES
FT                   LMARGKENGVLDLMRISGEEAQALEPALHCVEAVFSPQTGIVDSHQLMLALLGDAERDG
FT                   AVCAFHAPVEAIEAVNGRFVVKVGGSSPTTIGAACVINSAGLHANAIARKIRGLDARHV
FT                   PPLYLARGNYFSISGRAPFNRLIYPMPNEAGLGVHLTIDLGGQARFGPDVEWVDSINYD
FT                   VDPQRAEAFEAAIRAYWPALPAHALKPAYAGIRPKLSGPGEPAADFLIQGPAAHGVRGL
FT                   VNLFGIESPGLTASLAIAQRVCEVSGRA"
FT   gene            116726..117040
FT                   /locus_tag="Bphy_0107"
FT   CDS_pept        116726..117040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0107"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bxe:Bxe_A4333 putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69301"
FT                   /db_xref="GOA:B2JK14"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK14"
FT                   /protein_id="ACC69301.1"
FT                   /translation="MNNSRRTFLITSIGVASTIALSSRQAFADAPKVAESDPTAQALGY
FT                   KEDATKVDKAKYPKYAAGQDCGNCSFYQGKPTDAYAPCPMFAGKQVASKGWCSAYNKKG
FT                   "
FT   sig_peptide     116726..116812
FT                   /locus_tag="Bphy_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            117052..117351
FT                   /locus_tag="Bphy_0108"
FT   CDS_pept        117052..117351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69302"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK15"
FT                   /protein_id="ACC69302.1"
FT                   /translation="MDEQARVERCVTAPPLASFAAAVKSARRGERRALLSYESCLKSDV
FT                   VLFYTRMACARGLTAAHSNQIQINAPDASTQAGDIDVTSIQEPQYAGGHGGRHR"
FT   gene            117293..118615
FT                   /locus_tag="Bphy_0109"
FT   CDS_pept        117293..118615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0109"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_A4332 major
FT                   facilitator superfamily (MFS) metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69303"
FT                   /db_xref="GOA:B2JK16"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK16"
FT                   /protein_id="ACC69303.1"
FT                   /translation="MSQASRSLNTRAVTAAVIGNALEWYDFTVFGFLTVVIAELFFPSS
FT                   SDYSAILLTTASFGVAFFMRPVGGIVLGLYADRAGRKAALSLVIALMSLGILLLAVAPP
FT                   YSAIGVGAPLLIVVGRLLQGFSAGGEFGSSTALLIEAAPFSKRGFYGSWQMASQAAALL
FT                   LGAVVGALMTRGLSPEALRSWGWRVPFILGLVIGPIGFYIRRNLADSEAFLHAKQTARR
FT                   ATLGELFAHHSRDVLCGLGSVVALTVTIYVLISYLPTFAVRQLKLPYADSFTAVIVGNL
FT                   LLTVLSPLTGAWSDRIGRKGLSLWSLVITLVAIYPLFVWLEEAPSVSKLILVQAILSIA
FT                   LSGYYGPFGALMAELFPANVRSTGLSLAYNFAVMLFGGFGQFIVTWLIKTTGSPLAPTY
FT                   YVMCGLTISIVAVACMPAKRHADLDAMRKPLDALEQPLERR"
FT   gene            complement(118619..120133)
FT                   /locus_tag="Bphy_0110"
FT   CDS_pept        complement(118619..120133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0110"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_A4331 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69304"
FT                   /db_xref="GOA:B2JK17"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK17"
FT                   /protein_id="ACC69304.1"
FT                   /translation="MQSDYLDHDAIGLADLVRKRKVSARELLETAIARAEAVNPAINAI
FT                   VLKDYEAARRRASRERTNGSGEAPDAAALGDGPLAGVPYLVKDLGLAVKGLRMSMGSRH
FT                   YRHYIPAEDAPIVTLTRAAGLNIFGKTSTSEMGQMPYTEPELFGPCRNPWSLDHTPGGS
FT                   SGGSAAAVAAGIVPLAHASDGGGSIRIPASCCGLFGLKPTRGRQPSNAVPAPGDMGVDH
FT                   AVSRSVRDSALLLDLTSGNAGRPMGAPGTFLAATGEPCKPLHIAFVTDPMLAFTLSADA
FT                   RAALDDAAQLAASLGHHIEPVTLNIDFASLREAFLMIWSVSAENLVLHADQITGRKPNR
FT                   EEFEIATWAMGHIGRKFGERELPAALEAQRQISAKLAELMTRYDVILCATLAAAPIKIG
FT                   EMQPSAVEKMQMRAVTTVPVEPLMRKLLTEVSNKAFAWAGCTELFNMTGQPAMSVPLYW
FT                   NARGLPIGVQFATREGGEALLLRLAAQLETARPWFDRRPPLIPASS"
FT   gene            complement(120270..120968)
FT                   /locus_tag="Bphy_0111"
FT   CDS_pept        complement(120270..120968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0111"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: bxe:Bxe_A4330
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69305"
FT                   /db_xref="GOA:B2JK18"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK18"
FT                   /protein_id="ACC69305.1"
FT                   /translation="MSVTSRWIDIQTGNDAFGAYVSTPKSGKGPAVIVIQEIFGVNGHI
FT                   RDVVEQYAQDGYIAIAPDIFWRTQPRVELTYVGADRDKGIEILQKTNVDLAVADIGATA
FT                   AALRAMPEVTGKIAGIGYCFGGRLAYLAAVEGLLDIAVSYYGGGIQNQLDKAPQIKVPM
FT                   QFHYGELDHGIPLSAVGEVKERFAGRDDVELYIYPNADHGFNCTERASYHQHSAALAHG
FT                   RTLTFLATHA"
FT   gene            121607..122752
FT                   /locus_tag="Bphy_0112"
FT   CDS_pept        121607..122752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0112"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4327 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69306"
FT                   /db_xref="GOA:B2JK19"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK19"
FT                   /protein_id="ACC69306.1"
FT                   /translation="MNIKIQKLLPISAAAMLFATLATTASADTVVKIGHVAPLTGGIAH
FT                   LGKDNENGARLAVEEINAKGLTIGGQKITLQLDAQDDAADPRTATQVAQKLVDDKVVAV
FT                   VGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYA
FT                   AKGLKVKSVAIVDDSTAYGQGLANEFEKTAKSLGLNVMSHDATNDKAVDFRAILTKIKG
FT                   ENPDAIMYGGMDATGGPFAKQAKQLGLRAKVLAGDGVCTDKLSDLAGDATDNIVCSEAG
FT                   MALEKMEGGQAFQAKYQKRFGQPIQIYAPFTYDAVYIIVDAMKRAGSTDPAKILAAMPN
FT                   TDYKGVIGETTFDSKGDLKHGVISLYNYKSGKKTLLDVVKM"
FT   sig_peptide     121607..121690
FT                   /locus_tag="Bphy_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 28"
FT   gene            122916..123914
FT                   /locus_tag="Bphy_0113"
FT   CDS_pept        122916..123914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0113"
FT                   /product="transcription factor jumonji jmjC domain protein"
FT                   /note="SMART: transcription factor jumonji jmjC domain
FT                   protein; KEGG: bxe:Bxe_A4326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69307"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:B2JK20"
FT                   /protein_id="ACC69307.1"
FT                   /translation="MIDDEWRRWIAENLLLDASPEHVHAVLIEHGFEREHALCEIDSTL
FT                   NSPYFLAGARLRNRLRKREWMFSVYGELNRMRRGADEIERHAGLSRDAFYEQFYFQNRP
FT                   VIVTGMIDSWPARRRWNFDYFRARCARAEVEVQFGREADANYEINQPSHRRAMRFGDYV
FT                   DLVERAGVTNDFYMTANNASRNRVALAALWDDVPPIGEYLDAAAADAGYFWFGPAGTKT
FT                   PFHHDLTNNLMAQVIGRKRVLLVPFTDTAHMYNHLHCYSQVDGGALDVERFPSFEQAHV
FT                   IECTLEPGELLFLPIGWWHYVEALDASVTMTYTSFLERNDFARTYSTYREL"
FT   gene            complement(123950..125161)
FT                   /locus_tag="Bphy_0114"
FT   CDS_pept        complement(123950..125161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0114"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4324 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69308"
FT                   /db_xref="GOA:B2JKB9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKB9"
FT                   /protein_id="ACC69308.1"
FT                   /translation="MSDRPSESASIPAAHRNLPTSARKRARYATMALFLIAGMMYASWG
FT                   VHVPTVRDRFHLNPAMLSVALFAVAGGSIGAMVTNGPWIARVGTRRACLAGGLVMSACA
FT                   ALILVVPSYWMLLVLLAFFGAGMATLDVAMNAEASAVEEALGRPIMSSLHGMFSLGGMA
FT                   GAAVGGAALAHGMAPAVHLLLAALVSAGVLLAACPAVLPHVPHSEHPDAHAPRGNRWRS
FT                   PALWALGAIALVALIAEGAMYDWATVYMRDVVASTPAVSSAAYAAFSGGMAVARFAGDA
FT                   VRARFGAPQLTAASASLACAGMIGALLLPHPVAALTGFTMMGLGLANMMPVLFAAAARV
FT                   KGIPAAEGLAHVAGLAYFGLLLGPVIIGGVAQVTNLPIGLSVVALCAALVAFAAPKVLR
FT                   RLRI"
FT   gene            125383..126048
FT                   /locus_tag="Bphy_0115"
FT   CDS_pept        125383..126048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0115"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: bxe:Bxe_A4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69309"
FT                   /db_xref="GOA:B2JKC0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC0"
FT                   /protein_id="ACC69309.1"
FT                   /translation="MNIPAHAPLHLLHQAAIGTLATHARQPRGFPYPTVLPFAPDARHR
FT                   PTILVSRLAEHTRNLHSDPRSGFLIVHAPDGDVLNGERVTLVGTFEHVQPTPEVTHRYL
FT                   RYHPSAERYLVLGDFSFWVMSIERMRYIGGFGAMGWLMAEDLDPLAPVSFEEESALADM
FT                   IERHPRRPAHVRLLGVDRYGADLVTSGSRKRVAFDTPAPDWESLRALLEDCIARQGPA"
FT   gene            126407..126709
FT                   /locus_tag="Bphy_0116"
FT   CDS_pept        126407..126709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0116"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_A4321 putative HNS-like
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69310"
FT                   /db_xref="GOA:B2JKC1"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC1"
FT                   /protein_id="ACC69310.1"
FT                   /translation="MSSYRELLAQREKLEKQIEEAKAREYAEVLNEIKQKMADYGITLA
FT                   ELGGSRAKAVKTAGRPRAGVAPKYRDPASGSTWSGRGKPPRWIAGQEREKFLIEK"
FT   gene            126957..128159
FT                   /locus_tag="Bphy_0117"
FT   CDS_pept        126957..128159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0117"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bxe:Bxe_A4320 cation (Co++/Zn++/Cd++) efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69311"
FT                   /db_xref="GOA:B2JKC2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC2"
FT                   /protein_id="ACC69311.1"
FT                   /translation="MSSTLAAQSAEKQRVARTSTFASIALNTVLMSMQIVIGVFAHSQA
FT                   LVADGVHSLADLVSDFVVLIANRHSAAEPDADHNYGHSRYETVASLFLGGLLISVGVGM
FT                   LWRAGARLSDMQNIPAVHLSALAVAIVVLLSKEGLFRYMLREAQRVRSAMLIANAWHAR
FT                   SDAASSLVVALGILGSIAGVRLLDPIAAAIVGFMVARMGWTFGWDALQDLSDRALNEAD
FT                   TADLRSRIMSTPGVRDVHELRTRKMGDFALVDAHILVDPMISVSEGHYIAETARSRVLS
FT                   DSRVLDALIHVDPENDAISRPPVNLPPRAKIVAEVDTALAAQGLTAASVNLHYLSTGLD
FT                   IEVTLQPSRLGALESEVHQLERIDLEALKLRLGARRLSVTHAVDVSTAGAELAREPRGD
FT                   A"
FT   gene            complement(128169..128627)
FT                   /locus_tag="Bphy_0118"
FT   CDS_pept        complement(128169..128627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0118"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bxe:Bxe_A4319 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69312"
FT                   /db_xref="GOA:B2JKC3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC3"
FT                   /protein_id="ACC69312.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGIIQRYTALLDREKLGLHVCALAHIHLTRHTEGGVEQFEREIATCPEVTECYSTTGES
FT                   DYILKIVAPDIKAYDTFLHDRIFKIPAVAQVRTSVVLREIKFDTQLPL"
FT   gene            complement(128731..129345)
FT                   /locus_tag="Bphy_0119"
FT   CDS_pept        complement(128731..129345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69313"
FT                   /db_xref="GOA:B2JKC4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC4"
FT                   /protein_id="ACC69313.1"
FT                   /translation="MSVEIYVSTDVEADGPIPGPHSMLSFASAAYTADKQLIGTFSANL
FT                   ELLEGAAPHPVQEAWWKTQPEAWTACRKNLQQPAAALVAYVEWVEALPGKPVFVAMPAG
FT                   FDFTFMFWYMMRFAGRCPFSWSALDIKTLAFAMTGLPYRKCIKPRFPKHWFDDHPHTHV
FT                   ALDDAIEQGALFCNMLADLRQSQSAVMSEADGDDAGQKPAE"
FT   gene            complement(129342..129986)
FT                   /locus_tag="Bphy_0120"
FT   CDS_pept        complement(129342..129986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0120"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bxe:Bxe_A4317 putative metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69314"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC5"
FT                   /protein_id="ACC69314.1"
FT                   /translation="MKVTLIPVTPFQQNSSLLVCEKTGRAAIVDPGGDLDIIKGEVERQ
FT                   KASVEKVLLTHGHIDHCAGAKTLAEHYGVPIEGPHIDERFWIDQLPQQSLRFGFPAAEA
FT                   FEPTRWLKDKDTVTFGDETLEVYHCPGHTPGHVIFFSRAHRLALVGDVLFAGSIGRTDF
FT                   PRGNHGDLIRSIREKLWPLGDDVTFVPGHGPTSTFGDERRTNPYVADGVGA"
FT   gene            130629..131228
FT                   /locus_tag="Bphy_0121"
FT   CDS_pept        130629..131228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0121"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: bxe:Bxe_A4315 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69315"
FT                   /db_xref="GOA:B2JKC6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC6"
FT                   /protein_id="ACC69315.1"
FT                   /translation="MKTRLPRRVGSVFAFLALAGCAVPPGANTQVSGVSATTKDARAVV
FT                   APPSYGSGMNDLPGTADQKGKLADAEPLTDGPNIADFHQTGRASWYGRGFHGRKTANGE
FT                   RFDMHALTAAHRTLPLGSYVRVTNPATNDSVVVKINDRGPYARGRVLDLSYAAAKILHL
FT                   AHIGTARVKIEGLTQREAKAEMKEILASNQGDSNEK"
FT   sig_peptide     130629..130718
FT                   /locus_tag="Bphy_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.573 at
FT                   residue 30"
FT   gene            complement(131307..132182)
FT                   /locus_tag="Bphy_0122"
FT   CDS_pept        complement(131307..132182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0122"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bxe:Bxe_A4314
FT                   protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69316"
FT                   /db_xref="GOA:B2JKC7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC7"
FT                   /protein_id="ACC69316.1"
FT                   /translation="MTPLSELAQGQQYPTSALYVVATPIGNIADITVRALHVLGLVDRV
FT                   AAEDTRNTGQLLSRYGIAKPLVAVHQHNERESAQRIVDYLRAGERVAYVSDAGTPGISD
FT                   PGAKLVDAVREAGFTIVPLPGASALATALSVAGDWVSTFSFLGFLPPKAKQRAAALAPL
FT                   VKHSQAMVFYEAPHRIIETVQALADAFGGQRRLLIGRELTKLHEGLHRCTLAEGPKWLE
FT                   ADANRQRGEFVLVVEGAPADAEGEHEHDTLLGMLLEEVSVSSAAKIAAALTGASRNTLY
FT                   TRALELKKDD"
FT   gene            132181..132651
FT                   /locus_tag="Bphy_0123"
FT   CDS_pept        132181..132651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0123"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   bxe:Bxe_A4313 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69317"
FT                   /db_xref="GOA:B2JKC8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC8"
FT                   /protein_id="ACC69317.1"
FT                   /translation="MTRKTQTDETRQTLCHAAAPLPASAREATRPADNFSGGARSKIVG
FT                   AAFEARALTFLQRQRLRFVARNVVCRGGEIDLVMRERDGSLVFVEVRARAQSEYGGAAA
FT                   SVGWRKQQRIVRAAQHFLSTHDVAMPACRFDVIAFERGRLVWVRDAFRVDEG"
FT   gene            132877..133464
FT                   /locus_tag="Bphy_0124"
FT   CDS_pept        132877..133464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0124"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   bxe:Bxe_A4312 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69318"
FT                   /db_xref="GOA:B2JKC9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKC9"
FT                   /protein_id="ACC69318.1"
FT                   /translation="MSVERIQQHFRDSAAVTLAALEALSMPIAAAVDAMFAALANGNKI
FT                   LTCGNGGSAADAQYFAAELIGGFERERPALPAIALTTDSSVITGIANDASLDQIFATQV
FT                   RALGQPGDVLLAISTSGNPANVLAAIEDAHDREMIVVALSGTGGGKINEVLHDTDIHIC
FT                   APSDRTARVQEVHLLTIHSLCDGIDAMLLGEE"
FT   gene            133485..134288
FT                   /locus_tag="Bphy_0125"
FT   CDS_pept        133485..134288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0125"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   bxe:Bxe_A4311 periplasmic phospholipid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69319"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD0"
FT                   /protein_id="ACC69319.1"
FT                   /translation="MSAYRVKSTFVRTTLVVGLVAGLAATLQGCVLAVGAAAGGSALVA
FT                   TDRRTLGAQTEDREIQVKAMSLISQNLPDSAHVNVTVFNRRVLLTGEVAGDVSKARAES
FT                   VVRSLNNVNAIINELTVAPASSFSSRSNDTYLEGRVKTALIAEKDISANNYKVVCERGS
FT                   IYLMGLVTVDEGNRGADVASRVPGVTQVVKVFQYIQPQEAVAATTAAASAASGAPAAAA
FT                   AQPDAEVTSGAVPDSSITSKPLEQQSPAPVSNSSQVHPGNPKAGQ"
FT   sig_peptide     133485..133586
FT                   /locus_tag="Bphy_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.496 at
FT                   residue 34"
FT   gene            134285..134632
FT                   /locus_tag="Bphy_0126"
FT   CDS_pept        134285..134632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0126"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_A4310
FT                   putative cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69320"
FT                   /db_xref="GOA:B2JKD1"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD1"
FT                   /protein_id="ACC69320.1"
FT                   /translation="MRGFVSGLLWAAVVVGSVVGSVAHAADAPPRGLAIARSNACLGCH
FT                   AIDRKLVGPSFQQVAEKYKGNAQAAAVLAKKVKDGGSGVWGAIPMPAHPAMSDADIRTV
FT                   VDWALAGAPSK"
FT   sig_peptide     134285..134362
FT                   /locus_tag="Bphy_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            134688..134760
FT                   /locus_tag="Bphy_R0022"
FT                   /note="tRNA-Ala3"
FT   tRNA            134688..134760
FT                   /locus_tag="Bphy_R0022"
FT                   /product="tRNA-Ala"
FT   gene            134929..136038
FT                   /locus_tag="Bphy_0127"
FT   CDS_pept        134929..136038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69321"
FT                   /db_xref="GOA:B2JKD2"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD2"
FT                   /protein_id="ACC69321.1"
FT                   /translation="MNPPRPRSIEVDFFRGIVLIVIVLDHIPGSVLQHLMLHAYALCDS
FT                   AEVFVCLGGYASAAAYNAVLSKKGPKAAQTRFHKRCWEIYRAYLLTALLTLLSGAILQR
FT                   LHLNRTMVDLTGWPAFCAAPLKEAFEIATLRRQPYLSSVLPMYVLFALTVPLIVPVARK
FT                   SPLTALAISATTWALAIPLAKLSAIDDVSNWAFNPFAWQLLFVIGILCREHPVPTDIQE
FT                   SRTGRWLTKVAVAAVLAFAVTKLFILTQPLPGHLKQNLSIERVINFLAIAWLATGLIRT
FT                   GAIARLAHRMPAVVKVGQTGLACFVGGTLISLIVDTATPRNLSGLSHGLAALAGDLIAI
FT                   VAVLLLARFWSDWKGPAQPRAAVTGADCR"
FT   gene            136035..137750
FT                   /locus_tag="Bphy_0128"
FT   CDS_pept        136035..137750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0128"
FT                   /product="Feruloyl esterase"
FT                   /EC_number="3.1.1.73"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bxe:Bxe_B2279 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69322"
FT                   /db_xref="GOA:B2JKD3"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD3"
FT                   /protein_id="ACC69322.1"
FT                   /translation="MKRGTAWPRAARTLSRIALTSAMAAVGANTAAAATPDSQTQPQHP
FT                   PATEPKKAAFNTRCTDLNGLWLDPDTIALPTHGAHVETATPISAQTPGNGAGEFCRITG
FT                   VIRPIKGTTPDIRFDLNLPRRWNGRALQVGGGGYNGTVVTGIGVMPFSPIRAPLAQGYV
FT                   TLGDDSGHVGNSSLAVFGLVDESVVNFGYAHLKKTHDAALALIVRMYGHPPDRMYFAGG
FT                   STGGREGYTVMQRFPDDYDGVIADSPALNFSGVRLIGVRIGQAEYASHGGFVPPALLER
FT                   VYQKSLEVCDKLDGAADGIVSDVAQCRQHEAEIIDALRCHRGSSYAHEGGCLTDAQLAT
FT                   LNVLRDGLKLPYKLAYDVSGYHGYNVFQGTRLNGALGLGRDPVRQTSPTFAGNGYLFAQ
FT                   GDGYARYFVAQDATFDSMKFDVLHPGKYQKQLVALSQTIGAMNPDLSRFMAKGGKLITM
FT                   QGLADEVISPNQTIGYYEHLVDLYGDERVNAFMRLYMVPGFQHGSGVFIPSVDLLGALD
FT                   NWVTRGISPETLLATDIAPPTNGRSRPLCRYPMYPRYLGKGNLNDGNNFVCSEP"
FT   sig_peptide     136035..136136
FT                   /locus_tag="Bphy_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 34"
FT   gene            138001..138864
FT                   /locus_tag="Bphy_0129"
FT   CDS_pept        138001..138864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0129"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: afw:Anae109_0799 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69323"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD4"
FT                   /protein_id="ACC69323.1"
FT                   /translation="MNASKSAALVEVLTRHRDTLLTEWLNQHLSIALRRGLTTEAEMND
FT                   QFRNFLNVFSDTLARSDTLDASRPEWEPVRAFLTDMSTHRARQGFTPVETATFVFSLKQ
FT                   PLYSRMREEFDSQPLELAEVSWTVNLLLDALGLFTTEVFQRAREAIISRQQEELLELST
FT                   PVVQLWEGILALPLIGTLDSARTQVVMESLLQKIVETGAAISIIDITGVPTVDTLVAQH
FT                   LLKTVAAARLMGADCIISGIRPQIAQTIVHLGVDLTNVITKSTLADAFIVALQKSGSSI
FT                   STRIAS"
FT   gene            138874..139230
FT                   /locus_tag="Bphy_0130"
FT   CDS_pept        138874..139230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0130"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: aba:Acid345_2415 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69324"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD5"
FT                   /protein_id="ACC69324.1"
FT                   /translation="MDRIPILRMGDCLIVAIQVDMHDRLAIALQDDLTARIVKDKAKGV
FT                   LIDISALDIVDSFIGRMISNTAAMATVLDAQTVVVGMQPSVAITLVELGLTLTGVRTAL
FT                   NVERGMALLKQRQR"
FT   gene            139250..139675
FT                   /locus_tag="Bphy_0131"
FT   CDS_pept        139250..139675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0131"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: aba:Acid345_2414 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69325"
FT                   /db_xref="GOA:B2JKD6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD6"
FT                   /protein_id="ACC69325.1"
FT                   /translation="MNSFGVVVTSTVEVGLRSDQEIVKLRQIVRDEAIAQGFSLVDQTK
FT                   FVTAASELARNTLLYGGGGDATLDVLLNGSRKGLRLIFVDQGQGIADIERALQDGFTSG
FT                   SGLGLGLGGARRLCDEFEIQSEPGKGTRVSITKWKLR"
FT   gene            139660..140808
FT                   /locus_tag="Bphy_0132"
FT   CDS_pept        139660..140808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0132"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   Stage II sporulation E family protein; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: sus:Acid_0530 putative
FT                   anti-sigma regulatory factor, serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69326"
FT                   /db_xref="GOA:B2JKD7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD7"
FT                   /protein_id="ACC69326.1"
FT                   /translation="METSLSGLRAMHASFEIADASSVAFARRSANDAGQKGALNDTDLG
FT                   RVALIVTEAATNILKHAQHGELLVRVLPSGAAGTRADGVEIIAIDKGPGMRDVGLAFRD
FT                   GSTTAGTPGTGLGAIRRLSEDVSVYSQPGLGTVLRAVVRSRSPSDHAPARAMRAAAGTD
FT                   IGGVCVPYPGESVCGDAWGIESDQHGLTVTVADGLGHGPDAHVAAAGAVDVVRRRAGRS
FT                   PAALMELAHGALRPTRGAAVAIARLDLARSQLEFAGTGNISASIFNVGRPVLVGGGSTR
FT                   SASATSEGTRNSWQLTSRNGIVGHTMRDSQEFAVPWTRDALLILHSDGIGTRWDLAAYP
FT                   GLHLQPAVMIAAVLYRDFSRRRDDATVVVVKADQQQSVKGSE"
FT   gene            140895..142343
FT                   /locus_tag="Bphy_0133"
FT   CDS_pept        140895..142343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0133"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: sus:Acid_0531
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69327"
FT                   /db_xref="GOA:B2JKD8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD8"
FT                   /protein_id="ACC69327.1"
FT                   /translation="MTTPILRIRLGAEEDVVAARRKARAIAAGFGFSSLDQTRIASAVS
FT                   EIARNAFEYAHGGEVTFTFDAAAKPQALLIDVRDKGPGIRNLESVLEGTYRSPTGMGCG
FT                   IAGSRRLMDRCEIQSSAEQGTVVSMARFLPNDRPEMALTGIDAIMRSLVQQNPTSARMH
FT                   SETNDETARRSMDELHEQNRELLSTLTELRDRQDELSRLTQELEATNRGVVALYAELDE
FT                   RADELRRADAMKSRFLSNMSHELRTPLSSIRALSNLLLNRLDGDLSGEQERQVLLIRKS
FT                   AEDLSEIVNDLLDLAKIEAGRTDVTPVWFKAAGLFAALRAMLTPLLTDPAVKLIFEDTH
FT                   GLPSIFADEAKLTQILRNFVSNALKFTERGEIRVGAHLEPDGQHVTFAVVDTGIGIAEE
FT                   HQQVIFEEFGQVQNHLQQRVKGTGLGLPLCRKLAALLGGHAGVDSKPGVGSTFYLTLPL
FT                   EAKAAAGPDVRWADGSSIAHGGAS"
FT   gene            142340..143983
FT                   /locus_tag="Bphy_0134"
FT   CDS_pept        142340..143983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0134"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: mxa:MXAN_0229 sensor histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69328"
FT                   /db_xref="GOA:B2JKD9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKD9"
FT                   /protein_id="ACC69328.1"
FT                   /translation="MTVAAPLILNVDDNDGARYAKTRVLVHAGFDVVEAATGQGALDQV
FT                   RTHNPAIVLLDVKLPDISGIEVCSILKRDPQTRSTLILQTSAAAVQSFDKVRALDGGAD
FT                   SYLTEPIEPAELVANVRALLRLHRAEEALRDADRRKDQFLATLAHELRNPLAPIRNAVE
FT                   LMDPRYHAAEDAVCHARMIARRQVEHLSRLVDDLLDVSRITHGKIALQRECVHLDAAVA
FT                   TAVEANQPFIATKQHTLRVNVPKSACMIYGDPIRVAQVISNLLSNAAKYTPEGGVIELD
FT                   VSAADGSVTVRVRDNGIGIPPNELADVFNLFMQSEDSLARSEGGLGIGLSLAKTLTELH
FT                   GGTIEAFSGGLGMGSEFVVTLPMVVEQSAGKPCDASPDTSAAADGEPAARQPAGEATPA
FT                   TRRRVMVVDDSVDGAESMSILLEMLGHEVRVMYDGAAAIAAASEFKPEVVLLDIGLPGV
FT                   DGYQVARALRAEPATAGALLIALTGYGQDTDRQRTRDAGFDHHLVKPASLDDIERVIAA
FT                   DGASGAPRNPGTTLRPDANCSDATRSDVTE"
FT   gene            144107..149002
FT                   /locus_tag="Bphy_0135"
FT   CDS_pept        144107..149002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0135"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; KEGG: bxe:Bxe_B0221 multi-sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69329"
FT                   /db_xref="GOA:B2JKE0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE0"
FT                   /protein_id="ACC69329.1"
FT                   /translation="MKPDNTMAGAPSEADAASAGSTAPSFLAGGGEMGSLIRAYDWRAT
FT                   PLGAPAQWPQSLKTAIRIMLTSRQPIWIGWGRELLFFYNDPYKSIIGGKHPAALGQPTS
FT                   AVWSEIWSDIHPLLETALEGIEGTFVEQKLLIMERNGYPEETYYTFSYSPIPDDHGGTG
FT                   GIICANSDDTARMVGERQLRLLSEIGSATRDALSWRDVCEASVRALESDPYDITFALFY
FT                   QTEPGPAVASLVATCGIEPGHLAAPPKMDALDCPWPFIDALRSQQLVVVPDLAERFGVS
FT                   LPSGAWRRPATQAAVLPVQPSGETGRGGVLVVGLNPYRLVDDRYRSFLTLVARQVGATL
FT                   GYADAYEEERRRAEALAEIDRAKTTFFSNISHEFRTPLTLMLGPLEELLARPDAASASD
FT                   RQLIEVTHRNGLRLLKLVNALLDFSRIEAGRIEIHPQPTDLAAFTADLASLFRSAIESA
FT                   GMTLEVDCERLPHLVSIDREMWEKVVLNLLSNAFKFTLTGTISVSLTMTADGSVEMSVA
FT                   DSGIGIPKHELPRLFERFHRVEGATGRSVEGSGIGLALVSELVRSQNGAIHVESELGAG
FT                   ARFTVVLPPAIALDPAASEAARATMSANAQSYADAARRWLPDADTADTADTADTAALHG
FT                   VQQGAATGKLLVVDDNADLRDYMRRILTAAGHQVYVAADGMEALAAARALQPELVVSDV
FT                   MMPKLDGFGLLRALRADDGLREMPVLLLSARAGEEAKVDGLESGADDYLIKPFAARELL
FT                   ARVAGNLQLARLRRETGNRLREESRTLEILNRVGTVVAAELDLNRAVQVVVDAATELTG
FT                   AAFGSFFYNVPDDKGGSYMLYTLSGVPADAFAKSPMPRNTAVFAPTFEGHGIVRSDDIT
FT                   KDSRYGRNPPHRGMPDGHLQVRSYLAAPVVSRTGEVLGGLFFGHPTPGVFTTRSERYVE
FT                   GIAAQAATAIDNARLYQAAQREIAERTKAQEALRELNETLEGRVIEAVADRDRLWDVSE
FT                   DLLLVASVDGELQRVSPSWTRVLGHDMHWLALHSYFSLIHADDLALVKANLAELRRTGA
FT                   PMRFENRLRHIDGSWRWIAWTLSLDPDTRRIHGVGRDVTSDRETQEALRHAEEALRVAQ
FT                   KMEAIGNLTGGVAHDFNNLLQVIGGNLQLLSDDVAGDERPAQRVRNALAGVARGAKLAS
FT                   QLLAFGRRQPLAPKVVNLGRFVRGLDDMMRRALGDGIEIETIVSGGLWNTLVDPFQVEN
FT                   ALLNLAINARDAMDGHGKLTIEAGNASLDDAYAKRHVDVEPGQYVMVAVTDTGSGMSAD
FT                   VQEHVFEPFFTTKPEGQGTGLGLSMVYGFVKQSGGHVKIYSEPGHGTTIRLYLPRVREE
FT                   EDLETIVDAGPAKGGAETILVVEDDEDVRTTVVEMLSALGYRVLKAKDAQSALAIVESG
FT                   VPIDLLFTDVVMPGSLRSTELARKARERQPGIAVLFTSGYTDNAIVHAGRLDEGVELLS
FT                   KPYSREALARKIEHALHVQYARPDGGVTLQAEDSQTVRLVDRNNNATFDAIRNLRILFV
FT                   EDDELVRVSTAELLRTFGVEVAEASGAVQALDLLHEKSFDVLLTDIGLAGASGIDLAID
FT                   ATGRESRLRVIFVTGSDAALSPEQQLRLPGASQLRKPYDPLDLVNALRGCVE"
FT   gene            149102..149725
FT                   /locus_tag="Bphy_0136"
FT   CDS_pept        149102..149725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69330"
FT                   /db_xref="InterPro:IPR018715"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE1"
FT                   /protein_id="ACC69330.1"
FT                   /translation="MTESITCTAFEGARCIASGELKDVALAVKAATGRDGGASVLIFDD
FT                   RTGQLVELDLRGSASEVLARLAAQETGDTQPPEPASDAASATRGRGRPKLGVVAREVTL
FT                   LPRHWEWLNAQSGGASVALRKLVDAARVASEGKDRVRRAQEAAYRFMTTMAGDLAGYEE
FT                   ATRALYANDAARFDSMTAAWPVDVREHARKLARRSLDADPVAIV"
FT   gene            150067..151614
FT                   /locus_tag="Bphy_0137"
FT   CDS_pept        150067..151614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0137"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rme:Rmet_3683
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69331"
FT                   /db_xref="GOA:B2JKE2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE2"
FT                   /protein_id="ACC69331.1"
FT                   /translation="MMKWFDRMSVWKKLLIAFAAVIGFGVAVGAAGLSALASMHGMTEE
FT                   ISSRHMDGLYWMEEANRYKIDTDLDAANLGYAPDEAARKKLKDDIVASLKNMHDAYGLY
FT                   RATIAGADGQALYDDVLRKTDAWEAIVHQQIGLQPVPSGVDELVRRAIAASETLRDAIV
FT                   VLIDYRRKQANAAQHEAGAEYARMRVVLSLLVLASMAVGAAFAWLIARRLTRQLGGEPG
FT                   YAMQIARRIAAGDLTVRVDTKPGDTASLMHALANMRAQLAAIVGKINESSESILLASGE
FT                   IEQGNTDLSQRTEEQAASLEETASSMEQLTATVRQNADNAQQAGGVARGASEVALRGSG
FT                   LVREVVDTMRELASGSKRMTDIIGVIESIAFQTNILALNAAVEAARAGEQGRGFAVVAA
FT                   EVRALAQRSAVSAKEIKELIESSTSRVDSGAVLAERAGRTMAEVTQAVRRMTDLMGEIS
FT                   AASSEQSTGIEQVNRAVAQMDEVTQQNAALVEQAAAAAGAMAGQARHLKTAVAVFSL"
FT   sig_peptide     150067..150159
FT                   /locus_tag="Bphy_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.561 at
FT                   residue 31"
FT   gene            151789..153096
FT                   /locus_tag="Bphy_0138"
FT   CDS_pept        151789..153096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0138"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: bxe:Bxe_A4294
FT                   nucleobase/cation symporter, (NCS2) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69332"
FT                   /db_xref="GOA:B2JKE3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE3"
FT                   /protein_id="ACC69332.1"
FT                   /translation="MADSYFPRWRVQPKSVEGRVVNIDERLPWPQMFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAITGYTGHG
FT                   PNMNIPVALGGIIACGVAYVVIGLIVSAIGTAWIETLMPPVVTGSIVAVIGLNLAPIAV
FT                   KGVSGSAFDSYMALVTVLCVGAVAVFAHGMLQRLLILVGLLIAYAIYAVVTNGMGMGKP
FT                   IDFSIVANAPWFGMPHFMAPVFSGQAMALLAPVAVILVAENLGHIKAVSAMTGQNLDGY
FT                   IGRAFIGDGLATVLSGFAGGTGVTTYAENIGVMAVTKIYSTLVFVIAALIALVLGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNKVNFSDNRNLIVAAVTLVLGAGDF
FT                   SLKFGGFALGGIGTATFGAIILYALLRRKGPQEPAV"
FT   gene            complement(153168..154832)
FT                   /locus_tag="Bphy_0139"
FT   CDS_pept        complement(153168..154832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0139"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: bxe:Bxe_A4293 Na+/H+ antiporter, CPA1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69333"
FT                   /db_xref="GOA:B2JKE4"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE4"
FT                   /protein_id="ACC69333.1"
FT                   /translation="MDIVFTVLILLLAVAASGVIVRLVPVKLPLPLVQIAFGALLAWPH
FT                   LGLHVTFDPELFMLLFIPPLLFADGWRIPKREFYMQRRAILMLALGLVFLTVVAVGYFI
FT                   HAIVPSISLPVAFALAAVLSPTDAVALSGIAGRNRLPEHLMHILEGEALMNDASGLVAL
FT                   KFAIAAALTGVFSLRDASVSFVIIALGGLATGAAVAWLFSFASTRFLNLTEEGDPAPGV
FT                   VMTMLIPFAAYLFAEHFEFSGILAAVAAGMTMNLSTFARTSPAEARVRASVTWTMIEFV
FT                   FNGMVFILLGLQLPHIIGRALLDAHEQASGSELRLIFYVAAVALALYALRFVWVWLLRW
FT                   FASRGAAKHGVANAVPGLRTVSMTTIAGVRGAVTLAGVLSLPVALSNGQPLPGRDVAIF
FT                   IASGVILLSLFVAVVGLPLLMNGARRRPDPHAAEERTARIQAAQAAIRAIDDFHETATA
FT                   ECDEAQSAHAADVTARVMDIYRRRLATLDDDIEPAQNARRSEALEFQMKLAAMRAERST
FT                   LLELRGSQLINDDTLNKLMREVDLSETALQTRGKGKK"
FT   sig_peptide     complement(154776..154832)
FT                   /locus_tag="Bphy_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.653) with cleavage site probability 0.298 at
FT                   residue 19"
FT   gene            155217..156491
FT                   /locus_tag="Bphy_0140"
FT   CDS_pept        155217..156491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0140"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bxe:Bxe_A4292
FT                   putative diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69334"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE5"
FT                   /protein_id="ACC69334.1"
FT                   /translation="MTIAQQEKTTVPHGFELSMTSGLQRYSVQHGELTLTSVFQPIFSL
FT                   SHMRAVGYEGLLRAHDPFDRAVSPVDVFGHAARVGDVLHVDRLAQSLHLENFKVLGAER
FT                   EWLFLNVHPGVLIDSYHSAALLANLRRLNLSPRRIVLEVLEQSAEDIERLADAVRQFRE
FT                   RGFLIALDDFGAGHSNIERIWQLNPDIVKLDRIMLSHAAHRADVASILPGLVALLHEAG
FT                   KLVLIEGVETEHEAHMAMECNVDFVQGFFFGRPHPGLADAAHAAACIGELTERYQTQTE
FT                   QRERRNASRLAPYIRAFERAAERLAAGELLDEVCWNFLALDHAARCYLLDDKGRQAGRN
FT                   VVLRADRASHETRFLPLSDAQGANWLRRPYFRAAIEAPERVHVTRPYLSINEAVPCVTL
FT                   SVATQIGSRMCVLCGDIDWFEEPHF"
FT   gene            156536..157225
FT                   /locus_tag="Bphy_0141"
FT   CDS_pept        156536..157225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0141"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bxe:Bxe_A4291
FT                   putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69335"
FT                   /db_xref="GOA:B2JKE6"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE6"
FT                   /protein_id="ACC69335.1"
FT                   /translation="MRNERVLLEVIATTVADAKAAARGGADRLELITAMGEGGLTPSIG
FT                   MIEAVAAAVPIPVNVIVRPHSHSFVYDADDFAVILRDVRAARAAGANAVVFGMLTASRE
FT                   VDREALLRVVDAADGMPVTFHRAFDETRDLREALDILLEVDGVANVLTSGGRSSVLDAV
FT                   GEVQLLVAQAAGSACTVLAGAGLTVDRVAGFVHAAHVKAVHFGSGVRSDGVVAEEKVRL
FT                   VRGLLDA"
FT   gene            complement(157261..157557)
FT                   /pseudo
FT                   /locus_tag="Bphy_0142"
FT   gene            complement(157599..161189)
FT                   /locus_tag="Bphy_0143"
FT   CDS_pept        complement(157599..161189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0143"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: bxe:Bxe_A4290 putative indolepyruvate ferredoxin
FT                   oxidoreductase alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69336"
FT                   /db_xref="GOA:B2JKE7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE7"
FT                   /protein_id="ACC69336.1"
FT                   /translation="MTARPPIDGIPALADYRLSDNLTATRGRIFLTGTQALVRLTLMQR
FT                   QLDKARGLNTAGFISGYRGSPLGMVDQQLWKAKKLLDANDVRFLPAINEELGGTAVLGT
FT                   QRVEADPERTVDGVYAMWYGKGPGVDRAGDALKHGNAYGSSQHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFAMIAWHMPVVNPSNVADMLEFGVYGWALSRYSGAWVGFKAISETVESGSTV
FT                   DLDALQTQWPAPEGFEAPAGGLHNRWPDLPSLTIEQRLHAKLDAVRHFARANSIDKWIA
FT                   PSPHANVGIITCGKAHLDLMEALRRLDLTVADLEQAGVRIYKVGLSFPLEMTRIDAFVS
FT                   GLSDVLVIEEKGPVIEQQIKDYLYNRTQGARPAIFGKHAEDGSMLLSSLGELRPSRILP
FT                   VFANWLAKHKPALDRRERVVDLVAPQILSNAADAVKRTPYFCSGCPHNTSTKVPEGSIA
FT                   QAGIGCHFMASWMERDTTGLIQMGGEGVDWAAHSMFTKTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAAKATITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSHFVVVSDEPEKY
FT                   DGHHGLFPKGTTFHHRSELDKVQRELRDIDGVTVLIYDQTCAAEKRRRRKKGEFPDPDK
FT                   RLFINEEVCEGCGDCGVQSNCLSVEPVETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTI
FT                   EGGKLKKAAGVAFDAAALATCVDALPLPTTQLDAAPYDILVTGVGGTGVVTVGALISMG
FT                   AHLEGKSASVLDFMGFAQKGGSVLSFVRFAARDEWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRRGRTRIVVNTHAIPNASFVQNPDANLHADALLDKMRHAAGDEFMSSCDAQS
FT                   LATRFLGDTIGANIVMLGFAWQLGLVPISFGAMMRAIELNNVAVQMNQLAFSIGRMAAA
FT                   DPAGLEVLWTQRHAVHPAVSLESLDALLADREARLHTYGGAAYVKRYRALVDAARQAER
FT                   ELEPASGERLSRAVATTFYRLLAVKDEYEVARLHSDPAFRAALEAQFEGVAGKDFGVKF
FT                   NLAPPTISRAKHGAKPQKKTFGQWMWPVLGLMAKWRGLRGTALDPFGHTVERRMERELS
FT                   ADYETTMQRAFAVLSHVTADDVVRLAELHARVRGYGHVKLANLAAVKRSEREIAARLHI
FT                   EAASGPAVVDALQEAKGLGTLRGIPVVVAK"
FT   gene            161632..162249
FT                   /locus_tag="Bphy_0144"
FT   CDS_pept        161632..162249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0144"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bam:Bamb_2990 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69337"
FT                   /db_xref="GOA:B2JKE8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE8"
FT                   /protein_id="ACC69337.1"
FT                   /translation="MKLYYWPKTRAFRALWMLEEASARYELAHVNIRAGEQDTTQFHHI
FT                   NPMCKLPALDDDGVQVAESGAVLLYLADRFPEANLGAPVGDPLRGRFLQWLFFTPGCLE
FT                   PAMAEKLTGASGNSFSFGWGNLERVKAAIDMALYEGEWLLGERFSAADLLLAGTLQIAF
FT                   VAKLLEPTGRIGEYVDRAISRDAHTRAMAIEQREIEVLKLKH"
FT   gene            complement(162277..163218)
FT                   /locus_tag="Bphy_0145"
FT   CDS_pept        complement(162277..163218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0145"
FT                   /product="K channel inward rectifier conserved region 2
FT                   domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; K channel
FT                   inward rectifier conserved region 2 domain protein; KEGG:
FT                   bur:Bcep18194_A6296 K+ channel, inward rectifier"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69338"
FT                   /db_xref="GOA:B2JKE9"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKE9"
FT                   /protein_id="ACC69338.1"
FT                   /translation="MNATPPESSGDHRARAGRLLDRKIRARSHTVVAHGLPLRVWQDLY
FT                   HRALTISWPVFFTSLAFLFLVLNSAFASLYELGGATIANQNPKGFAGAFFFSVETLATV
FT                   GYGDMHPQTLYGHLVATLEIFVGMSGIALATGLIFARFSRPRAKIMFSRFAIVRPIDGQ
FT                   TTLMVRTANARQNVIVEARARLRLMRVERSTEGYVLRKIYDLKLVRDQQPMFYLGWNLM
FT                   HVIDEASPLFGETPESLYTRDASLLLTIEGSDENTSQTMQARFSWPSDDIRWQHRFVDL
FT                   IREENGVSHIDYTHFDDVEPLQPHELQQAPTG"
FT   gene            complement(163365..163610)
FT                   /locus_tag="Bphy_0146"
FT   CDS_pept        complement(163365..163610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69339"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF0"
FT                   /protein_id="ACC69339.1"
FT                   /translation="MAEPLFLYGVYAIHVRPLELQGARWDAEYEIRHRDHPVQRWTTVG
FT                   GDIGFATEAEAVETAHQQAVADIEHGAGVPKPRAFP"
FT   gene            complement(163714..163953)
FT                   /locus_tag="Bphy_0147"
FT   CDS_pept        complement(163714..163953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69340"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF1"
FT                   /protein_id="ACC69340.1"
FT                   /translation="MQERCIMEDVTYTKGLYTATATIRPVDGGQYQGVVALSRDEGDET
FT                   EDTVYEVEATSATADEALEEAKALAHRILGEIEL"
FT   gene            complement(164095..165021)
FT                   /locus_tag="Bphy_0148"
FT   CDS_pept        complement(164095..165021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0148"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bxe:Bxe_A4286
FT                   putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69341"
FT                   /db_xref="GOA:B2JKF2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF2"
FT                   /protein_id="ACC69341.1"
FT                   /translation="MSASLESSTTFPDFVSAGDILTDLVRTGPSSWLSVPGGAGWNVAR
FT                   AVARLGLPTACAGSLGVDNFSDDLWNASVAAGLDMRFMQRVERAPLLAVVHQTHPPAYF
FT                   FMGDNSADLAFDPSALPEGWMSYVKWAHFGCISLVRQPLGTTLAKLAADLRARGVKISF
FT                   DPNYRNLMAHGYEPTLRRMAGLADLIKVSDEDLRMLFKTDDEAAALAQLRAMNPKAIVL
FT                   VTRGSETATLIDGDRVIEAKPPRVAVADTVGAGDASIGGLLFSLMTAPQRKWEEHLAFS
FT                   LAAGAAACRHSGAHSPTLDEVVSLLQD"
FT   gene            complement(165040..166302)
FT                   /locus_tag="Bphy_0149"
FT   CDS_pept        complement(165040..166302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0149"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /note="PFAM: N-acylglucosamine 2-epimerase; KEGG:
FT                   bxe:Bxe_A4285 putative N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69342"
FT                   /db_xref="GOA:B2JKF3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR034116"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF3"
FT                   /protein_id="ACC69342.1"
FT                   /translation="MKQPDTTLSNNTANDKAPPVASFRDGAFLLSHIEDTLRFYAPNVF
FT                   DPSGGFFHFFRDDGSIYNRTTRHLVSSCRYVFNYAMAYRQFGEPQHLEYAQHGLKFLHD
FT                   GHWDPHHQGYDWEADWRDGHRRTLDATRHCYGLAFVLLAYAHAAMAGIEEAKPMIAATF
FT                   ELMEHRFWDPAAGLYADEATADWRVSSYRGQNANMHTMEALLAAYEATGHLVYLDRAER
FT                   VATNIALRQAKLSQGLVWEHFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLI
FT                   LERHRPLPWLLPRAIELFDAAMTHAWDHDHGGLYYGFGPDRTVCDHDKYFWVQAETFAT
FT                   AALLGKRTGNERFWDWYDEIWRYSWTHFVDHRYGAWYRILTCDNRKYSDEKSPAGKTDY
FT                   HTMGACYEVLHHALQTSSTSA"
FT   gene            complement(166299..167285)
FT                   /locus_tag="Bphy_0150"
FT   CDS_pept        complement(166299..167285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0150"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: bxe:Bxe_A4284
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69343"
FT                   /db_xref="GOA:B2JKF4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF4"
FT                   /protein_id="ACC69343.1"
FT                   /translation="MATTIRDVARAASVSIGTVSRALKNQPGLSESTRERVVETARRLG
FT                   YDSAQLRPRIRRLTFLLHRHHSNFSVSPFFSHVLHGVEDACRERGIVPSVLTAGPTEDV
FT                   VQQMRLHAPDAIAVAGFVEPETLTTLAAMKRPLVLIDLWAPDLRSVNLDNQAGAALAMQ
FT                   HLFAQKRTRIAFIGGSLAHYSIAQRALGYRRAFFEAGLLFDPSLEVTIHAGLDPDSGAA
FT                   LAMEQLLDRPGPRPDAVFAYNDLAALAALRVCVARGLRVPEDIAIVGFDDIPAAAHARP
FT                   PLTTIAVDKEALGRRGVELLLDDTPSALDIRIPVQLVVRASTSVNTP"
FT   gene            complement(167683..169524)
FT                   /locus_tag="Bphy_0151"
FT   CDS_pept        complement(167683..169524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0151"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; CBS domain containing protein; EAL
FT                   domain protein; KEGG: bxe:Bxe_A4283 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69344"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF5"
FT                   /protein_id="ACC69344.1"
FT                   /translation="MSQRSPSLLAAPRIVDLIAQRDLSAVFQPIVDFEDGAILGYEGLI
FT                   RGPAGTALETPYALFAQAAAEGSVIALERAAAHTCIEAFARLKCECKLFLNFSAGAIRQ
FT                   LADERDDTFTMLRNMGVHAGRIVIELTEQSAIPDVASFLPAISLLRMAGAQFALDDYGT
FT                   ANASMNLWVRLRPDVVKIDRFFIHDIASDPLKFEAVKAMQHFAAASGARLVAEGIEKEA
FT                   DLIVVRDMGIACGQGYFLGKPSAHPPPLVADNAREALRSRHIAVFPEATRAVVSASPSG
FT                   GMASTKMVVHAPALPRDATNNDVLELFNRLPNLHAVAVVEEDEPVALINRRAFMDRYAL
FT                   PYHRELFGKRPCMLFANESPVVIEKSMTVEDMAKLLANDDQRYLADGFVITEHGQYVGL
FT                   GTGESLVRAVTEVRIEAARYANPLTFLPGNIPISSHITRLLSHEAGFHACYADLNHFKP
FT                   FNDQYGYWQGDEVLKFAAHVLADVCDPTRDFLGHVGGDDFLVLFQSEDWHARAQRAIHT
FT                   FNEGAQRFYGPGDRLAGGIHGEDRRGNPSFYGFVTMAIGCVQVQPQCNDAAYSSEDIAS
FT                   VAALAKRRAKREASGLVMVEFNEGRMVLQGRTTATVD"
FT   gene            complement(169801..170823)
FT                   /locus_tag="Bphy_0152"
FT   CDS_pept        complement(169801..170823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0152"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bxe:Bxe_A4282 putative sodium/bile acid symporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69345"
FT                   /db_xref="GOA:B2JKF6"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF6"
FT                   /protein_id="ACC69345.1"
FT                   /translation="MARPKLLPDNFTLCLIGTVIFASLLPVHGQAALAFNWVTDIAVGL
FT                   LFFLHGAKLSREAIIAGATHWRLHLVVLLSTFALFPVLGLVLKPLLSPLVTPALYAGIL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCSASASSLLGIFITPALVSVIVTNQAASGGSP
FT                   WHTVWNIVLQLLVPFVAGQLLRPMIGGWIERNRSVLKFVDQGSILLVVYGAFSEAVNEG
FT                   LWHQMPLAALGGLLAVCAVLLALALAVTMFVSKRLGFSRADQITIIFCGSKKSLAAGVP
FT                   MAKVIFATHAVGAVVLPLMLFHQIQLMVCAALAQRWGARDVSAEKRAAQKGTTTAVARR
FT                   "
FT   sig_peptide     complement(170734..170823)
FT                   /locus_tag="Bphy_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.703 at
FT                   residue 30"
FT   gene            171381..171995
FT                   /locus_tag="Bphy_0153"
FT   CDS_pept        171381..171995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF7"
FT                   /protein_id="ACC69346.1"
FT                   /translation="MVLAGLSRIKWWVTGALVVALTSLAYAKPSFVQHDGHGLFGGRTG
FT                   FQGAAFSGPVHGHAAPRENISREMPRGVSMHGGRYTRNDTAHAPGTSPSGRAGVNDTFA
FT                   GRAWGGNASNYGAQRMMVPSDVYRNRPAAQYVGTQYAGAITPVSTDSRNAPRPPSNAQS
FT                   AHVGSIRDDVTRYNEERGASRQIPRPPGDTSRIPPSSPYRN"
FT   sig_peptide     171381..171464
FT                   /locus_tag="Bphy_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.976 at
FT                   residue 28"
FT   gene            172525..173628
FT                   /locus_tag="Bphy_0154"
FT   CDS_pept        172525..173628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0154"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_A4279
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69347"
FT                   /db_xref="GOA:B2JKF8"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF8"
FT                   /protein_id="ACC69347.1"
FT                   /translation="MNTTVSRALRTGREASPKATFKATVIGALLAIASTSSFAQSSVQL
FT                   YGQVDEWVGVTKFPGSQAAWNVSGGGMSTSYWGIKGAEDLGNGYKAIFTLEDFFRAQNG
FT                   KYGRFDGDTFFGRNAYVGIESPYGTVTAGRLTTQLFVSTILFNPFIDSYVFSPMVYHVF
FT                   LGLGTFPTYTTDMGVVGDSGWNNAIQYSTPDFSGLSGSAMYALGNSADHNGSKKYSAQF
FT                   LYFHGPFAATGVFQYVNFNNSPTDLGSLVAGLKSQSVGQVGVSYDLKYVKFYGQYMYTK
FT                   NDQDVSSWHVNTAQGGVSVPLGTGTVMASYAYSRDSGGLDQMHQSAAIGYDYPLSKRTD
FT                   VYAAYLYDKYTSLASGYTAGVGLRAKF"
FT   sig_peptide     172525..172644
FT                   /locus_tag="Bphy_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 40"
FT   gene            173794..174732
FT                   /locus_tag="Bphy_0155"
FT   CDS_pept        173794..174732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0155"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4278 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69348"
FT                   /db_xref="GOA:B2JKF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKF9"
FT                   /protein_id="ACC69348.1"
FT                   /translation="MDTLVSMKVFRHVVEVGSFVGASEKMDMSAAMASKHVMHLEQQLG
FT                   ARLLNRTTRRVAPTEAGREYYERLSQVLSELDEAEQAVGAASVVPQGRLRVSSLSAFGL
FT                   RHVMSAVADYATQHPQVTVDITLSDRVVELIDEGFDVAIRASPSGLKSSSLIARQVATA
FT                   HLVLCASPEYIERHGAPKSAADLTRHNIIQYSGVSALELVAGANAESGRVKLSGNLIVN
FT                   HLEAQRVVVLQGAALALLGTEVIGDDLAAGRVVPLLIDELPPRELPIHVVYASRRHLSA
FT                   KVRSFVDFIAERFSSEPLWPTLEQIKALALR"
FT   gene            174860..178243
FT                   /locus_tag="Bphy_0156"
FT   CDS_pept        174860..178243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0156"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: reh:H16_A0280 methylmalonyl-CoA mutase;
FT                   TIGRFAM: methylmalonyl-CoA mutase, large subunit; PFAM:
FT                   ArgK protein; methylmalonyl-CoA mutase; cobalamin
FT                   B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69349"
FT                   /db_xref="GOA:B2JKG0"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG0"
FT                   /protein_id="ACC69349.1"
FT                   /translation="MTDLSTPQRIGDDAHASHSSTPRAPGAQSSRRLRFVTAAALFDGH
FT                   DASINIIRRILQASGVEVIHLGHNRAVEEVATAALQEDADGIAVSSYQGGHIEYFRYLV
FT                   DLLRERGGAGIKVFGGGGGVIVPDEIAALQQYGVERIYSPHDGQRLGLQGMIDDMIARC
FT                   RDAARPRPDTPQPSKLVRDLKDALRGDADGVARLAAFRELARLITSLETGDLDPAIRAE
FT                   LAARAKQANVPVLGITGTGGAGKSSLSDELIRRFRLDYGDAMTIAVIAIDPSRRKSGGA
FT                   LLGDRIRMNAIGDWGDGARVFMRSLATRDASSEISDALPDTINACKMTGFDLIVVETSG
FT                   IGQGDAAIVPHADTSLYVMTPEFGAASQLEKIDMLDFADFVAINKFDRKGAADALRDVA
FT                   KQVQRNQQKFAAKIDEMPVFGTIASRFNDDGVTAVYQHIAAALRSHGLRESEARLPKLE
FT                   GLRHSSGRNAIVPPERVRYLSDVALMVRAYRERADKQSQLARERWQLDEARRMLNDASG
FT                   NVADAAAFDSLIDARTSQLGEREKALLEAWPKTVAAYSGDEHVVKIRGNEIRTALTVET
FT                   LSGSRIRKVALPAYKDPGEILRWLMLDNLPGYFPFTAGVFPFRRENEDPTRMFAGEGDP
FT                   FRTNRRFKLLSDGVPAKRLSTAFDSVTLYGEEPNERPDIYGKVGNSGVSVATLDDMKAL
FT                   YDGFDLCAPETSVSMTINGPAPTILAMFFNVAIDQQIALAHAKAQQQGRAPSHDELDAA
FT                   RRFALENVRGTVQADILKEDQGQNTCIFSTEFSLKVMGDIQAYFVEHGVRNFYSVSISG
FT                   YHIAEAGANPISQLAYTLANGFTYVEAYLARGMDIDDFAPNLSFFFSNGMDPEYTVLGR
FT                   VARRIWAVAMRERYGANERSQKLKYHVQTSGRSLHAQEIDFNDIRTTLQALIAIYDNCN
FT                   SLHTNAFDEAITTPTEDSVRRAVAIQLIINREWGLAKNQNPNQGSFVIDELTDLVEAAV
FT                   LTEFDRLTERGGVLGAMETGYQRGRIQDESMLYEHRKHDGSYPIVGVNTFLGAHAHDAP
FT                   PPVALARSTENEKQGQLKRLRTFQSRNQSDAPAMLERLKRAVIDDQNVFAVLMDAVRVC
FT                   SLGQITHALFEVGGQYRRNM"
FT   gene            complement(178306..179265)
FT                   /locus_tag="Bphy_0157"
FT   CDS_pept        complement(178306..179265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0157"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   bxe:Bxe_A4276 putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69350"
FT                   /db_xref="GOA:B2JKG1"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG1"
FT                   /protein_id="ACC69350.1"
FT                   /translation="MALPAVLQHLSLPVVASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQIQASLAEHKAANPDAVIGPIAVNQIVHQSNARLEHDIRVCVEHKVPI
FT                   FITSLRAPAKEIVDAVHSYGGIVLHDVINLRHAQKALEAGVDGLILVAAGAGGHAGTTS
FT                   PFALVGEVRRMFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATKEAHAVEGYKQ
FT                   AIIHSNSADIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGSDKAKAWKDI
FT                   WGAGQGVGLMHDVPSVADLVARLKDEYETAKARLGIGG"
FT   gene            179525..180415
FT                   /locus_tag="Bphy_0158"
FT   CDS_pept        179525..180415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0158"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A4275
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69351"
FT                   /db_xref="GOA:B2JKG2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG2"
FT                   /protein_id="ACC69351.1"
FT                   /translation="MPFADFTPFRFTAGDVDIFGVKGGAGPPLLLLHGHPQTHLIWHRC
FT                   ASQLAGHFTVIATDLRGYGASAKPPSDATHAPYSKRAMAADQVAVMRHFGYERFLVCAH
FT                   DRGARVAHRMALDFPDFVERLMLLDIAPTLAMYEATDRAFATAYFHWFFLIQPEPLPET
FT                   LIEGNPDVYVDRVMGSRAAGLAPFAPAVLAEYRNALRQPGAVHAMCEDYRASATIDLEH
FT                   DRAAVERGHKIACPVRVLWGAQGVIERCFEPMAEWRKVARDVSGRSLACGHYIPEEAPG
FT                   ELVPEMLSFFEAVEL"
FT   gene            complement(180445..180930)
FT                   /locus_tag="Bphy_0159"
FT   CDS_pept        complement(180445..180930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0159"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bpd:BURPS668_0348 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69352"
FT                   /db_xref="GOA:B2JKG3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG3"
FT                   /protein_id="ACC69352.1"
FT                   /translation="MPKNLTGAEKRAPAPATLDDTDRMLLASLADDARQPISELARHVG
FT                   LSAPATADRLRRLNTQGVIERFTVQIDPRALGYTLQAIVRVKPLPGQLHLVEEVIRRIP
FT                   EFVECDKVTGDDCFICRLYLRSIDQLDEILLKVTERAETSTAIVKSTPVSRRLPPLA"
FT   gene            181042..181941
FT                   /locus_tag="Bphy_0160"
FT   CDS_pept        181042..181941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0160"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bch:Bcen2424_2962 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69353"
FT                   /db_xref="GOA:B2JKG4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG4"
FT                   /protein_id="ACC69353.1"
FT                   /translation="MTTGNEVRQGAFEMTLAMLMSGTIGWLVVSSQQSALNVAFFRCLF
FT                   GGATLLLICAARGLLARKLFSWKMIALATLGSAAIVANWVLLFAAYSRASISMATTVYS
FT                   TQPFMLVALGALVFRERVTASTVVWLLIAFIGLVFVVKVEPAVLAVPGQYLQGVAYAVG
FT                   AAFLYAVSSIITKHLKNTPPHLIALITVATGVVVLAPSVQYDALPSTGMHWLQLVTLGV
FT                   VNTGIMYVLLYGAIQKLPTAMTGALSFIYPVVAIIVDRVAFGQKLAWIQVLGAVLILLA
FT                   AAGVNLGWRIVPARRYSI"
FT   gene            complement(182173..183093)
FT                   /locus_tag="Bphy_0161"
FT   CDS_pept        complement(182173..183093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0161"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bxe:Bxe_A4274 putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69354"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG5"
FT                   /protein_id="ACC69354.1"
FT                   /translation="MIALPASVRVFERGWLSSNNVLLVDDACAALVDTGYASHAAQTVA
FT                   LVRHALGARPLDLIVNTHLHSDHCGGNAQLQATWPCRTLIPSTEADAVHAWDETRLTFR
FT                   ATGQLCPRFAFSGTIEPGTRLTLGALVWDVLGAPGHDPHSLMLYCAEHQLLISADALWQ
FT                   NGFGVIFPELDGESGFAEQQAVLELIGTLDVKTVIPGHGAPFSDVHAALDRALSRVAWL
FT                   RADPSRNAKNALKVLIVFKLLDAGAMSFAALLRMVDEASVMRAAASMLKPRSAWPALLR
FT                   EMVEGLAADSGPLRFDGERISARAE"
FT   gene            complement(183090..183545)
FT                   /locus_tag="Bphy_0162"
FT   CDS_pept        complement(183090..183545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0162"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bxe:Bxe_A4273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69355"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG6"
FT                   /protein_id="ACC69355.1"
FT                   /translation="MNTPPRVVTIGETFGATLTLSSESIKSFATTVNDLNPLHHDETYA
FT                   AQSRFGGLIASGTQPTAHFMALLATHFSTYAQPLGLEFDIKLKKAVHSGDTLTMTWRVL
FT                   GAYWKASLNGDLTQLEGSIANQHAETVVTGKSTILVMPRPATQAGAA"
FT   gene            complement(183542..183790)
FT                   /locus_tag="Bphy_0163"
FT   CDS_pept        complement(183542..183790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0163"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   bxe:Bxe_A4272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69356"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG7"
FT                   /protein_id="ACC69356.1"
FT                   /translation="MTACTARTQSTAPGIAPVPSPCINVCRMDKATNLCEGCLRTIDEI
FT                   ANWSSFDDAAKRAVWDEIEARHAGIKSKHADRREAKT"
FT   gene            complement(183787..184320)
FT                   /locus_tag="Bphy_0164"
FT   CDS_pept        complement(183787..184320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0164"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_A4271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69357"
FT                   /db_xref="GOA:B2JKG8"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG8"
FT                   /protein_id="ACC69357.1"
FT                   /translation="MSDNATVRQPSHTPELDALPDSARRVAMLLRERGHAGHVVMLPET
FT                   GKTSAEAAAGLGCSIAQIAKSILFRRREDDAPVLIVASGANRVDEKKVAAQVGDIARAD
FT                   AKFVREKTGYAIGGVCPIGHATPPVTLIDADLFTLDSLWAAAGHPHAVFNLTPQELAAL
FT                   TDAPVVEIALRETA"
FT   gene            complement(184342..185268)
FT                   /locus_tag="Bphy_0165"
FT   CDS_pept        complement(184342..185268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0165"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bxe:Bxe_A4270 putative hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69358"
FT                   /db_xref="GOA:B2JKG9"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKG9"
FT                   /protein_id="ACC69358.1"
FT                   /translation="MAMPQAVKIVEVGPRDGLQNEKEFVPTEVKIELINRLSAAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIARRPGTIYSVLTPNLRGFEGAVAAHADEIVIFGAA
FT                   SEAFSQKNINCSIAESIERFVPVAQAAKEKGIRIRGSVSCSLGCPYQGEVPVASVVDVV
FT                   ERFAALGCDEIDIADTIGVGTPKRTREVFAAVTQVFPRERLSGHFHDTYGQALANIYAA
FT                   LQEGIEIYHASVAGLGGCPYAKGATGNVATEDVLYLMNGLGIDTGIDLAQVVEIGDFIS
FT                   TSIGRPNVSRAGKALLAKARSEKTNCV"
FT   gene            complement(185385..186326)
FT                   /locus_tag="Bphy_0166"
FT   CDS_pept        complement(185385..186326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0166"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: bxe:Bxe_A4269 putative 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69359"
FT                   /db_xref="GOA:B2JKH0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH0"
FT                   /protein_id="ACC69359.1"
FT                   /translation="MKVLYYTPQSDADAWLRDLSRALPGADLRVWQAGDDAPADIAIVW
FT                   KPPRDMLAGRTDLRAIFNLGAGVDAILKLERDHPGTLPRNAQLVRLEDTGMAQQMSEYV
FT                   GHAVLRYMRRFDEYDRLKAERRWHVLEPHARETFTVGVLGLGVLGSHVAKSLVSLGFPV
FT                   RGFSRSAREIEGVDTFAGETQFDAFLNGVKVLVNLLPHTPDTNGVLNARNLSKLAHGAY
FT                   LVNIARGAHLVEQDLLDALEQGQIAAATLDVFVEEPLPAQHPFWTHPRIAITPHISALT
FT                   LREESVVQIAQKIGALMRGEPIGGIVDIERGY"
FT   gene            186570..187172
FT                   /locus_tag="Bphy_0167"
FT   CDS_pept        186570..187172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0167"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   bxe:Bxe_A4268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69360"
FT                   /db_xref="GOA:B2JKH1"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH1"
FT                   /protein_id="ACC69360.1"
FT                   /translation="MFSCTRSIWPPRLVTVPGLHGSEGAHWQTWLERQFPRSLRVEQAD
FT                   WDAPNLGQWAQAVRDLLARERGPFVLAAHSFGCLATAHALQQGVPAADIAGVLFVAPAS
FT                   PKKFEYAGAFDARRLGVPSILIGSETDPWMPLAGARELATHLGSAFVNLGDAGHINTAA
FT                   GYGPWPRAKYLVDTLAHCAAPLRFQDEGEELATQVFS"
FT   gene            complement(187197..187427)
FT                   /locus_tag="Bphy_0168"
FT   CDS_pept        complement(187197..187427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69361"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH2"
FT                   /protein_id="ACC69361.1"
FT                   /translation="MARAETTIEHILQDLADLKREVRELKTYVDERLRQLEAKMDARFS
FT                   ALETSMRTECRLLWAANFALAGMLAKGFHWI"
FT   gene            187790..188815
FT                   /locus_tag="Bphy_0169"
FT   CDS_pept        187790..188815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0169"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: bxe:Bxe_A4267 putative ABC sulfate
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69362"
FT                   /db_xref="GOA:B2JKH3"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH3"
FT                   /protein_id="ACC69362.1"
FT                   /translation="MAGRGDKARGLAAGFTALTLALGAAQNAHADASLLNVSYDVTREL
FT                   YKDINTAFVAAYKQKSGETVAIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAER
FT                   GHLVPDNWRARLPNNSAPYTTTMVFLVRKGNPKHIKDWDDLAKPGVQVVIPNPKTAGNG
FT                   RYTYLAAWGYKKQNGATDAQALDFEKSIFRNVPVLDTGGRGATTTFTQRGIGDVLVTFE
FT                   NEVSLIDTGVGAGSFEAVYPSISILAEPPVTIVDKVVDKRGTRKEAQAYLDYLYTAPAQ
FT                   EIIAQHHLRPRDPAVLAKHASEFKPLKTFTVEQVFGSWQKAQQSHFADGGTFDQIIVDR
FT                   K"
FT   sig_peptide     187790..187882
FT                   /locus_tag="Bphy_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            complement(188981..190036)
FT                   /locus_tag="Bphy_0170"
FT   CDS_pept        complement(188981..190036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0170"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: bxe:Bxe_A4266 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69363"
FT                   /db_xref="GOA:B2JKH4"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKH4"
FT                   /protein_id="ACC69363.1"
FT                   /translation="MSQIQTAPLPVMPSQAAAAADAAASRWKVADVAALYELPFNDLLF
FT                   RAQQVHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVHHETGLKAEKLMEVEEVLAA
FT                   ARVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKSMGLETCVTLGMLEAHQAQALR
FT                   EAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLEHVRDAGINVCCGGIVGLGESRRER
FT                   AGLIAQLANMEPYPESVPINNLVQVEGTPLTGTEALDPFEFVRTIAVARITMPRAMVRL
FT                   SAGREQMDEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLLARLGIRAEAAQQMPA
FT                   ERECSHGCEGH"
FT   sig_peptide     complement(189977..190036)
FT                   /locus_tag="Bphy_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.739 at
FT                   residue 20"
FT   gene            complement(190073..190792)
FT                   /locus_tag="Bphy_0171"
FT   CDS_pept        complement(190073..190792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0171"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="KEGG: bxe:Bxe_A4265 dethiobiotin synthase; TIGRFAM:
FT                   dethiobiotin synthase; PFAM: Cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69364"
FT                   /db_xref="GOA:B2JKH5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKH5"
FT                   /protein_id="ACC69364.1"
FT                   /translation="MSPALSLFVTGTDTEIGKTLVSAALLRGFVRDGLRAAAMKPIAAG
FT                   ATLVNGVLHNEDADQLDAAANVLLPPDIRTPFMLKEPAAPHIAAAHESVTLDMARIVDA
FT                   HEAALQMADVVVVEGVGGFRVPLTDSHDTADLAFALNLPVVLVVGMRLGCISHALLTAE
FT                   AIAARGLRVVGWVANRVDPAMLFPDENIDTLRDRLARQYDAPLLGSVPHLSPASPDVAA
FT                   THLDTTRLLHALRTAPR"
FT   gene            complement(190789..191973)
FT                   /locus_tag="Bphy_0172"
FT   CDS_pept        complement(190789..191973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0172"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: bxe:Bxe_A4264 8-amino-7-oxononanoate synthase;
FT                   TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69365"
FT                   /db_xref="GOA:B2JKH6"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="PDB:6ONN"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKH6"
FT                   /protein_id="ACC69365.1"
FT                   /translation="MQLLDTLEQGLKEIDARGLRRRRRTVDSPCSAHMTVDGRNMIGFA
FT                   SNDYLGLAAHPLLVAAITEGARRYGAGSGGSHLLGGHSRAHAQLEDDLAEFAGGFVDNP
FT                   RALYFSTGYMANLATLTALAGRGTTLFSDSLNHASLIDGARLSRADIQIYPHADAEALG
FT                   AMLEASDAAVKLIVSDTVFSMDGDIAPLARLLELAEHHGAWLVVDDAHGFGVLGPQGRG
FT                   AVAEAALRSPHLIVVGTLGKAAGVSGAFVVAHETVIEWLVQRARPYIFTTASVPSAAHA
FT                   VSASLRIIGGDEGEHRRAHLRSLIALTRDMLKSTPWLPVDSHTAVQPLIIGSNEATLDV
FT                   AASLDRANLWVPAIRPPTVPEGTSRLRISLSAAHSHNDLEQLEHALMKTAEARA"
FT   gene            complement(191973..193319)
FT                   /locus_tag="Bphy_0173"
FT   CDS_pept        complement(191973..193319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0173"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   bxe:Bxe_A4263 adenosylmethionine--8-amino-7-
FT                   oxononanoateaminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69366"
FT                   /db_xref="GOA:B2JKH7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH7"
FT                   /protein_id="ACC69366.1"
FT                   /translation="MNTQATEDWIVRSLRAVWHPCTQMKHHERVPLVPVSRGAGAWLYD
FT                   RAGHRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAMLAGCTHEPAIELAERLRAL
FT                   TQDTLGHAFFASDGASAVEIALKMSFHSWRNRGYDGKREFVCVANSYHGETIGALGVTD
FT                   VALFKDAYDQLIRNAHVVASPDARLAREGETAAEVAQRALDDVRALFESRAGNIAALIV
FT                   EPLVQCAAGMAMHDPSYIAGLRALCDRYGVHLIADEIAVGCGRTGTFFASEQAGVWPDF
FT                   LCLSKGISGGYLPLSIVLSRDEIYAAFYDDDTTRGFLHSHSYTGNPLACRAALATLDLF
FT                   ASDNVLAANATKSAALRAALEPLAQHAQVRNLRQRGTIFAFDAVVHDADAAKTFSRRFF
FT                   ENALQRELLLRPIGTTVYLMPPYILDDEEIALLAERTRATFDATLTGAR"
FT   gene            complement(193893..195182)
FT                   /locus_tag="Bphy_0174"
FT   CDS_pept        complement(193893..195182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69367"
FT                   /db_xref="GOA:B2JKH8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH8"
FT                   /protein_id="ACC69367.1"
FT                   /translation="MVFSKVLSVGAMSAALLASGVTAAHADPLADAEAGPLGRAQVQRL
FT                   ALDEDGYLPVVKLSEQIIRIPVDTDGNVTLETTVYKPEGPGPFPMVVFNHGKIHGDPRA
FT                   QTRSDPVSLAREFVRRGYVVVAPNRQGFAESGGSYVQDGCDVTRNGLSQAADVATTVDY
FT                   MSKQSYVDAKHIVVAGTSHGGLATIAYGTNAAPGVRGLINFSGGLRQDACTDWQGNLTN
FT                   AFRTYGESTHVPSLWLYGDNDSIWPSTLVSQMYTAYTRNTEGKGVNAKMVDFGAYKNDA
FT                   HRLVGDRDGVRVWWPSVEAFLARVGMPTGVQYRVAEPTQPTPTHFAKIDAVDSVPFVDE
FT                   AGRAGYRNFLHQYPSRAFAVSDSGAWSWAEGGDDPMSVAIANCQKQSSGPCRLYAVNDS
FT                   VVWKDGSTQTADADADSSSKEGSKPALASR"
FT   sig_peptide     complement(195102..195182)
FT                   /locus_tag="Bphy_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 27"
FT   gene            complement(195745..196191)
FT                   /locus_tag="Bphy_0175"
FT   CDS_pept        complement(195745..196191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69368"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKH9"
FT                   /protein_id="ACC69368.1"
FT                   /translation="MTASAKQRPVECPCGGAAPNRRNTDKPPRFSDCCGRYIDGGAAAP
FT                   NALELMRSRYSAYVLGESHYLRDTWAPQTCPADLDIDISAPDAPRWLGLQIKRFSPLDD
FT                   THAEVEFVARYKAGGRAHRLHECSRFTRGEDARWRYVDGDVSDR"
FT   gene            complement(196210..197340)
FT                   /locus_tag="Bphy_0176"
FT   CDS_pept        complement(196210..197340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0176"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bxe:Bxe_A4257
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69369"
FT                   /db_xref="GOA:B2JKI0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI0"
FT                   /protein_id="ACC69369.1"
FT                   /translation="MLLDQDHLMIRDAVRTFVREAVAPNAAQWDRERIFPADAHRQLAE
FT                   LGAYGVLVPEEYGGAGLDALALALILEEIAAGDGGTSTAISVNNCPVCSILLTYGNEQQ
FT                   KRDWLTPLARGEMLGAFCLTEPQAGSDASALRTTATRDGDGYMLNGVKQFITSGKNGNV
FT                   AIVMAVTDKNAGKRGISAFIVPTETPGYLVARLEEKLGQHSSDTAQIVFDNCRVPAANL
FT                   IGSEGEGYRIALSGLEGGRIGIAAQSVGMARAAFEAALAYAKERESFGQALFSHQAVQF
FT                   RLADMATQLEAARQLIWHAASLKDAGQPCLTEAAMAKLFASEAAERICSAALQIHGGYG
FT                   YLSDFPVERIYRDVRVCQIYEGTSDIQKILIARGLS"
FT   gene            complement(197377..198054)
FT                   /locus_tag="Bphy_0177"
FT   CDS_pept        complement(197377..198054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0177"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_A4256 putative short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69370"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI1"
FT                   /protein_id="ACC69370.1"
FT                   /translation="MKTVLIVGASRGIGREFVKQYRHDGWRVLATARDAQSLGELVTLG
FT                   AEALSLDVAAPEDIAGLGWKLDGERLDAAVIVSGVYGPQTEGIETVTAEDFDFVMTTNV
FT                   RGPMQLIPVLLPLVEDAQGVLAVLSSRMGSINDTTGTTGWLYRASKAALNEVLKVTSVQ
FT                   TRRATCVSLHPGWVRTDMGGASAAVDPAQSVRGMREVLAQAASTPHLFHGRFFQFDGTA
FT                   LEW"
FT   gene            complement(198103..199293)
FT                   /locus_tag="Bphy_0178"
FT   CDS_pept        complement(198103..199293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0178"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bxe:Bxe_A4255 putative acetyl-CoA
FT                   acetyltransferase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69371"
FT                   /db_xref="GOA:B2JKI2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI2"
FT                   /protein_id="ACC69371.1"
FT                   /translation="MSETQDPVVIVSVARTPMAAFQGDFASLTAPQLGAIAIKAAVERA
FT                   GLKPEQVEEAVIGCVLPAGQGQAPARQAALGAGLPLSTGSTTVNKMCGSGMRAAMFAHD
FT                   MLSAGSVDVVVAGGMESMTNAPYLLPKARGGMRMGHGQVLDHMFLDGLEDAYEKGRLMG
FT                   TFAEECAGSFDFTREAQDKFAVESLMRAKRANEDGSFAWEIAPVTIEGKKGSVTVERDE
FT                   QPFKANLDKIATLKPAFSKTGTVTAANSSSISDGAAALVMMRESTAKKLGVTPLARVVG
FT                   HATFAQEPAKFTTAPVGAIRKLFEKNGWKADDVDLYEINEAFAVVTMAAMKEHNLPHDK
FT                   VNVNGGACALGHPIGASGARILVTLIGALRKRGLKRGVASLCIGGGEATAMGVELF"
FT   gene            complement(199286..200062)
FT                   /locus_tag="Bphy_0179"
FT   CDS_pept        complement(199286..200062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0179"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bxe:Bxe_A4254
FT                   putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69372"
FT                   /db_xref="GOA:B2JKI3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI3"
FT                   /protein_id="ACC69372.1"
FT                   /translation="MTTNASSAEHPLAHLFANNDAWVTHKLEDDPEFFSRLAHQQAPEY
FT                   LWIGCADSRVPANEIIGLPPGEVFVHRNIANVVVHSDLNCLSVVQFAVDLLKIKHIMVV
FT                   GHYGCSGVGAALLGRRVGLADNWLHHVQDVRTKHASLLEEWPMGEARHRRLVELNTIEQ
FT                   VVNVCRTTILNDAWARGQDLTVHGWVYGVHDGRVRDLGMTVKDPARLEETYTSCVAAVS
FT                   ASRAHTADNDVVAADAAKLGDVAAVVHGVIKEMKHE"
FT   gene            complement(200123..201931)
FT                   /locus_tag="Bphy_0180"
FT   CDS_pept        complement(200123..201931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0180"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: bxe:Bxe_A4253 (isocitrate dehydrogenase (NADP+))
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69373"
FT                   /db_xref="GOA:B2JKI4"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKI4"
FT                   /protein_id="ACC69373.1"
FT                   /translation="MNHFPKLLSSQIGFDVAETLLAGFDRHYCIFREAAIRAKNLFEAA
FT                   DWHGLQKLARERITSYDERVRECIAKLEDEYDAENIDDDVWQQIKLHYIGLLTTHRQPE
FT                   CAETFFNSVCCHILHRSYFNNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGKDGLAVT
FT                   LERIVTNFQLNPPFENLTRDVQCVIQALRDNFGTFNEAPNFQIHVLSSLFFRNKAAYII
FT                   GRIINGDMMLPFALPVHHVKPGLLALDALLCKRDQLLIIFSFAHSYFLVDMEVPSAYVE
FT                   FLGSILHGKPKAEIYTSVGLQKQGKNLFYRDLLRHLKHSSDRFIIAPGIKGMVMLVFTL
FT                   PSFPYVFKLIKDAFPPPKETTREQVVGKYQLVKRHDRLGRMADTLEYSSVALPLSRLDD
FT                   ALIRELEKEAPSMLEYEGDNLVIRHVYIERRMVPLNIFLQNGTDADIEHGIREYGNAVK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRAVPPPRNEEDEMSGEPW
FT                   YSVGPHDIFPETYNTFLLGDPRVRESFLKHHADFFDPALWQKQKDYILRGELPDFYPYD
FT                   RSLRFSIRYPERFAADHVTAATERAA"
FT   gene            complement(202155..202589)
FT                   /locus_tag="Bphy_0181"
FT   CDS_pept        complement(202155..202589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0181"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: bxe:Bxe_A4252
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69374"
FT                   /db_xref="GOA:B2JKI5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI5"
FT                   /protein_id="ACC69374.1"
FT                   /translation="MNTQYTITELAREFDVTPRAIRFYEDQGLLSPSREGSSGLRRVYS
FT                   GRDRTRLRLTLRGKRLGFTLSEIRDLLDLYDSPTDTLPQLQAFLATVIRHREVLERQRE
FT                   DLNATLEDLAQYEAQARALLESGTRSDGYGGAETPRTKLR"
FT   gene            202753..203823
FT                   /locus_tag="Bphy_0182"
FT   CDS_pept        202753..203823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0182"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bch:Bcen2424_2925 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69375"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PDB:6AO1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI6"
FT                   /protein_id="ACC69375.1"
FT                   /translation="MNALEHQLDYPFADGMPAAGTTQEVAPGVYWLRMPLPFALDHINL
FT                   WLLRDEIDGQKGWTIVDCGIASGEIKANWETVFDTALEGLPVLRVIVTHCHPDHLGLAN
FT                   WLCEGGDKKRWNVRLWITLGEYMLGRVMAAGDGSNAGGEGAARHFARHGLRDEASLDKL
FT                   RNRKSYYADLVPAVPGQYRRLRDGDALSIGARTWRVVTGFGHSPEHCALHAEADGVLIS
FT                   GDMVLPRISTNVSVFDIEPEGNPLALYLESLGRYETMAADTLVLPSHGKPFRGLHTRIG
FT                   QLRDHHAARLAEVRAACADKPCSAADIVPIMFRRALDIHQMTFAMGEALAHLHLLWLQG
FT                   ELTRVQGEDGVIRFRA"
FT   gene            complement(203927..205525)
FT                   /locus_tag="Bphy_0183"
FT   CDS_pept        complement(203927..205525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0183"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_A4250 putative ABC peptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69376"
FT                   /db_xref="GOA:B2JKI7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI7"
FT                   /protein_id="ACC69376.1"
FT                   /translation="MRFKLLAAAATLTALAIAPALSVAKPLTVCTESSPDGFDVVQYNS
FT                   LVTTNASADVIFNSLVSYDEAAKKVVPSLADKWDVSADGLTYTFHLRPNVQFQTTDYFK
FT                   PTRALNADDVVFTFDRMLNESNPWHKVTGASGFPHAQSMGLVKLIKSVSKVDDNTVKFE
FT                   LNEPNATFVSILTMGFASIYSAEYADQLLKADKTADLNAKPIGTGPFVLKTYTKDSIIR
FT                   YDVNPTYWGTKPKIERLIYAITPDAAVRAQKVKAGECQIALSPKPLDVADAKKDKSLAV
FT                   VQTPAFMTAFVALNTQKKPLDNQKVRAALNMAFDRTSYLKAVFDNTATPANNPYPPNTW
FT                   SYNKAVKPWPYDTEKAKKLLAEAGYPNGFETTIWVRPNGSVLNPNPKAGAEMLQADFAK
FT                   IGVKAEVKVIEWGELIKQAKQGQHDTLFMGWAGDNGDPDNYLSPLFSCNAVKSGINFAR
FT                   YCDPELDKLIAQGKETADQSKRTKAYEAAQQVIHDEALWIPLGYPTAAAITRTNVSGYR
FT                   VSPFGRQNFGAVTVQ"
FT   sig_peptide     complement(205451..205525)
FT                   /locus_tag="Bphy_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 25"
FT   gene            complement(205739..206551)
FT                   /locus_tag="Bphy_0184"
FT   CDS_pept        complement(205739..206551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0184"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bxe:Bxe_A4249 putative ABC Fe+3/siderophore transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69377"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI8"
FT                   /protein_id="ACC69377.1"
FT                   /translation="MTTRAVDAAGVEHAKAERGARIVSLVPSLTELLFALKLDAQIVGR
FT                   TGFCVHPRDKLRHVPKVGGTKAVKLDVVRALQPTHVIVNIDENERDTVEQLRAFVPHVV
FT                   VTHPLAPQDNLALYALFGALFDREDEASALSLALRAQLNAAAARAWPRQHVLYAIWREP
FT                   WMTVARDTYISAMLRLVNWHTLPDVPGGETGASRYPSFDLDAEWLTRVERILLSSEPYR
FT                   FTTQHCDALSQHARFKGKRVQLIDGEMVSWYGSRAIEGIAYLVDYARR"
FT   gene            complement(206555..207325)
FT                   /locus_tag="Bphy_0185"
FT   CDS_pept        complement(206555..207325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0185"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A4248 putative short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69378"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKI9"
FT                   /protein_id="ACC69378.1"
FT                   /translation="MSSPLKVFITGASSGIGEALAAEYARRGAILGLVARRGDALARFR
FT                   ASHPQNTISVYAVDVRDADALAHAAQRFIAEHGCPDIVIANAGISRGAVTGHGDLQTFR
FT                   DVMDINYFGMVATFEPFAQPMIAARTGALVGIASVAGVRGLPGSGAYSASKSAALKYLE
FT                   ALRVEMRPLGVSVTTIAPGYIRTPMTAHNPYSMPFLMDADRFAAKVADAVARRKRFAIF
FT                   PWQMRFAAMLLHVAPRWLYDAVFEKAPRKPRAAQ"
FT   sig_peptide     complement(207260..207325)
FT                   /locus_tag="Bphy_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.951 at
FT                   residue 22"
FT   gene            complement(207344..207982)
FT                   /locus_tag="Bphy_0186"
FT   CDS_pept        complement(207344..207982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0186"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bxe:Bxe_A4247
FT                   putative thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69379"
FT                   /db_xref="GOA:B2JKJ0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ0"
FT                   /protein_id="ACC69379.1"
FT                   /translation="MKKLLSILFLSFGLVASAAHAAPAAPVAGKDYTVLSAPQPVEAPA
FT                   GKIEVIEFMWYGCPHCNEFDPYLEAWIKKQGPDVVFKRVPVAFRDDFIPHSKLYHAVDA
FT                   LGLANQLTPTIFHEIHVNKNYLLTPEDQAKFLAKNGVDSKKFMDAYNSFSTQSAVQRDK
FT                   KLMEDFRIDGVPTLAVQGKYETGPAQTNSLPGTIQVLDYLVAQVRAKKM"
FT   sig_peptide     complement(207917..207982)
FT                   /locus_tag="Bphy_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(208136..208933)
FT                   /locus_tag="Bphy_0187"
FT   CDS_pept        complement(208136..208933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0187"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   bxe:Bxe_A4246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69380"
FT                   /db_xref="GOA:B2JKJ1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ1"
FT                   /protein_id="ACC69380.1"
FT                   /translation="MAKPRRTTKQQSKQTGGTFLGIVLGLIVGLAIAVVVALYITRAPT
FT                   PFVAKVAPPAASDSGASQPQYDPNRPLQGKSPGQPVPQAAQPAPPNTAPGQTTNQSQTS
FT                   GMLEEPQIVEVPPSSNNGVAVAPKPAQDNGANANNGTTTAMIPPKKAQSPTSAPSTASI
FT                   APTQPKAGSTPNANGTPPAANDANTGYLLQVGAYKTAADAEQQRARLAFQGFESKVTQR
FT                   DAGGVTYYRVRIGPFSKFEDMNTTRQRLSDAGVDTAVIRFSKQ"
FT   sig_peptide     complement(208832..208933)
FT                   /locus_tag="Bphy_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.932 at
FT                   residue 34"
FT   gene            complement(209034..210818)
FT                   /locus_tag="Bphy_0188"
FT   CDS_pept        complement(209034..210818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0188"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bxe:Bxe_A4245 arginyl-tRNA synthetase, class
FT                   Ic; TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69381"
FT                   /db_xref="GOA:B2JKJ2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKJ2"
FT                   /protein_id="ACC69381.1"
FT                   /translation="MLPAHKHTLETLLTDVVKQVAQATQGESEAAFIAPAITLERPKVA
FT                   AHGDVACNVAMQLAKPMRANPRQLAQQIVDALLADPLAKGLVDGAEVAGPGFINLRLSA
FT                   ASKQAVIAAVFAQREAFGRSQREAGKRVLVEFVSANPTGPLHVGHGRQAALGDAMSNVL
FT                   ASQGFDVHREFYYNDAGVQIGNLAISTQARARGLKPGDPGWPEAAYNGEYIADIARDYL
FT                   NGETVSASDGEPVKGAGDVEDLEAIRRFAVAYLRHEQDMDLQAFGVKFDQYYLESSLYK
FT                   EGRVEKTVNELIAAGKTYEQEGALWLRTTDDGDDKDRVMRKSDGTYTYFVPDVAYHETK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLGIGIPKGYPDYVLHKMVTVMRDGQEVKIS
FT                   KRAGSYVTVRDLIEWSGGAVPGQEAAPDLLDEETIRRGRDAVRFFLISRKADTEFVFDV
FT                   DLALKQNDENPVYYVQYAHARICSVINEWKSRYGADETGLPVVDLSPLDSERATALLQK
FT                   LAEFPDMLTHAAGELAPHAVAFYLRDLAGEFHSFYNAERVLVDDEAQRNARIALLAATR
FT                   QVLANGLAVIGVSAPAKM"
FT   gene            211190..211516
FT                   /locus_tag="Bphy_0189"
FT   CDS_pept        211190..211516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0189"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   bxe:Bxe_A4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69382"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ3"
FT                   /protein_id="ACC69382.1"
FT                   /translation="MLITFKCRSAPDVIMLENLAQYLLGIIGKRLGARGVINHDELGVA
FT                   ISKLEAAIVTDKQERAEHEGHYHEGEEGHEPHELPVGLAQRAFPFLDMLRAAQKDNTDI
FT                   VWGI"
FT   gene            complement(211959..214676)
FT                   /locus_tag="Bphy_0190"
FT   CDS_pept        complement(211959..214676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0190"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: bte:BTH_I0357
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; Methionine synthase B12-binding module cap
FT                   domain protein; Vitamin B12 dependent methionine synthase
FT                   activation region; cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69383"
FT                   /db_xref="GOA:B2JKJ4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ4"
FT                   /protein_id="ACC69383.1"
FT                   /translation="MTDHTMRLSGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNNQ
FT                   FDEALAVARQQVENGAQVIDVNMDEAMLDSKAAMVRFMNLIASEPDIARVPIMIDSSKW
FT                   DVIEAGLKCVQGKAIVNSISLKEGKEQFVHHAKLIRRYGAASVVMAFDEQGQADTFARK
FT                   TEICKRSYDILVNEAGFMPEDIIFDPNIFAIATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYADLDAELRER
FT                   VEDVVLNRRDDATDRLLEIADKFKTGAAKKEENLEWRNQPVEQRLAHALVHGITNFIVE
FT                   DTEEARAKIMDGGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRLLAEAGGDVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   PCNEILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDDYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPNYEGPVVYVPDASRSVSVASNLLSDEGAAKYLDELKSDYNRIRDQHANKK
FT                   ALPLVTLAEARANKTKIDWSAYQPVKPKFIGRRVFRNFDLNELANYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDAKSMLARLIQGRWLTANGVIALLPANTVNDDDIEIYT
FT                   DESRSEVALTWRNVRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGLGV
FT                   DTKEKQFEKDHDDYSAIMLKALADRFAEAFAEAMHARVRRDLWGYAQGETLSNDELIGE
FT                   KYRGIRPAPGYPACPDHLVKRDMFSVLQADEIGMSVTESLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGQDQLEDYAQRMSLSIADAARALAPLL"
FT   gene            complement(214738..215808)
FT                   /locus_tag="Bphy_0191"
FT   CDS_pept        complement(214738..215808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0191"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   bxe:Bxe_A4240 putative homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69384"
FT                   /db_xref="GOA:B2JKJ5"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ5"
FT                   /protein_id="ACC69384.1"
FT                   /translation="MNQPAPSAVPARAGAAYTRGAALPALLESRILILDGAMGTMIQRY
FT                   KLDEAAYRGERFKDYARDIKGNNELLSITQPHVISEIHEQYLAAGADIIETNTFGATTV
FT                   AQADYGMEDLAVEMNRESAKLARAACDKYSTPDKPRFVAGAIGPTPKTASISPDVNDPG
FT                   ARNVTFDELRAAYYEQAKALMEGGADLFLVETIFDTLNAKAALFALDELFEDTGERLPI
FT                   MISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTY
FT                   VSCYPNAGLPNPMSDTGFDELPADTSGLLKEFAQAGLVNIAGGCCGTTPDHIAAIAKAL
FT                   SEVKPRKWPGQYRDAA"
FT   gene            complement(216124..216381)
FT                   /locus_tag="Bphy_0192"
FT   CDS_pept        complement(216124..216381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69385"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ6"
FT                   /protein_id="ACC69385.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQDGHLAMKSGGYEIVDKNTQREIYIDGE
FT                   MAASFREHVQKLIEDEPTLDEVDEFLGQFDSLMNQPVILH"
FT   gene            complement(216499..217287)
FT                   /locus_tag="Bphy_0193"
FT   CDS_pept        complement(216499..217287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0193"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A4238
FT                   3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69386"
FT                   /db_xref="GOA:B2JKJ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ7"
FT                   /protein_id="ACC69386.1"
FT                   /translation="MQINVNGIDTRYVMSNEGGGPWLTFVHQLGGDLSIWDQLAGYFRD
FT                   DFTVLRYDVRGHGQTSVSDRQFSVADLSQDLRALLNALGVENTHIVGMSMGGMIAQQFA
FT                   LDNPARVATLTLADTHAASPVDGRGTWEQRAAKAREEGVAALSQATMERWLTAGFRDAH
FT                   PEVVEQIREVFEHTSSEGYAQACIALRDFDVRSRLKEIALPTLTVAGRHDAGTPPAATQ
FT                   EIANAIRDAQFELLDAAHLAPIEQSQRFTALLESFVQKRV"
FT   gene            complement(217504..218733)
FT                   /locus_tag="Bphy_0194"
FT   CDS_pept        complement(217504..218733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69387"
FT                   /db_xref="GOA:B2JKJ8"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ8"
FT                   /protein_id="ACC69387.1"
FT                   /translation="MSSPSAVRSIPPARLARAQRRASRLRWTGVLAAVVGAHLIAAQWF
FT                   ERHHDAFKPVSPEHVPVQVALLKPERVETQAAGSPPPAKASPAAPKHAVRSPRDHVLTA
FT                   TRSRPKLHETAPATEPASAPVDASAASVASSATRTGAGSNANAAGEGNAQHTAPGVRFS
FT                   VPPSGNLQYDTFYNGVRNQPGTIHWSSDGRSYDMIVSVPLPFVGTFSYASHGHVDAFGL
FT                   APDQYVEKRGRRGEDITTFRRDTKQIGFTRTPVTLPLQDGAQDRFSMVMQLASLVRGDP
FT                   DAYQPGVTRQFYVTDNDSGEIWPIETIGDESVRTDRATLDARHFMRLPRREGDRRRIDV
FT                   WLAPSLGWLPVRLVQTEPNGTQIELVWRGKIASPDAGSNDNGSDTSSDDTSTSPPQPSL
FT                   TDPGAGPEKP"
FT   gene            complement(218859..219749)
FT                   /locus_tag="Bphy_0195"
FT   CDS_pept        complement(218859..219749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0195"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bxe:Bxe_A4236 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69388"
FT                   /db_xref="GOA:B2JKJ9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKJ9"
FT                   /protein_id="ACC69388.1"
FT                   /translation="MSPTARSSSIRKDADAAEPLDTVDDDAADSHESGEEKLRSGIQSI
FT                   EVGFRLLDVLTHEPRAMMLRDLAQRAAMSPAKAHRYLVSFQRLGVVAQDPLTGRYELGG
FT                   FALQLGLARLARVDGVKLARIALAELRERIDMTVGIAVWGNQGPTVVHWMESSYPAKAS
FT                   LKLGDVMPMLSSATGLLFAAYLPRGKTAAMIDRELAEAQRWAAANSPRTPQDVERVLDE
FT                   VRLHGAARVEGMLLPTIHAFCTPVFDSNGDLALGLIALGHEGAFDIAWGGEVDSALREC
FT                   AQKLSYELGYSPTAR"
FT   gene            219910..220902
FT                   /locus_tag="Bphy_0196"
FT   CDS_pept        219910..220902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0196"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_A4235 putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69389"
FT                   /db_xref="GOA:B2JKK0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK0"
FT                   /protein_id="ACC69389.1"
FT                   /translation="MKLASLKDGTRDGQLIVVSRDLHTAAVADTIAPTMQRILDDWTFY
FT                   APQLRDLYDELNQGRARNTFSFDAKECMAPLPRAYQWADGSAYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFIGAKDDIVCASESFGIDFEAEVAVITGDVPMGAKPEQALKSI
FT                   RLVTLVNDVSLRNLIPAELAKGFGFFQSKPATSFAPVAVTLDELGDAWREGRVHRPMIV
FT                   HWNGKKVGQPDAGTDMVFNFGQLIAHAAKTRHLRAGAIVGSGTVSNKDAKRGYCCIAEK
FT                   RCLETIESGSAQTEFMRFGDTVKIEMFDEAGKTIFGSIDQAVAPFEAVQ"
FT   gene            221102..222295
FT                   /locus_tag="Bphy_0197"
FT   CDS_pept        221102..222295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0197"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4234 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69390"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK1"
FT                   /protein_id="ACC69390.1"
FT                   /translation="MPRYGTFAFSSSRHSASKRRTMLAAALSALPGVALAQVKIGLVLS
FT                   LTGPAASLGIPARDTATLFPKEIAGQKVDYIVLDDASDTTQAVQDTKKLISEHHVDAII
FT                   GSSITPNSLAMIDVIAEGETPAISLASSAKIIEPVDAKRRWMFKTPQTDAMMASAITGH
FT                   ASQHGVKTLAYIGQADALGETFYAEVAKFAQIHHIGVVANERFNRTDPSVTGQILKIMA
FT                   ANPDAVVVGAAGTPAALPPKTLIGRGYKGKIYHNHGVGNNDFLRVCGTDCNGTFLPASP
FT                   VLVAAQLPSDYASKRLALDYIARFEKLRGPGSVSAFGAYAWDASMLLDNAIPIALKAAA
FT                   PGTAEFRRALRDALEATKGLADTNGVVNMSATDHLGLDQRARVMVEISNGKWVYQPR"
FT   sig_peptide     221102..221212
FT                   /locus_tag="Bphy_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            222377..223237
FT                   /locus_tag="Bphy_0198"
FT   CDS_pept        222377..223237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0198"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_A4233 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69391"
FT                   /db_xref="GOA:B2JKK2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK2"
FT                   /protein_id="ACC69391.1"
FT                   /translation="MSAMSHESESHTVEPAFYAHYRSLRVRRHAHGILEIVMSGEGANK
FT                   SNLATADANMHRELADIWRDVDRDPDTRVAVIRGEGKGFSAGGDLGLVEDMANDFDVRT
FT                   RVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAGLLADISIATKSARIIDGHTRLGV
FT                   AAGDHAAIVWPLLCGMAKAKYYLMLCEPVSGEEAERIGLVSLAVDDNDLLPKTFEVARK
FT                   LASGSQTAIRWTKYALNNWLRSAGPAFDTSLALEFMGFAGPDVREGVASLRERRAPDFP
FT                   GKEPF"
FT   gene            223414..224157
FT                   /locus_tag="Bphy_0199"
FT   CDS_pept        223414..224157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69392"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK3"
FT                   /protein_id="ACC69392.1"
FT                   /translation="MTDNPGSTPPFPGFPGFPPAEMLDRMWGMMRLTPFGAAFPGTSPG
FT                   SAQGFVPSLSIMSDMMAPLTNVEELDKRITDMRAVEQWLKLNLNMLQSAIQALEVQRAT
FT                   LATLRAFGAFAQQSMTQPAAEAPQKQPEPPPAARTQQEAGDAAESPPPPTFDASGWWNL
FT                   LQAQFNQLAQFAMAQPAATTATGASEAGAGVEPSDLEPDDAPESDTAGAAQAGADDAPR
FT                   PAAKRAPSAKRAGGAAAKKSSSTPE"
FT   gene            224717..225589
FT                   /locus_tag="Bphy_0200"
FT   CDS_pept        224717..225589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69393"
FT                   /db_xref="GOA:B2JKK4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK4"
FT                   /protein_id="ACC69393.1"
FT                   /translation="MNTMLYPELYKSLESVRWDMEKDIPWDKFDGSLLTDEQAATIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPHMVPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKAIYETISRDEARHGG
FT                   AYLRYMKKALTNFGDGARAAFAKIGVLMASARRTEKPLHPTNLHVNQSLFPRDTVQSRL
FT                   PDPEWLERWLDEQICFDDGWEKKVVERILHNLSILFERSFTTAQELNRYRKEVVTRLQA
FT                   EQQPAQQPA"
FT   gene            225714..226196
FT                   /locus_tag="Bphy_0201"
FT   CDS_pept        225714..226196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0201"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   rfaE bifunctional protein; PFAM: cytidylyltransferase; FAD
FT                   synthetase; KEGG: bxe:Bxe_A4229 cytidyltransferase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69394"
FT                   /db_xref="GOA:B2JKK5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK5"
FT                   /protein_id="ACC69394.1"
FT                   /translation="MAATFERKLTTRDALAQLRPSLTGPVVFTNGVFDILHRGHVTYLA
FT                   DAKALGATLIVGVNSDASVRMLGKGDDRPINNESDRMALLAALESVDWVVCFGEQTPVA
FT                   LIEALHPDVLVKGGDYDMDKLPESALVRGWGGMALAIPFEHDRSTTALLKKVRAQG"
FT   gene            complement(226244..226483)
FT                   /locus_tag="Bphy_0202"
FT   CDS_pept        complement(226244..226483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69395"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK6"
FT                   /protein_id="ACC69395.1"
FT                   /translation="MLRWLLALLFLANILAFVTMRGLFGPSPAAGPREPNHLNRQVRPE
FT                   QLRVQPMSSADAADLAVIGGPAPVAPIAASALRQ"
FT   sig_peptide     complement(226391..226483)
FT                   /locus_tag="Bphy_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.706 at
FT                   residue 31"
FT   gene            complement(226523..227392)
FT                   /locus_tag="Bphy_0203"
FT   CDS_pept        complement(226523..227392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0203"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bxe:Bxe_A4227 putative
FT                   transcriptional acitvator, Baf"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69396"
FT                   /db_xref="GOA:B2JKK7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JKK7"
FT                   /protein_id="ACC69396.1"
FT                   /translation="MSTPYLLIDAGNSRVKWALVQADGTQTHSGAFSHGGQLVKGTGDP
FT                   LQSRHEPDWSALPAPGSAWLSNVAGDAVARRIDAFIDRHWPGLARTTVRSAAQQCGVTN
FT                   AYTTPSQLGSDRWAGMIGARAAFPGEPLLIATFGTATTLEALTADGVFVGGLIAPGWSL
FT                   MMRSLGEHTAQLPTLDSTAARGLLDGDNAAGQREPAERGAWFATDTPRSLSSGCALAQI
FT                   GLIERMWRHLQDEWQVSVRLVVGGGAAGELVQALSVPYTRHDSLVLAGLALIAAQAPVY
FT                   PSTHTRPV"
FT   gene            complement(227389..228348)
FT                   /locus_tag="Bphy_0204"
FT   CDS_pept        complement(227389..228348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0204"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; KEGG: bxe:Bxe_A4226
FT                   biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69397"
FT                   /db_xref="GOA:B2JKK8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK8"
FT                   /protein_id="ACC69397.1"
FT                   /translation="MGADLALTRTGAVAKIRFMTTPSSPSPSGDWRIDRQRAVALFGPA
FT                   AHDWPIEIVEETGSTNADLMARVKALPREPGALPRPIVRVAYLQTAGRGRRGRPWYAEP
FT                   GNALLFSVACVLPRPLEGLAGLSLAVGVALVDGLRSLPVAGPGQIALKWPNDVLLEGDK
FT                   LAGILIETAWSTPDASAVVIGIGTNVKGADELAAKVGALNADVPAQARGAAPTALSRAL
FT                   PNANLTDTLAAELNALEPALQRFGAEGFAPFRQRWNGCHAYAGRDVVLFEQGVEIERGV
FT                   AAGVDELGQLLLDTPSGQLAIATGDVSLRLADEESGAA"
FT   gene            228496..229635
FT                   /locus_tag="Bphy_0205"
FT   CDS_pept        228496..229635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0205"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bxe:Bxe_A4225 putative ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69398"
FT                   /db_xref="GOA:B2JKK9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKK9"
FT                   /protein_id="ACC69398.1"
FT                   /translation="MNYDTPPGLEVTAGGQGKIVRLSGQWTALALARDRLHGQALPRLR
FT                   ELVDSRAHVAQWDLSNVERMDHVGGQALWRVWGYKLPRDLVALNDTQRDIFDRIALLDT
FT                   VRENPEPVRRFDPFTQLGLGIFSFVEHVYGGVAMFGRVILDLLSIARNPKLAPWKEISA
FT                   NVYSAGTQALPITALVAFLIGIVLSYLSAQQLRLFGANQFIVNILGMSVLRELGPVLSA
FT                   ILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVIALSLAMPLLVMWTNI
FT                   ISLLGGALAAKLVLQIDVSYFVRALPGVVPVANLWIGLGKGMVFGMLIAIAGCHFGFRI
FT                   KANSQSLGEGTTTSVVSSITIVILADAVFAILFQNVGLS"
FT   gene            229632..230522
FT                   /locus_tag="Bphy_0206"
FT   CDS_pept        229632..230522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0206"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A4224 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69399"
FT                   /db_xref="GOA:B2JKL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKL0"
FT                   /protein_id="ACC69399.1"
FT                   /translation="MIAPLTTAVRDQPLPEIAETVIEVRDLSKRYGRNIVHQHLDFDVR
FT                   RGEIVSIVGGSGSGKTTLMRQILGLEKPTSGSIKVFGEDTSKLDDNEARLMRVRSGMLF
FT                   QHGALFSSLSVFDNIAQPLRELGKVPDDLLRDIVMLKLEMVGLPCKHASKMPAALSGGM
FT                   VKRVGIARAIALEPELLFLDEPTAGLDPQASDEFVELISALHRALGLTVVMVTHDLDTM
FT                   VALSTRVAVIADRTVVVAAPVEEVAGFDHPFIREYFLGLRGRLALQGLSPERRARLPAE
FT                   ALEPATEALPLRTAP"
FT   gene            230664..231626
FT                   /locus_tag="Bphy_0207"
FT   CDS_pept        230664..231626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0207"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bxe:Bxe_A4223 ABC transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69400"
FT                   /db_xref="GOA:B2JKL1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKL1"
FT                   /protein_id="ACC69400.1"
FT                   /translation="MENKSHAFWAGLFTVVMVAAIAAAAFLFNVDRSVRIPFDLIARTN
FT                   VTGLYPDAAVRYRGLDVGKVQSIKFDREHPGQILIRILVDKNAPITHSTFGSLGLQGVT
FT                   GLAFIQLDDTGRDTTPLASSAKSVAQLPMRPGLLDQLQARGDILIRQLEKTVRDVDALL
FT                   SPEMRDQLLATAASLQHAADGVTTLTAQMGPAVGKLPDTLTALDQTLASTNRMITNLNR
FT                   PDGPLEGTLNKVGTAAQQAGDALTAMNATLQDISARVGYDTLPRVNSLADDVRSAVRSV
FT                   DRAAETFSETPNSVLFGAPHAAPGPGEPGFVWPAGHAAK"
FT   sig_peptide     230664..230732
FT                   /locus_tag="Bphy_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.516 at
FT                   residue 23"
FT   gene            231645..232271
FT                   /locus_tag="Bphy_0208"
FT   CDS_pept        231645..232271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0208"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A4222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69401"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKL2"
FT                   /protein_id="ACC69401.1"
FT                   /translation="MSRSINRLFTSRAALAAVLVALGALAGCVGNPAAISDYRYDLGPA
FT                   PTPGSTGTMPAIKVLDVTAPATLNTDKLVYRLPYADAQQTAAYANSHWTMPPAQLLTQR
FT                   LRNALSSRGTVLTGSDGVSAPVLKVDLDVFEQDFDGQSQSHASVTARATLLVGGKVAGQ
FT                   RTFIARAPASSADAAGGARALAAASDELVAQISAWLGVQPLVAQQ"
FT   sig_peptide     231645..231725
FT                   /locus_tag="Bphy_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.301 at
FT                   residue 27"
FT   gene            232302..233462
FT                   /locus_tag="Bphy_0209"
FT   CDS_pept        232302..233462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0209"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: bxe:Bxe_A4221
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69402"
FT                   /db_xref="GOA:B2JKL3"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKL3"
FT                   /protein_id="ACC69402.1"
FT                   /translation="MADKPWQRRPSAFARQALVLYAALIVYGSWYPFYGWRSLGLGPFD
FT                   YLFDPVPQYLTAFDVVTNVLGYMPFGALAVLAVYPRWRGALAVAFAFGLGTLLSGLMEA
FT                   VQTYLPTRVASNLDLAANALGALLGATLMSPLTGALLDRGMLRRMRFLWFERDSTAVIG
FT                   LAGLWPFATMYPSPLLLGLGTWPRELWLRADSTMQEALLAWAPAAWHVPAWPALVAAWL
FT                   PDDAWEACIAALNLLAAGALASLPMRERAPRVRLLIAFVVAMLFVKAGATFLQSQSGLA
FT                   FNWATPGALIGLASGFVAMLLALKLPRGSRAALAAIALAVSLVFVNLLPVNPYFDVVLA
FT                   DWRQGRYLHFNGLARWLAWMWPYAVLVWVGLSAERALLAKGRGSRT"
FT   gene            233608..233931
FT                   /locus_tag="Bphy_0210"
FT   CDS_pept        233608..233931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0210"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: bxe:Bxe_A4220 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69403"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKL4"
FT                   /protein_id="ACC69403.1"
FT                   /translation="MDSFFKHHVFFCLNQREPGASRPSCANCNAQEMQEYAKKRVKQLG
FT                   LAGPGQVRINKAGCLDRCEEGPTIVVYPEGVWYTYIDKTDIDEIVESHLANGKIVERLL
FT                   IDR"
FT   gene            233954..234598
FT                   /locus_tag="Bphy_0211"
FT   CDS_pept        233954..234598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69404"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC40"
FT                   /protein_id="ACC69404.1"
FT                   /translation="MNVHTKKYLIDGPVGKIEVAVDAPDASRDGGAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVGLNYITYRTNFRGVGETQGTHDAGVGERDDLRAVIDHMRA
FT                   QPDQADLPLVLAGFSFGTFVLSHVAARLREEGQEIERMVFVGTAASRWEVAPVPDNTLV
FT                   IHGETDDTVPIQSVFDWAQPQELPVVVIPGAEHFLHRKLHILKRIIVDAWR"
FT   gene            234977..236206
FT                   /locus_tag="Bphy_0212"
FT   CDS_pept        234977..236206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0212"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: bxe:Bxe_A4218 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69405"
FT                   /db_xref="GOA:B2JC41"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC41"
FT                   /protein_id="ACC69405.1"
FT                   /translation="MRFSNSGSISLSSFASFVPRSAASKFALGFALPAALVASTAFAQV
FT                   PPPGVNARSWVLVDATSNQVLASGNPDERVEPASLTKLMTAYLTFEALASKKITMDQSI
FT                   NPSEAVRRVRNDESRMFIEANKPVTVHDLVYGMIIQSGNDAAIALAELVGGSEAQFVNM
FT                   MNAEAQKLGMKNTHFADVNGMPDPQHYTTAGDLAILSARLIRDYPDYYNIFSVKEFTYN
FT                   KIKQPNRNRLLWIDPTVDGLKTGHTQAAGYCLIASAKRSLPGVPDASRRLVTVMMGEQK
FT                   EHDRVQDSLKMLNYGYSAYDAVRLYKANQVVETPRVYKGSQDTVKLGVTTDQYITLPKG
FT                   MADKAKPQIEHADPLIAPIAQGQQVGTVKFVADGKTLAQVPLVALQGVPQAGIVGRVWD
FT                   SMMLMFNKKK"
FT   sig_peptide     234977..235108
FT                   /locus_tag="Bphy_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 44"
FT   gene            236305..236574
FT                   /locus_tag="Bphy_0213"
FT   CDS_pept        236305..236574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0213"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   bur:Bcep18194_A6234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69406"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC42"
FT                   /protein_id="ACC69406.1"
FT                   /translation="MSPVNESLIDFPCDFPIKVMGKSHPDFQTTIVEVIRQFDGGFDAE
FT                   RVEVRPSSGGNYTGLTVTVRALNREHLDDIYRALTGHPMVKVVL"
FT   gene            complement(236608..237612)
FT                   /locus_tag="Bphy_0214"
FT   CDS_pept        complement(236608..237612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0214"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4215 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69407"
FT                   /db_xref="GOA:B2JC43"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC43"
FT                   /protein_id="ACC69407.1"
FT                   /translation="MDLRQLPALNAIKAFEAAARHESFSRAADELYVTHGAVSHQIRAL
FT                   EEELGVKLFARDGKRVRLTEIGRRYAAQVRTALVSLAEATREIRAGDRDRRLVVSMLSS
FT                   FAARWVTPRIGRFIEANPQWDLELLSTNALTDFARDDVDCAIRFGYGNYPGLHTELLLE
FT                   EVFFPACSPTFNGGNLPKTPVDLANVPLLRSDDELWRPWFDAAGLNDWPEPKRGVLYQD
FT                   SSNLLQAAIDGQGVALTRRSLAMHEVAAGRLVRLFDIDGPSPWQYYFICTPQLMRTARV
FT                   KAFRDWVFDEVGRFRLLFEKACTENAMRSSTDAARTKGLDALHVQLPATQAER"
FT   gene            237711..238037
FT                   /locus_tag="Bphy_0215"
FT   CDS_pept        237711..238037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69408"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC44"
FT                   /protein_id="ACC69408.1"
FT                   /translation="MREISSSITFEIVAGETVPMKVTRSTRLAVSGGAVWVTRSDDVED
FT                   YWLEPGKTLRLRRGERLWLSVERGTQARVAFLVPTRPEQKALNWFDRVSARFGTWLRSG
FT                   WRTV"
FT   gene            238110..238877
FT                   /locus_tag="Bphy_0216"
FT   CDS_pept        238110..238877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0216"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: bxe:Bxe_A4213
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69409"
FT                   /db_xref="GOA:B2JC45"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC45"
FT                   /protein_id="ACC69409.1"
FT                   /translation="MCATPVSPSPESPRSAQAGAAASDAAAQPVIVRWRGLEDYQASFD
FT                   AMRAFTGSRSFETSDEIWLVEHPPVFTLGQAGDPAHLLAADSGIPLVKVDRGGQITYHG
FT                   PGQVVGYLLLDLRRRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVSPEQPNA
FT                   GLHAGAKIAALGLKIRNGCSYHGVSLNVKMDLQPFLAINPCGYAGLETVDMATLGVAAG
FT                   WDDVAQTLAASLIANIDGIPAAVGLPQAGAITA"
FT   gene            238891..239895
FT                   /locus_tag="Bphy_0217"
FT   CDS_pept        238891..239895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0217"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: bxe:Bxe_A4212 lipoate synthase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69410"
FT                   /db_xref="GOA:B2JC46"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC46"
FT                   /protein_id="ACC69410.1"
FT                   /translation="MTDVTANPAASSPVNGAAGAAPYDATAKQKAQAKTARIPIKIVPI
FT                   EKLKKPDWIRVKAATGNSRFYEIKQILREHNLHTVCEEASCPNIGECFGKGTATFMIMG
FT                   DKCTRRCPFCDVGHGRPDPLDPEEPGNLARTIAALKLKYVVITSVDRDDLRDGGAAHFV
FT                   ECIQKTRELSPETRIEILTPDFRGRLDRAIGILNAAPPDVMNHNLETVPRLYKEARPGS
FT                   DYAHSLKLLKDFKALHPNVATKSGLMVGLGETEEEILQVMRDLREHNVDMLTIGQYLQP
FT                   SEHHLPVRAYVHPDTFRMYEEEAYKMGFTHAAVGAMVRSSYHADVQAHDAGVV"
FT   gene            240128..241816
FT                   /locus_tag="Bphy_0218"
FT   CDS_pept        240128..241816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0218"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein; KEGG:
FT                   bxe:Bxe_A4205 Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69411"
FT                   /db_xref="GOA:B2JC47"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC47"
FT                   /protein_id="ACC69411.1"
FT                   /translation="MPMLILLNLLSGVALLVWGTHIVRTGILRVWGGDLRRALARSTNS
FT                   RAKAFAAGVGVTSLVQSSNATAMIVTSFAAQGMLPLASGLAIMLGADVGTALMARILTL
FT                   DLSWLSPFLIVFGVPLFLSRKQNRSGQVGRTATGLGLILLALHLIVESAQPMMHGAGVR
FT                   VMFGALTGDTMLDALVGATFAVISYSSLAAVLLTATLASSGVISLKVALCLVIGANLGS
FT                   GLLALAGTLAQNTAARRLALGSLAFKLAGALLILPFTSLLARGLPMLIGNPREAVVGFH
FT                   VIYNTLRCCACLPLIDGVARVCCRVLPERPDPNGQLRPMHLDAASIATPTLALSNAARE
FT                   VLRIGDIVRTMLDNLSHLIHHNDPEKARDTIRMDDDVDHLYAEVKAYLARVSREQLDDA
FT                   DSRRWTDIIALTINLEHAGDIIERIVTDIEEKKIAHRLAFSEEGLAELDDLHTRLVGNL
FT                   QLGLSVFLSNDLRCAELLLAEKERFRDLERAYSYKHLDRLAGETLRSIETSALHLDVIS
FT                   DMKRLNSLFCSTAYPVLDAAGALHDTRLRKRMHEDVPAATLTQQP"
FT   gene            complement(241824..242597)
FT                   /locus_tag="Bphy_0219"
FT   CDS_pept        complement(241824..242597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0219"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bxe:Bxe_A4204 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69412"
FT                   /db_xref="GOA:B2JC48"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC48"
FT                   /protein_id="ACC69412.1"
FT                   /translation="MWQEDRHQRIRALLSTLNRVSTERIMADLGVSRETVRRDLLDLEA
FT                   LGELRRVHGGAVKPADEAPIAERAQTHVKSKKTIAKAATAAVASGQTLFIDAGTTTAAL
FT                   ADELAKLANLTVITNSIDVAMKMRGAPDQREAWANEVILLGGSISDRALSTTGDTTILD
FT                   IQRYRADIALLSPVAVDSKHGASNYDRAETEVARAMVANADSVVILADHSKIGQRSRIA
FT                   YCPPEKIDLLVTNRKAADVASFAQLKRKVGKVILA"
FT   gene            243038..243802
FT                   /locus_tag="Bphy_0220"
FT   CDS_pept        243038..243802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0220"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bxe:Bxe_A4202 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69413"
FT                   /db_xref="GOA:B2JC49"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC49"
FT                   /protein_id="ACC69413.1"
FT                   /translation="MGNGIDQALSADWPYPRLVAHRIGGKLAPENTLAGFEMCARFGYG
FT                   MIEFDAKLSSDNQIFLLHDDDLDRTTNGRGAAADHTWQQLASLDAGAWFDDRFKDERLP
FT                   TLAQVAARCASEAIAANIEIKPCPGRDEITGRLVALAAKDLWRKQKPLLSSFSFEALKA
FT                   ARDAAPSLPRGMLFEALPDDWLSIVRELACVSLHADHKHLTQTNVRAIRDAGLRVLAYT
FT                   VNDPARARELAKWGVDMICTDRLDMIGADVVA"
FT   gene            243893..244990
FT                   /locus_tag="Bphy_0221"
FT   CDS_pept        243893..244990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0221"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_A4201 ABC polyamine/opine/phosphonate
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69414"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC50"
FT                   /protein_id="ACC69414.1"
FT                   /translation="MKPTTLRCLLLACGVAAAGNVLAAPPDALVAAAKQEGQLTVIALP
FT                   HDWCGYGPMIADFQKKYGIKVNELNPDAGSGDEVEAIKANKGNKGPQAPDVIDVGLSFG
FT                   PTAKAQGLLQPYKVATWKSIPNDNKDPEGYWYGDYYGVLSFEVNADMIDKVPTDWSDLQ
FT                   KADYKNAVSLAGDPRSANQAIQGVYAAGLSAAKGDASKAAQAGLKYFADLNKSGNFVPV
FT                   IGKAASLAQGTTPIIVRWDYNALADRDTLKGNPKVQVVVPKTGVVAGVYVQAISAYAPH
FT                   PNAAKLWMEYLYSDEGQIGWLTGYCHPIRYNELVSQKKVPQALLDKLPPASAYKNAVFP
FT                   TLQQQDATKDVVTKQWDQVVGANVK"
FT   sig_peptide     243893..243964
FT                   /locus_tag="Bphy_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            245099..246043
FT                   /locus_tag="Bphy_0222"
FT   CDS_pept        245099..246043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0222"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A4200 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69415"
FT                   /db_xref="GOA:B2JC51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC51"
FT                   /protein_id="ACC69415.1"
FT                   /translation="MSASSEAGPGGGQADLMVPSVPQPAPKVDGPGRASPIWTWIGVMP
FT                   FFLFALLFLILPTGFLMVGAFQDAQGHFTLANMRDLFQENTLDAYWISFKVSAASAFGG
FT                   AVFGSLLAWAAVHGKLPGWIRPTLLTFSGVASNFAGVPLAFAFICTLGRVGLVTVLLKK
FT                   YADINLYSTGFSILSFWGLTLTYLYFQIPLMVLIVTPALDGLKREWREACDCLGGTAYQ
FT                   YWRYVALPVLWPSVLGAALLLFANSFGAVATAYALTGSSLNIVTILLYAQIRGDVLHNQ
FT                   NLGYALALGMILVTGLSNGGYIWLRSRAERGRR"
FT   gene            246040..246831
FT                   /locus_tag="Bphy_0223"
FT   CDS_pept        246040..246831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0223"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A4199 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69416"
FT                   /db_xref="GOA:B2JC52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC52"
FT                   /protein_id="ACC69416.1"
FT                   /translation="MNRQSRAGAWTAMIVGSLYFLIPLIATFEFSLRMRRGTYSFDAYQ
FT                   VVLGDPRFQASFGYSILMAVLTIVVGVLLVVPTAYWVQLRLPKLRGIVEFITLLPLVVP
FT                   AIVIVFGYLRIYNSSSILPLTSNERATDLLLVFGYVTLSLPYMYRAVDAGLRAVDIRSL
FT                   TEAAECLGANWPTILIKVIFPNIRSGILSGAFLTFAVVIGEFTLASLLDRPAFGPYLQL
FT                   IGANRAYEPSALAIIAFAVTWASMGLIQVFGSARTLAAQKP"
FT   gene            246852..247931
FT                   /locus_tag="Bphy_0224"
FT   CDS_pept        246852..247931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0224"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A4198 ABC spermidine/putrescine
FT                   transporter, ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; TOBE domain protein; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69417"
FT                   /db_xref="GOA:B2JC53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC53"
FT                   /protein_id="ACC69417.1"
FT                   /translation="MAFLEIDSLHKAFGANTALHHFDMKIERGEFITFLGPSGCGKTTV
FT                   LRMIAGFETPTRGTIRLDGRDVTHLRTRQRKVGMVFQAYALFPNMTVAQNIGFGLKIAN
FT                   RPQSEIKQRVDEMLQLIKLPHLGERYPWQLSGGQQQRVALARALAGKPQVLLLDEPLSA
FT                   LDAKIRISLRQDIRALQRELGITSIFVTHDQEEALSISDRIVVMNEGRVEQVGTPLEIY
FT                   NYPRTRFVASFVGTLNILSGHVIDPSSGRMAVDGQELHTTQALPADDAGKKRMLAVRPE
FT                   AIVLEPPAAGRNTLTATVEEVSFLGAIVRIRTRVKDEVVSLDIFNDPNRRLPERGQPVA
FT                   LGFSHENLLVLEEGAQAQG"
FT   gene            248341..249621
FT                   /locus_tag="Bphy_0225"
FT   CDS_pept        248341..249621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0225"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bxe:Bxe_A4197 sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69418"
FT                   /db_xref="GOA:B2JC54"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC54"
FT                   /protein_id="ACC69418.1"
FT                   /translation="MKKPIYKVLYVQVIVAIIIGIALGHFYPALATDMKPLGDAFIKLI
FT                   KMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALILGLAATHLLRPGVG
FT                   FNVDPATLNGKEVASYAAKAHGQTTVDFLMHIIPDTLVSAFSQGEILQILLIALLFGAV
FT                   LAHVGERGKPVTNFIESLSSILFGMVGIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKL
FT                   IGTFYLTSIVFVVVVLGFIAKMVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLE
FT                   KLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTDLTWGQQLTLLAVTMLTS
FT                   KGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVS
FT                   AWEKELDRSKLRAALSRDVSVTESAEV"
FT   gene            249625..251676
FT                   /locus_tag="Bphy_0226"
FT   CDS_pept        249625..251676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0226"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bxe:Bxe_A4196
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69419"
FT                   /db_xref="GOA:B2JC55"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC55"
FT                   /protein_id="ACC69419.1"
FT                   /translation="MKAAARQHGASPHATQATAAPGETGQAHAGPEGFDDERYATIGDP
FT                   HRTNPAIVTRRLLILFALVAGLVAACGLTWTITWQHGIDTLRRNAAVRADRTTATLKST
FT                   LERYESLPYLLGEHPLVQDVLVDPKPDNVARANQYLTDLNRRARANVAYLVTAAGRCVA
FT                   ASNWDQPDSFIGQAYLFRPYFVEAVKGKVGRFFGIGTTSLDPGYYISQPVRRDGKIVGV
FT                   AVVKLNLEWFQGADASEPMIVTDDHGVIFLSSVPAWKYHTVKPLTSDVIASIYDTRQYA
FT                   RQPIAPLPMSVVRTLEGGAQIVRIGGGRTGNYAAPRFLASQRTLGEPDWRLITLAPVDP
FT                   VNADARYATIVTGFGYVSLCLLLFYWRMRRARVREVMRSRALLQKAYAELNQRVAERTA
FT                   DLSQANEQLTKEVSERTRAEQELRDAHDELIQASKLAALGQMAAGITHELNQPLAALRG
FT                   FSDNTRVFLERGDQESAKENLEAIAALTERMGKITNQLKLFVGRARPRNACAGVARALR
FT                   NVLTLLQKRLQGVTVDVSLSDEGASPVRFNLDIDDPKLVVHCDDLRLEQVLINLLGNAL
FT                   DAVAATPSPRIAIGVQTSPDVLTLTVSDNGPGIPDEVLPRLFEPFFTTKEMGQGLGLGL
FT                   AICSSIARDCGGSLAARNNAQGGAEFVLTLRRVRAQATDIADSVTTGS"
FT   gene            251706..253064
FT                   /locus_tag="Bphy_0227"
FT   CDS_pept        251706..253064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0227"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: bxe:Bxe_A4195
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   NtrC subfamily, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69420"
FT                   /db_xref="GOA:B2JC56"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC56"
FT                   /protein_id="ACC69420.1"
FT                   /translation="MVNKGLQVLYIEDDELVRRASVQSLQLAGFEVVGYASVESAAKLI
FT                   HAEFSGVIVSDIRLPGASGLDLLAQCRERAPEVPVILVTGHGDISMAVQAMRDGAYDFI
FT                   EKPFASERLIETVRRAVERRTLVLENLALRRELAGQGTLAPRIIGRSPAIEQVRKLIAN
FT                   VAPTDASVLINGDTGAGKELIARSLHELSPRRDKPFLAVNCGALPEPMFESEMFGYEPG
FT                   AFTGAAKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPVRVDC
FT                   RIVAAAKGDMTDHVAAGTFRRDLLYRLNVVTIALPPLSERREDIVPLFEHFLLDAAVRY
FT                   QRPAPILTDRQRTNLMQREWPGNVRELRNAADRFVLGVGDDTATATGDDALTSPMQPLK
FT                   ERVEQFERAVIAEALEQTGGAVAVAADRLQVGKATLYEKIKRYGLAARGEGER"
FT   gene            complement(253149..253673)
FT                   /locus_tag="Bphy_0228"
FT   CDS_pept        complement(253149..253673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0228"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bxe:Bxe_A4194 putative thiol-disulfide isomerase and
FT                   thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69421"
FT                   /db_xref="GOA:B2JC57"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC57"
FT                   /protein_id="ACC69421.1"
FT                   /translation="MSQSNVSRRSSPIRYIAAAVVTGAIAVAGYFAFGSQQHVPDATFT
FT                   LLSGQKVSTADLKGKVYLVNFWATSCDTCMKEMPQMIQTYNRYKDKGLEFVAVAMSYDA
FT                   PMYVTNYTETRRLPFKVAMDDGSAAKQFGNVQLTPTTFVIDRNGKVLKRYVGEPQFAEL
FT                   DQLLEKALGTT"
FT   sig_peptide     complement(253560..253673)
FT                   /locus_tag="Bphy_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.517 at
FT                   residue 38"
FT   gene            253846..254454
FT                   /locus_tag="Bphy_0229"
FT   CDS_pept        253846..254454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69422"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC58"
FT                   /protein_id="ACC69422.1"
FT                   /translation="MPVNLRRVMLCPALRLFASLFGPFRALIVSLFAVLSAGWLLAGCS
FT                   PTYDWRTIMNNDNGYTVDLPAKPSTDQRQVNIGGTPMSMSMQIAEAGDAVFAVGTVMLP
FT                   SDDPQMQRVALDFLRSGLARNLGSAPDARAAQIPLATGGQLEGLEMTFSGKAGPTQEAR
FT                   TMHARLVAKGRHVYQAAVIARKEPPPEQVEQFFTSFKLY"
FT   gene            complement(254787..256241)
FT                   /locus_tag="Bphy_0230"
FT   CDS_pept        complement(254787..256241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0230"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: bxe:Bxe_A4192 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69423"
FT                   /db_xref="GOA:B2JC59"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC59"
FT                   /protein_id="ACC69423.1"
FT                   /translation="MVRMSPVIQSSCSQCEIKATLTATVNLAPADLPKESGRFDLPIAL
FT                   GILAASGQIPVESLAQREFAGELSLTGALRPMRGAFAMACGTARGHLSYAEVALDHPED
FT                   VDDRTACTPELYLPLASAKEAALVPGVAVYGAADLPSLCAHLAGDADARLYPVAAATLS
FT                   NDALVAAPDMADVIGQRGARRALEVAAAGGHHMLMIGPPGAGKSMLAARLPSLLPPMTD
FT                   DEALTSAALLSASAAGFTPAQWRQRPFRAPHHSSSAAALVGGRNPPQPGEITLSHLGVL
FT                   FLDELPEFDRHVLENLREPLENGRITISRAALQADFPAACQLVAAMNPCPCGWRGDPGG
FT                   RCRCTPEVAARYLRKLSGPLLDRIDIQIEIPALSPAELSARSTATGEPSAPIAVRVEVA
FT                   RERQLRRQGKTNRELSGREVDEVCRPNGEGERLLREAGERFRWSARAYYRVLKVARTVA
FT                   DLAGDDMPTAAQVSEAVQYRRAFGSQ"
FT   gene            256256..258205
FT                   /locus_tag="Bphy_0231"
FT   CDS_pept        256256..258205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69424"
FT                   /db_xref="GOA:B2JC60"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC60"
FT                   /protein_id="ACC69424.1"
FT                   /translation="MNRQRVTGILTVETSATFYGRCYEREDEFDLTTAKLFADSWLYVA
FT                   LIELKSRSHQQRLNSGNVRLLFALASECCISPGVRRFLALPISSVGRYEVALCFRAVED
FT                   LLRSRLAATWGPTTLIRSSSHFRKVVVEDVPSEYFAEHVSKHRTYFRTSLNVHRVPRKT
FT                   LSESVKEIGPEYLQAPLGATPHSTIEQLREREVERMTADIERLRQGCRDELRFWRQVRE
FT                   RMTDMEKYRPTKDETKLVGLYLRGGMTNYRMNLLGECSISGIASAIVRYANTRGNPRHP
FT                   ERKSWAKDLVFEPLLDFYQIPVDRTEGLHSKHIYFLSRNIHMRELLAAFLALLIHTRFN
FT                   GHSLRSVQRNWIKENPDGSFSVDAFKGKTGRFTPTVDITRENQPAYDAIKLLIWNHDQL
FT                   RKFGHIGPDENRIWFCWNNKNTVMTEPFTNPDQAKRILLTQLKMQWFSNDQIRTHMLTL
FT                   DKFRSGREFETIRQDAGHQSLNTTAHYFDQLSTQLHSSAINLEYKRRLDATIKFAISDD
FT                   REFFAKKFDPRFVDKNLLFPIGDGTSCSSPYSPPDPGWLFDGVCDAKRCHAGDGCPNNR
FT                   IIVGKARVREIWATSEYYANNWHRLLVANEQAFMAWHGPAMIFNLALKSYIRSSTFWPM
FT                   IRPLVNDDDSETEE"
FT   gene            258183..260423
FT                   /locus_tag="Bphy_0232"
FT   CDS_pept        258183..260423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69425"
FT                   /db_xref="GOA:B2JC61"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC61"
FT                   /protein_id="ACC69425.1"
FT                   /translation="MIVKLKNSQHKISRSERFAPSTINMLLTSGFLSISDESVISLKRS
FT                   DARREEEKFVTFDLNNYFMPPNALFPEPVALSTRHDIVAAMLLGLDNFISRTRDSHTRT
FT                   RRVSVHLIEIVMFYEAMWVRNVIVIESMTPLQFLAIANELAVGGWPEALMLNNRARRAG
FT                   IREKDFEKQYAGREIKARLCTAYSHCLEYLKAQYLRYCNVDPLVDTSDTSIRKYSASRI
FT                   RSWLASANLLYDAQHGYGLKDCPFPDAYALSRTLGLPEARTRNLSIGEAGKIFRVSMIW
FT                   VYERAPLLLALLEEMVVEVEAAVKHRKSDIGERLPTVLQNSENRRDLENLLPFELRSLD
FT                   ATTHGYIQHSVRSAITGLMAACFVLLAFMNARRKSEVSHKMVGLMCGSLTVRSEALRIY
FT                   EVKFYVAKTYRQRMPFYVNETTCDAIRTLEEIQALFTRIDKARLPANEITPFDEIPLFS
FT                   YRRLSVAEGIGTERIWFDFHSYGRQGDAASLVREALGTATLSFGTTHIFRRMYALIFFY
FT                   RYENADIVAIARQFGHVDLKSILVYLTDPASRADIESIFRTIPTETDDRRRAYMEEMAD
FT                   LEKEIRQVGDQKLGEEVFAILAGEPYAGGYARYVRKLHARFAQVLSFAKSSASDAVYNA
FT                   VKQRGHFPRPYSHGECMLGTATNQKAARCYSIEDGHVHQEKANATTCANCRFHLTKAAY
FT                   VENLEFEREQLSASMNSADPNSFETARRRRELKSLDEAIASLRSRLGMSYAQ"
FT   gene            260413..261009
FT                   /locus_tag="Bphy_0233"
FT   CDS_pept        260413..261009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69426"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC62"
FT                   /protein_id="ACC69426.1"
FT                   /translation="MRNNATRASGRKPTVAYNAEAKAKVNIETKLNLIERFVKQCAVMS
FT                   PPEGWSESKRSNSPPQSLRQFNRWTDTSFICSFLNVEKIEVQTIGNGTLERYAELRVRV
FT                   QRALENIEKLKSKGGTLLEQSEATRRRAHKRALRQLDILERELVDLRRERFALIQERDE
FT                   LKNQLYALQKRFRDEVSKAVESKTAVKGAVVTRLK"
FT   gene            261016..262260
FT                   /locus_tag="Bphy_0234"
FT   CDS_pept        261016..262260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69427"
FT                   /db_xref="GOA:B2JC63"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC63"
FT                   /protein_id="ACC69427.1"
FT                   /translation="MIERNASEFGGGRLSWKRFGAKRYVVAYDPVTMGIVWPLVDYAIF
FT                   LTDRIGSDPKTVESAILGVAAYRYFLVVVSKDDNRRTEKKLGSLGFEESTDTLLRSFRD
FT                   QEVERVCRRINSNHDKMTAQRTVNAKLIHIYHFLNWYRCTHNLEYFLGPSQCSIASTLG
FT                   DSDVNSRRRGRYESRTYERYPLLFRRVHENPRTVRAYVATEKDKAYIRDYFRANFTYFV
FT                   AVRNLLIMEIADRVGWRRESINSLACEQFSPGRLEAMDARGLACVPDRQKFGYRDAFYI
FT                   PPSLAIEIASFINDVRSTFLEEMGWFDKVATGPVFISARDGNGLTDKSISKIFGRAFAA
FT                   AGAPRRAGIKSFRSKFANDAIAAETLARLELGLDTSAPSVAAAVSVDLGHSHPESIRAY
FT                   VEQHQSRLASRKRNP"
FT   gene            complement(262310..263497)
FT                   /locus_tag="Bphy_0235"
FT   CDS_pept        complement(262310..263497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll1572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69428"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC64"
FT                   /protein_id="ACC69428.1"
FT                   /translation="MGFAFTRRQLYELVWQRPVSVVAESLGVSNVGLAKACRRGDIPLP
FT                   PRGYWARLHAGQHVTRSQLPPRGPGASDRVDIGSGKPQAFRIDDNDDGSIAEYEIPQPP
FT                   VYDETLEAIEKRIRQSLPQKFRYVHELENSQPLIAQLLREDDVRRNAMAKSGYSWDKPR
FT                   FESRFEQRRLIFLSNLFRLLVALDVRCTIRGREARQIILQVGSQHVDLRVDLLESLRPR
FT                   KRIPGGKSGALMALEVRVARWKHDDPEERLFWSDGPTGKLEIQLRDIAVALVLTGERQY
FT                   RKAKQFSYEWNKHFAEDRIKRIGEAARAAEASAREELAQSERDRIGRLLSQVTAHQQAQ
FT                   LVRNYVCKVRDSKHALDERAFDGDFEAWSRWALSVADQIDPLCQSFDTERKANNE"
FT   gene            263893..266946
FT                   /locus_tag="Bphy_0236"
FT   CDS_pept        263893..266946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC65"
FT                   /protein_id="ACC69429.1"
FT                   /translation="MKALEGHIGGEAELERVHSSLTAHFDALRAARSDGPIYLLEHDLS
FT                   EADLLAVLRSVQVCLRRHRIEGSWWDSHSLPLLVAATEIGYIYRGTGTDFWPIFSKRLG
FT                   EISLADRSELSSLFRRSTARFGFAAPADSPWNRAFCHIAWPVLHAILPIELHRPLARAL
FT                   RDVRTHLDLSGSDAALIAPIRNRAHLGGGGRLAAWLEDQRTAAAVVRQFLDPSHQHAIA
FT                   NSAVGRIAADLANDEIAKVALRDARKRQKALMMQPVRRVRGKIPVEETRFAQLVLRSTD
FT                   QGLLLALKFPQLDVPAREVAREALDAIRWRAFLWGRGQPVPSRNIFSDYPVPLNVALLP
FT                   PTDAPLIERTGELPVPPEAKEFLDSLRVNTSTPILFSDFTAEDDAFQRLSKSVIGNSHV
FT                   VVLIADENPPKSAEFLGRVAGLRVYKIDVGQPDGVEWLENYGWSVYRSSLFSFVGEPEL
FT                   EQHRPKRRFRLNSYIAFEVTAVGAACTVHLIKPDGSESHIDGTDRILAGFDADQIGIYK
FT                   IQYGAGESKVFEVVPYDDDEGLVSVDIAAGTGAIADLVERQVVLRFESEASLQEAEVEL
FT                   RLLSDSRECARATRTLPDTPCCLNGDDILWDSMLTEEVLERLLLSKTVELRVLIKGLVD
FT                   SNFRFEQAAAPFAWRQDAVGNLTAVNETGEMALFFASPQNPLDVMPSTGGVSGPHITLY
FT                   RAGNRIPHITGGLCVGPKVWHASDEHAAPMPTRLLRQFEARRGDAADAHSVVEALLSWS
FT                   AASVDHPITQMRRGRVVQQLDHWLVRQLCGADWADRESKISKSRETSFAPAFLQVCKRL
FT                   QVGYAKAGLSQTQCAHLDRILLRLLERRGLSVLLHESCIHVDQEVGAALDDLFNNAYTI
FT                   LHLELTSLGDGCPFDPDEDIDVGETSEDWERARCAASSETAIVELVDLLRPLGAGELLS
FT                   RSDFDVLLPDDVIDLLHRWIATHGPSHHVRHWSSDLVESAYWLFAKPSVASRLSWRGAT
FT                   ERLLADGFSARAIRYAALRMTIKSRNSL"
FT   gene            266943..269915
FT                   /locus_tag="Bphy_0237"
FT   CDS_pept        266943..269915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0237"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: rpe:RPE_2164 helicase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69430"
FT                   /db_xref="GOA:B2JC66"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC66"
FT                   /protein_id="ACC69430.1"
FT                   /translation="MNDPFVDLCLGVQALRRSVERQIAGLGGATGVAAMSYPHQLANVQ
FT                   RVLTDSRIRHLLADEVGLGKTVQALMVLNALRIQNPKHRALILVPENLAPQWLLECQSR
FT                   AHFVPLDHAPPRDETGTHVRIAYYEQLRSVTEIDPAVYDLLIVDEIHRLQSDARQRIAE
FT                   VAGDFRQLLLLSATPRLEDAQAFRQLLTILEPARISLAARSSETPEIVLREREAAIATL
FT                   AANGTHDQWMQVGLALPPEQTSLATLARTHCILRRVIHTRRRDFPDLLPQRVHHRIAVE
FT                   STGDENARLEEVWKFISRSAENDATTDLARLGQVALRSPRALSERINILRRRDQRDPEG
FT                   FLLAATRHLDAGNGDSRLEALIDLLVDIWNVDPEEAVLVVAEDNPTVDYLSTAIPQYLP
FT                   EIGARGRRRPLSITVKRNRDAAATADIVDLFAEYGESLGGFVNGEAQLLIAADLAQVGL
FT                   NLQHARKLIFFSIPWSPIAVEQWIGRLDRLGSAALEHQPGERNIDIFTICQRGQVDERV
FT                   VSILDDFGIFERSIRLDGDEINIVSQHIVEAALAANNDDWRSLSEEVRAVASDGSEVLH
FT                   TPLLDELPWRPKQTRALADYFDRVGVLGPVLEPSDARRAIVRSEVALRSWMRLIKSANG
FT                   LRLWSGEDRDTPSRKFRLLHYYRSPYSKAPIEPRFLLPGVDPGDGRRYAYLDRRRALES
FT                   PPVATVHVDDNPVTRLNFLDHGDPVHETLLAEWAKIGKDGPACVEVLFPEGHPLKDEAR
FT                   RGVYLIAILSWIPGELHLSEPDLSSVLPRLEETNIRQERKPILDAIANMEEDLRADRFW
FT                   LNSVLTPRLDVLAAQYVDGGWNLAEPGIADALLMPWSLTVHGKDRTLSKGTVTGLTAEL
FT                   KTARNSGLELLRKEYANRHQRSLGERIDLQDRIASRRYLIDSEATDLVLLRQAQLDDAV
FT                   AQNLETSEQGFARSRFRTIRNARDMAVHAREVRLARFAGLAEALVKPAFSQYKLVTLTV
FT                   A"
FT   gene            complement(269916..270908)
FT                   /locus_tag="Bphy_0238"
FT   CDS_pept        complement(269916..270908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69431"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC67"
FT                   /protein_id="ACC69431.1"
FT                   /translation="MLENLDQNTLRQRLGFRADREDVPAVDSVAEAARTCIQSWRSPAR
FT                   ARVTTYLHRQFIAAGFDEGLVRNRVTDVIDALIDIGEFTRIRLDGKDSLALSRPSIVSI
FT                   NDGSFIVLGKVAAPLPNDFHGPRYTRLTSSVPVALESVPFSDWIGPAGFHLHLARRVGG
FT                   QADSTLREFWRCLTDAVTHEGNPLDPVTMRAVVGSPDATVWFGRCDTPEVSGRWASTVP
FT                   NGTWCGVRPGRAPNEWHPILATVEGSAAQALDLYNWDEWAWALLARGVVTETPENSNWR
FT                   NGVLTFQHPIPTQFVRAMRLLGGPGPRAWTWQVSEAANQCFDNWRRSQS"
FT   gene            complement(270901..272640)
FT                   /locus_tag="Bphy_0239"
FT   CDS_pept        complement(270901..272640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0239"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: rpe:RPE_2166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69432"
FT                   /db_xref="GOA:B2JC68"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC68"
FT                   /protein_id="ACC69432.1"
FT                   /translation="MAIMIPDVSPDQIVHGSERDVFIALRDQLPNTYRVVHSLPWLRPE
FT                   RDSVDAPLREGEADFVIFHPGYGLLVLEVKGGEEMFARGHQWFRKLAKGERRITNPFDQ
FT                   ARRNMHALTNAVEERTGGRLPPSKYVYAYAVVFPHGRAKGLLPLDVADQILIDVDRMPE
FT                   LERMIEKAFTAFPGKAGKLERTEFIEMLDVLMPRFQIVRPLSPQIEAGREKLLELTENQ
FT                   ALAFHGLFANKQLLIEGVAGSGKTLLAMERALASARQGIRCLFVCYNKELAQWLREQLG
FT                   ADPSRAEIAKLIDVYHFHSLAAELAKEVGLPFEVPTDQAKARQFWDEDAASILERAVAS
FT                   LVAIGEPRYGALVVDEAQDFAELWWYALFPLVKDGEDGAIFVFMDLAQSLRASASPPPF
FT                   EFPARYALNVNCRNTKRIARLSANLVPIETLSPAGAPVGVDVRMLRATAPTQQAGLVAN
FT                   ELRRMLEVEHLAPHQIVLIGPAAKERSSLKGLSEVSGTSIVTSASEWRTGKGVLCTTAR
FT                   SFKGLEADVVIVYDLAALGAGFTSADLYVACSRARHVLILVCHDERIRSVLEQADAVSR
FT                   SNA"
FT   gene            complement(272643..278936)
FT                   /locus_tag="Bphy_0240"
FT   CDS_pept        complement(272643..278936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0240"
FT                   /product="Helicase superfamily 1 and 2 ATP-binding"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; Helicase superfamily 1 and 2
FT                   ATP-binding; SMART: DEAD-like helicases; KEGG: rpe:RPE_2167
FT                   DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69433"
FT                   /db_xref="GOA:B2JC69"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC69"
FT                   /protein_id="ACC69433.1"
FT                   /translation="MFSELKNLHRALSAYIEATYHISNPSLVDLRRAILDEQGTISQQA
FT                   YVESTPIYQGRRKFADLAIPHQARDFLSHLGTAEGGRLVFDPPYDHQADALEIIAGSSA
FT                   RSVLATTGTGSGKTETFLLPILMKLANEAASKPEQFAERAVRSIILYPMNALVNDQLGR
FT                   LRKLLGAPAVRHWFTEHAGRPAKFARYTGRSLYPGQRTEERNKQRLKSLNFYRDLERGA
FT                   QTDEAIASQIRELRSLGRWPAKPGDDGLENGMTAWLGSGKRWVGPDQRFQRAIERPEDA
FT                   ELLLRHEVQDQAPDLLITNYSMLEYMLLRPIERPIFERTKAYFESHPDERLLFVLDEAH
FT                   LYRGASGTEVALLIRRLRNRLGLAPDRMQVIATSASFADGEAARNFIGDLVGREADTIE
FT                   VLRGKKFARRPSGSGDLPLATALAACDIKRLKDVDSAHRIDALRPLLTFRREVLTAERF
FT                   ALASAASDVKRITLNGLDAMLNPVEETVTVPAHGQIETTSSFLLINEITAVDGISIGRS
FT                   ADKPDLMVIDGQQKVIRDGLQRAVHAALKDLPIVGRLVNLTSGAETREDETTLTPRSPI
FT                   AINEIGALLFEHDIPASIHVPATDALLELASYAKAEPEGQPLLAARVHAFFRGLPGLWG
FT                   CADVACSKLPANIRPGPTGMLYPQSTRECGCRARVFEVHTCRDCGVAYFQAYALNPAQP
FT                   DFLWAEDVGDLEDVDGVVRPVQILLEDPGFDADKYCTTAFLDPLTGRVGTQSTSARQIW
FT                   LPRPTKNVEPGHFEKCPHCEGNGSQVMNHQTKGDEPFQELISVQLLDQPARPEAVSPLK
FT                   GRKSLIFSDGRQAASRLSGKLKDFSLQDSIRPLLLSGLKMLEQRFDEPIALGYAYPAIL
FT                   YACAKFDVNFRLPGSEHEEFARDLRKVRNFVKDHGDLGEFRELAATLNKTRVQSVRAPL
FT                   TRVLSNRHTGLLPLALAAPQALLTENQIKRLNTLDAPPAGGGTDEEKRRALLDLWIALS
FT                   LSTGSVMLEGTPSEWIDSREGPQIKRSSGRQTGLFEKLFGARWHRAQFSKNAKPGASWI
FT                   DFLTDTFAQNENAEGFFVNAAKVRLRPEQEVRWRRCGHCTLAQPENLLMGGTCIQCGKQ
FT                   TALLDPRKDTVFRTRKYLYRKLVERLEAENDQGYVPYPFVAEEHTAQLNDAGQDQAFSR
FT                   AEWYELRFQDLDVPGPRGERAGAVDVLSCTTTMEVGIDIGSLTAVALRNVPPGRANYQQ
FT                   RAGRAGRRGSSLSTVVTFAGSDSHDQRFFAAPQAMVGGPVPDPVLNLDNREIVQRHAFA
FT                   LMLSLFQQERIEMPEADGDAQASNIFESLGKLSEFRLPDPDGFTFSGLKAWLATNAAFV
FT                   DAALRDVIPPEAVEEDPELFFSSLPQELLRALDSVGAGEKAVDLVAASPVIAAEEGPVF
FT                   DFGIDDYGDDGDMGGVPSDNTAEKAHQNADANPEAPLQPQNLLDRLFAKAVLPRYAFPT
FT                   DVVSFSVFDPSSTSYRADIIYSPQSGLTQALSQYAPGREVWVDGRKFRSMAIYSSFQKD
FT                   RINAYRAQKLYYECSRCGYAKLEEPDDTHRRGDTEDCPACKKKAGMGPAESWIVPVGFA
FT                   HPYDEPAELAGAETPLSTRPTRAKLSAPQFEQEQELGKLERPDGSGFAAWASKQTLMVT
FT                   NLGVRKAGSLETGFHYCPACGRTEPTGWTEGQLTKPQHRRPYPNYGKQPEMCAGYKRAI
FT                   VLGHDFLTDIALFSFRLSPELQVPAGSTAGRIVLTTIAEALSIAAADLLDIDVADIGGG
FT                   HRPALNEGGARGSEVEVFLYDTAPGGAGFVRSAARDPGKLLTRALAILETCECSASCYA
FT                   CLRSHKNRWDHADLDRHLGATFLRHILYGERPWVPEHVEDRLLDMLETDLIDAGKTVVR
FT                   GPDGTLTLPEYDGRTLVISHPLIREQPGSQRAFARGSKPTDRYLDQLLVDRALPAAVLR
FT                   ALDAAMAGDSDDAPFAFADAGVPVYRALSHLEGSGQELPPASEFADIPDAPEGSFIVRL
FT                   DVETMEIAKPALGQTYPFKKGTWHMFTRVEESRSKTPMLMRRTDGRAFQSSGSEVTFGL
FT                   VNASVRENGIDRYRIVYASLRPTARAEQVNKDAVEFLGAFHRHMDS"
FT   gene            complement(279209..279430)
FT                   /locus_tag="Bphy_0241"
FT   CDS_pept        complement(279209..279430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0241"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   bxe:Bxe_A2662 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69434"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC70"
FT                   /protein_id="ACC69434.1"
FT                   /translation="MEEPKRRAPTAIMRRPEVERETGLSRSTIYGRIKSGTFPPPVRLG
FT                   VRSVGWRSADIEAFLTSPADYKTPNDGI"
FT   gene            279867..280988
FT                   /locus_tag="Bphy_0242"
FT   CDS_pept        279867..280988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0242"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: yen:YE1170
FT                   putative integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69435"
FT                   /db_xref="GOA:B2JC71"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC71"
FT                   /protein_id="ACC69435.1"
FT                   /translation="MASITERGPYQWRAQVRRRGHASQSKTFATKAEAESWANMIESEM
FT                   AWGAWVSRGKAKTATLCQALRRYETEISRRKRGSVQEASVLKIWMETALAKCPLVAIRT
FT                   LDIAKLRDEWLEAYKPATVLRRLAVLSHVFSVARKEWGMESLPNPVELVRKPEPGDTRT
FT                   RRLVAEVHLETAERVRNPDRRAQDGELDRVVAASESALLPPIVWLAVETALRRGEIVSL
FT                   TWEYVDLPHRVIHLPATGNGTARDVPLSSRAIAILRSMKDRGRAKKSAPRDGAERSNFI
FT                   FDIRGDAITRAFERAVARARKIYEDECRMARGTPDERFLVDLRFQDLRHEAACRLATIF
FT                   PLHELARITGHKDLRMLTRYYPQQEEDWAHRLA"
FT   gene            281394..281735
FT                   /locus_tag="Bphy_0243"
FT   CDS_pept        281394..281735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69436"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC72"
FT                   /protein_id="ACC69436.1"
FT                   /translation="MDQEPRHTIHRFRQVPLNSNRGVTFTLRNLIARSVRALRQTRTPI
FT                   CDPAISIQEFAPAAPLYLTHMETCLTTVRSQIASVGLGDKLTALGEMSVPIMLIESAGM
FT                   AISRPLNLF"
FT   gene            complement(281916..281991)
FT                   /locus_tag="Bphy_R0023"
FT                   /note="tRNA-Ala9"
FT   tRNA            complement(281916..281991)
FT                   /locus_tag="Bphy_R0023"
FT                   /product="tRNA-Ala"
FT   gene            282639..286271
FT                   /locus_tag="Bphy_0244"
FT   CDS_pept        282639..286271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69437"
FT                   /db_xref="InterPro:IPR025639"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC73"
FT                   /protein_id="ACC69437.1"
FT                   /translation="MPLTVDPQLVDGDWRLFCPDIGDDGTAYSTMRRLAEFKADDAVDA
FT                   LSRFAESQKASTEQALKTRVAATLLRDLLQIGWDVYVNAHHIHLRPSRTKNPADRKAVI
FT                   RQQLLFGRNDQLCEDSHRRFLFTVERPSKYSACKPVTDLIADGRRLAEQLRPIAEAPRE
FT                   QRGEQLRKLCRPYLQLVSDERDQFTNLRLIDIWRYFRHSWTTRYRSSPGRNLFYLVRDA
FT                   AQPNHPVMGIAALGNTVMQLTPRDHSLGWTLEGLFALCDAGQISEHEILHAFRERLEED
FT                   FEQIYRDDLPVDRRIDHSVDDETLGRLIVIEQDASRDREHALKGEDESATKRVDELTPE
FT                   MLLRLTKTPLYRSKRARTVREILRAYRAIALWHGNLRELVATEEGCWAVNVALKQLKKR
FT                   FSATSMMEITVCGAVAPYNHLLGGKLICLMMMSPRVVKDYRERYGGMVSVIASQMAGRP
FT                   ITKQPDLVFLGTTSLYTDHSSQYNRVKLPASTISGQTCPLEYVRLGRTLGFGSPNLSAE
FT                   TELGLAAIAKVTSGFRNVNFVFGEGQSPKLRQLREGFAGLGLNQTNLLQHGAPRIIYGV
FT                   SLAKNVERTLLGIDAQPEYCIDPEQADAETAIADFWIDRWLASRLDHTPAVDAVSKSTP
FT                   LTERVSRLIPERAPEEVLQQSLPFTFVMAKEERKEMQTDVNEDERLQFIRHLYRNESAF
FT                   SDHVSLGRLKELNIKTDLEDLVRKVVRGGGSVVITGNAGDGKTHTIMLMKKELKDAHVV
FT                   TDASELSSSEIATQWQSARDSGKPFCIAINEGPFVDLVREYRDKHPWLGEIREDLLRLV
FT                   GYKALESAGDSSTENWKPKIGETVIVDLSHRRVLSANLVKAIIDKLTDDQWYQGCATCT
FT                   ARANCAVTYNRMQLRSELPRQRMINLLTTVGKSGAKITFREALAFVSYCIFAGKTCREL
FT                   IEVGSSEQVRYYWNAFEGEGAIFELVANGIDPMTQTNPRVDEDLWRGKFAPEDFAGNGA
FT                   FPLDKRNMDEIEEREQKTMAHEFAALKRRWYFEHSDGRILDYSDANKLFVDLQDTSTAM
FT                   AIRLSRLIALINRWWNRGGDSKSDALRLWTRLSYQPRARSHAMVSGLAVNRNRLRLYKP
FT                   ELAPVLKRAFGEQPVGHLVLASADDPRFARLVVDPTLLEGLLHGSISDGQSEVSRRLGQ
FT                   FNDALAQYAEKSTDVRTIEIVDPQSELRTTVVVDLINGRYDSAN"
FT   gene            286279..287766
FT                   /locus_tag="Bphy_0245"
FT   CDS_pept        286279..287766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69438"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC74"
FT                   /protein_id="ACC69438.1"
FT                   /translation="MSKQLRKAITDELHRRHGYRVMEAKIKPVHIANALMRVEHECVGK
FT                   MNVLQQLFEATVAKNSLDQKLNAARLMLDAQRDRWGALGQTADLKSSALLNKVLPLLRT
FT                   LLGADGALFGTSPDLSSFSSPTSLTVTGDPSDDGAGAFVFKLWGGHEEATRLPVLDLLS
FT                   ELTSPRKDPAQIDDLSALLIPLVDSTRAKSAPEFNAEDLISDYSNVEKQLRLAASRLCA
FT                   YERKLNPNPIASLQRVVLLAALSVFRHGATRAHERAGGPERFLLLDASGDHYSAVAQAS
FT                   TGCVTQLINDACRYMASVVNDLLTSQIANWPVEPIAAINSLLESSGQAPLEPNSPLSRR
FT                   ITDIVKDFDDPEDIRREVAEELIRQVEGNQRRGLDGYLRLLGIRSGFLYPTQKNPNKRL
FT                   NPTDRTLEVLVASTVDVHGPILEYRDFLEELKTRWAIVVGGRTEDALILSHVGASVPAK
FT                   ALRENSERFLSRLESLGLARRLADSVAVVGLLEATHE"
FT   gene            287759..292492
FT                   /locus_tag="Bphy_0246"
FT   CDS_pept        287759..292492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mem:Memar_2180 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69439"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC75"
FT                   /protein_id="ACC69439.1"
FT                   /translation="MSELMVEISNQVSRQITDLLLAELDASTGRGEFGVVVHDASVFDR
FT                   KYLLARLPDIFKGTKARLRVAVVGQHDDVATFKALNEKYATLVASDEESAVQWRNQNLK
FT                   TIVVLTDEPLTKQGSLKDFSIMSEAKLIIRLCDQQRDHAEVLWLRTLWDALKSTRGPAL
FT                   SLQKIATFAAALQRLTPLERSVKAPRNLHALGLFPDTHLAEESSEGRIIRRLKANAELL
FT                   NMVSNATPEDLDRMATYCRQLAAKEKVKFNAIRKRLRAIGERSSADLTDLEFSDVQQIW
FT                   RGKVMSPTARLDTGSDGTVSPDKVPVESVVAQLLLDGGAEQLADLAERVEQLADQAQND
FT                   QINSDDEPLGSADVSDGTNATSFQAVTSVDANIIALSSSRSTNEDWGGVIDIESDRLDA
FT                   LTEITAFKAWQPFKCSQFKEWLGEFVSADLAPATCLDLFDLLAKNRAELLEYISELTVS
FT                   PVAVLGGRPKALAAAEGYLQTYDQLLKQLQATYQEMYAQASDEAERLVHWLLAMELYVY
FT                   RRDGITEVLLSPVHPLNLWRSVAIVKDLQSLGGKLSDTERATLIAASAEDVQLLNVLVL
FT                   PQIDGVNSQASLLGHAGGVGHLPLFKEAPRGVLEPDGIKSVTAFATLIAQLRPFARPGL
FT                   QVMFVNAPRPGRFLEAVLDVLDLDNTSAEDTFWGVHFRYRYTSDDTRGWTSEFENIDDQ
FT                   TKDRIRSGQERGLISVSVDPEIRTWPDVIEEARRLPAHLTVVFDPFEVRTALVARAGLH
FT                   DLSPWMPSCEYRYNKLKKQIMVVPVAEEEIFATYFSAATLVHRELKQSTATHQPQVSSV
FT                   RTWLDELADSSIWTIIADPHRVLVPRLGEAEVIDRRIEGARQITAFGRDLSPFVRRLDQ
FT                   QLRRTHYVADPETLEELVRDLVAMEPNGILGLVGGDKSKHIKGALGKLIAMRWYRGLDP
FT                   SGLAVSLDTQNAQRWLTAGGHSNEKADLIGLREENGELIIDVIEVKTHDEGVPYSVQNG
FT                   VVAGHAVNQVLSTLHALAEVFGGSNLSPLAKPRREVLREHLYTALLRDLNPQYIERWHS
FT                   LLQDLFDGALTVRLSGRIVHVQLASIATTPSAVLQSKVGVPIEINTLAATEVGLVLTST
FT                   KVVAETALLERIDASTKVIPESIDPTQAYHLLSSTSAETTIENSLEGSTSIVVNDSRED
FT                   GNGEPIRSTKNMARIQNVSPSDRAVHEVTKRQEAVSTGGPSGSLDIMLGKEVNSSQPVS
FT                   WAPGRQSNGFFLVLGASGSGKTETLKVLGKGVSDHGVPVLVLDFHGDVQFPGLRSVLLS
FT                   SGTSSTIGVNPMELDSQSAEETGLYDQRKVIRDMIRNAVPALGHRQGAILRDAIEAAYT
FT                   TAGFSDTDPATWRNAPPTFADVEQILGGWAEDDARKSQRASIEGCLAAVQEIFEHPIFQ
FT                   RTEHVSVEEILAESVRLDLSKLTDEVRYIAAETLLRKIFRVLRLKGPIPVQPVDDRQRF
FT                   RLFVVVDEAKILSTGGGDPDAPDRILNLLFTEARKFGLGMILASQMSDHFGSEVKANAA
FT                   TWLVLKPMDIREAKKNAPNVHMEPEALTSLKGKGDGYFRDRSSPRARRVQVEPLKSD"
FT   gene            complement(292826..293647)
FT                   /locus_tag="Bphy_0247"
FT   CDS_pept        complement(292826..293647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69440"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC76"
FT                   /protein_id="ACC69440.1"
FT                   /translation="MKNEKINAEINRQNFLGKTDQDLKDLYIERNAFDVPINSEVYRIF
FT                   QAPFLLDDIASSKITLLNIRSSVFNDPLENPLFGLEFSTEEGDSLFLDPLVENYFGQSW
FT                   TEESLDEYWRWEAFSHGTNFGVRVKASLRNVMHRLVQTQNKYFMLRYFVGKVTYHDPSY
FT                   LADLTKSHTYNEFLDSLGHGITRSLTAIRKEFSDEKEIRILYDYEKEDDYAKSNVTVNK
FT                   GLFCKHPFDWSGVIEEVLLDPRMPDSDASAYCQELRNKGIMCSISRSRARP"
FT   gene            complement(294196..294657)
FT                   /locus_tag="Bphy_0248"
FT   CDS_pept        complement(294196..294657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69441"
FT                   /db_xref="GOA:B2JC77"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC77"
FT                   /protein_id="ACC69441.1"
FT                   /translation="MNGNENLEEKSKAILIKYVLAATATGAVPVPAVSAAIVAENSLMI
FT                   NHIAAIYGCEISVGTVIASIGMLGTANMIGREVFVEAARLLSWGAAFVGAPAVVSAIGA
FT                   STAGLQTYLIGLISIEIAKGGGEKLSRGVVKSLLRKGKDDFDDFSGCAA"
FT   sig_peptide     complement(294550..294657)
FT                   /locus_tag="Bphy_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.782) with cleavage site probability 0.524 at
FT                   residue 36"
FT   gene            294863..295270
FT                   /locus_tag="Bphy_0249"
FT   CDS_pept        294863..295270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0249"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   slo:Shew_1266 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69442"
FT                   /db_xref="GOA:B2JC78"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC78"
FT                   /protein_id="ACC69442.1"
FT                   /translation="MTEMKTVTTYGAILGAVLGQIRSAAGMKQSDLAEAVGVGPSTWSR
FT                   IEKGESSLSTDQLKLAADALKVPPSRILEMVDVAEKITADKGIAREPVGQAQWTVAAGA
FT                   VALGLIPVVGSMLSNIVAGAIKSQIEKAIKK"
FT   gene            295405..296730
FT                   /locus_tag="Bphy_0250"
FT   CDS_pept        295405..296730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_3156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69443"
FT                   /db_xref="InterPro:IPR029470"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC79"
FT                   /protein_id="ACC69443.1"
FT                   /translation="MTPQDLYSFLSDVRLVDLIERVKISDDFLDVVSLTETQHSDMLAW
FT                   CLHPNEGHGQGDAVVKDFLIAAYTAGVESNKYSNKNFYRKWTPGRIRTASFGSAFIARE
FT                   FSLNSGLEKKRGRLDLFLIDPSNKLVVTIENKAGASLTEAQLSAYYSAVSEQIASRPVF
FT                   QEYDFAYVVVDRDLSEYPDEHLDALGSRWTLLDYSWLEASANRARRHMERNNEAAQLLM
FT                   AYCQRQTGWQSPNEKIVSELSAELAAQHELVVEAIKSVRKLRPTDWTPTNFSGDAGELL
FT                   LFVQQNPQLCEHLVQARGIGSVLVGLRTALPTLTHEDIEHGRTWLRFSTRNMQALMRST
FT                   DGFWPIFVNVYRETSDLESSKFTIRLIWATEHFTETECDVDALRDHMSKRFPELKKFGS
FT                   SAYRRLVIERKLNATSVIRKVTEVVRDVESQLNSARRAGIFN"
FT   gene            297155..297871
FT                   /locus_tag="Bphy_0251"
FT   CDS_pept        297155..297871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69444"
FT                   /db_xref="InterPro:IPR021561"
FT                   /db_xref="InterPro:IPR033455"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC80"
FT                   /protein_id="ACC69444.1"
FT                   /translation="MDSAPRGTPLDTDFLRTLGVDPSATTRMIKAGWLHRLSKGAYLLR
FT                   GDSPSRDGLIAYLSRQIVGLHVGGKTALDWQGIRHNIAFRPRIVLWGATPYRFPTWVAQ
FT                   YMSYTYQTTRLFGDWNAPSAYLKPLPFGDSRVLVSIPELAFLELVSAIGRDGIKGQSME
FT                   EALNIADGLRNLRSELLAEMLERCTSVKVVKLARDLGVSSGHAWGRDLQTFVDRKGANR
FT                   RWTRRLKDGTRLTLKP"
FT   gene            complement(297861..298133)
FT                   /locus_tag="Bphy_0252"
FT   CDS_pept        complement(297861..298133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0252"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pde:Pden_2403 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69445"
FT                   /db_xref="GOA:B2JC81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC81"
FT                   /protein_id="ACC69445.1"
FT                   /translation="MSVSAPNPRSTPARQQLADSLRRLRAERNWSQEELAARCELDRSF
FT                   VAHVERGARNISLDNVEKLANAFGVGIADLFLRRDPKGEAGTIRA"
FT   gene            298229..298702
FT                   /locus_tag="Bphy_0253"
FT   CDS_pept        298229..298702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69446"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC82"
FT                   /protein_id="ACC69446.1"
FT                   /translation="MFLTQRSWSVDDRVAIALSAPFHPWKSIAFATTEPKFLVEFGNSY
FT                   ANDGGFRYLLVSGVETLAQMGVAPGTVIDSVHYLSCEGRCHPPVLDALWEIRRISSPDE
FT                   PAQYAYRREDGTWSGIGQWPITHVVPFEHQTVVFALRFGPTNLQVGKDASQGN"
FT   gene            complement(298886..299122)
FT                   /locus_tag="Bphy_0254"
FT   CDS_pept        complement(298886..299122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0254"
FT                   /product="Mg chelatase, subunit D/I family protein"
FT                   /note="KEGG: bmn:BMA10247_2825 Mg chelatase, subunit D/I
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69447"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC83"
FT                   /protein_id="ACC69447.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALLNCGLDFPVRRIRCRQPRYCPECTR"
FT   gene            complement(299223..299477)
FT                   /locus_tag="Bphy_0255"
FT   CDS_pept        complement(299223..299477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0255"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   bxe:Bxe_A4191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69448"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC84"
FT                   /protein_id="ACC69448.1"
FT                   /translation="MKQPNDVFNDFQARVSDLFKNSPAKDVERNVRAMLSQGFSKLDLV
FT                   TREEFDTQTQVLVRTRARLEELERRVAELEQKLPVSQSS"
FT   gene            299890..300228
FT                   /locus_tag="Bphy_0256"
FT   CDS_pept        299890..300228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0256"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bxe:Bxe_A4190 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69449"
FT                   /db_xref="GOA:B2JC85"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC85"
FT                   /protein_id="ACC69449.1"
FT                   /translation="MKLITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRT
FT                   GETGADAL"
FT   gene            300255..301760
FT                   /locus_tag="Bphy_0257"
FT   CDS_pept        300255..301760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0257"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bxe:Bxe_A4189 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69450"
FT                   /db_xref="GOA:B2JC86"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC86"
FT                   /protein_id="ACC69450.1"
FT                   /translation="MRKLLMSLLMAGSLLSVGIGAALADDASAPAAASAPDATASAPAA
FT                   SDAAAAPAASAPAADASAAPAASAPADASAAAAASDAAPAAPTAPFSVDSSKISSGDTA
FT                   WMLTSTALVLFMTVPGLALFYAGMVRKKNVLATVMQSFAITALVTVIWTVLGYSLAFTP
FT                   GGSFLGGFSRVMLHGMAYIKGDKATTLTVSHLAPTIPESVYFVYQMTFAIITPALITGA
FT                   FADRMKFSAMLIFMTLWSIIVYSPIAHMVWEPTGWLATAGILDFAGGTVVHINAGIAGL
FT                   VCCLVLGKRTGYGKDSMAPHNLVLTMIGASMLWVGWFGFNAGSAVAADGRAGFAMLTTQ
FT                   IATGIAALGWMFAEWIAKGKPSVLGIASGAVAGLVAITPASGFVGVGGALAIGLIAGVV
FT                   CFWSATWLKHKMGYDDSLDAFGVHCIGGIVGAILTGVFAVKDIGGFDGSVLLQAKGVVT
FT                   TLVYSGVISFILLKIIDMTIGLRVTEEEEREGLDVILHGEHVE"
FT   sig_peptide     300255..300329
FT                   /locus_tag="Bphy_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            302014..303303
FT                   /locus_tag="Bphy_0258"
FT   CDS_pept        302014..303303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0258"
FT                   /product="glutamate--cysteine ligase"
FT                   /note="TIGRFAM: glutamate--cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: bxe:Bxe_A4188
FT                   putative glutamate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69451"
FT                   /db_xref="GOA:B2JC87"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC87"
FT                   /protein_id="ACC69451.1"
FT                   /translation="MVPHLVTALNGPLLDLERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGAFNNLPQETLPLAVQAAMASIEKICPDAKNLLVIPERHT
FT                   RNAFYLENVARLATIMRQAGLNVRFGTLDENVVGPVTIALSDGQKIVLEPLERSARRIG
FT                   LKNFDPCSILLNNDLSGGIPSVLENLHEQYVLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KLVEIDPWMINPYFAHVEGVDFEARTGEEALADAIDGVLKKIAKKYREYGISERPYVVI
FT                   KSDAGTYGMGVMTVHDASEVAALTQGERTKMATTKEGLEVHDMIVQEGVYTFERIGEEV
FT                   AEPVVYMIDRYVVGGFYRVHGSRERDQNLNAPGMHFVPLGFEHTALPDAHAKPGAAPPN
FT                   RFYMYGVVGRLGLLAASVELERTDPEAIQV"
FT   gene            303493..304449
FT                   /locus_tag="Bphy_0259"
FT   CDS_pept        303493..304449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0259"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: bur:Bcep18194_A6192 glutathione synthetase;
FT                   TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase domain protein; glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69452"
FT                   /db_xref="GOA:B2JC88"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC88"
FT                   /protein_id="ACC69452.1"
FT                   /translation="MDILFIADPLSRFKIYKDSTYAMMAEAAKRGHTLYACEPQHLAWT
FT                   GSGVEADVYRFEIVGDQADGHRDVWHEAQPVEARTLASFGAVLMRKDPPFDMEYVTSTW
FT                   LLELAERAGARIFNKPQAIRDHSEKMAIGEFAQFVAPTLVTRDPARLRAFHAEHSDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIVEMLSHDGARSVMAQKFIPEIKAGDKRILLIGGEP
FT                   VPYSLARIPQGSEVRGNLAAGGLGVAQPLTARDREIAEALGPVLKARGLLLVGLDAIGD
FT                   WLTEVNVTSPTCFREIMDQTGFDVAAMFIDALERAVG"
FT   gene            304730..305227
FT                   /locus_tag="Bphy_0260"
FT   CDS_pept        304730..305227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0260"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: bxe:Bxe_A4186 putative sugar transport PTS system IIa
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69453"
FT                   /db_xref="GOA:B2JC89"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC89"
FT                   /protein_id="ACC69453.1"
FT                   /translation="MAGILIIAHAPFATALRECVAHIYGGLPARIGVIDVSADCDPAQV
FT                   VAFAHAEIDRLKEENGALVLTDMFGATPANIAGRLATVPDVRVLAGVNLPMLVRAVCYR
FT                   ATPLDVLVDKALAGATKGIHAVGPATPPAACVMSTTDCMPDQALAETCKTGAGTSCNRN
FT                   DA"
FT   gene            305289..305558
FT                   /locus_tag="Bphy_0261"
FT   CDS_pept        305289..305558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0261"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: bxe:Bxe_A4185 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69454"
FT                   /db_xref="GOA:B2JC90"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC90"
FT                   /protein_id="ACC69454.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAANFQAEIWMSRNGRRINAK
FT                   SIMGVMMLAAGIGSTVVIETEGADEKEAMDALLQLIADKFGEGQ"
FT   gene            305778..307520
FT                   /locus_tag="Bphy_0262"
FT   CDS_pept        305778..307520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0262"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: bxe:Bxe_A4184 PTS system EI
FT                   component, phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69455"
FT                   /db_xref="GOA:B2JC91"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC91"
FT                   /protein_id="ACC69455.1"
FT                   /translation="MSFTLHGIPVSRGIAIGRAYLIAPAALDVDHYLIEPSQIEGEVER
FT                   FRAAQAVVHRELAELRADLAADAPSEMGAFIDVHAMILNDAMLVQETIDLIRTRRYNVE
FT                   WALTEQLERLTRHFDEVEDEYLRERKADIEQVVERVLKALAGATGALVNGIHGRCDEMI
FT                   VVAHDIAPADMMQFKTQTFQGFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIRQDD
FT                   LIIVDGDHGIVIVDPAPIVLEEYSYRQSEKALEARKLQRLKFSPTQTVCGTRIELCANI
FT                   ELPDDAQAALDAGATGIGLFRTEFLFMNTKDRMPEEEEQFAAYRRAVELMNGMPVTIRT
FT                   IDVGADKPLESIGDEFETAPNPALGLRAIRWSLSEPHMFLTQLRAILRASAFGSVKILI
FT                   PMLAHAREIDQTLDLIQEAKRQLDDAGLAYDPNVRVGAMIEIPAAAIALPLFLKRLDFL
FT                   SIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAFTLREAKRAGVPVSICGEMAGD
FT                   PSLTRLLLGMGLTEFSMHPSQLLLVKQEVLRAQLKALEKPVADVLAAFEPEEVQSALER
FT                   VAQA"
FT   gene            complement(307568..308326)
FT                   /locus_tag="Bphy_0263"
FT   CDS_pept        complement(307568..308326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0263"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: bxe:Bxe_A4183 putative
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69456"
FT                   /db_xref="GOA:B2JC92"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC92"
FT                   /protein_id="ACC69456.1"
FT                   /translation="MNDDQLLRYSRHILVDELGIEAQQRFLDAHALVVGAGGLGSPAAM
FT                   YLAAAGVGTLTLVDADTVDLTNLQRQILHVTKSVGRLKVESGRDTIAQLNPDVVVNPVP
FT                   ERVDDAWLDRTVPHTAVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQISTFDF
FT                   RSDASPCYACVFPEDQPFEEVACSTMGVFAPTVGIIGAMQAAEALRVIAGIGEPLVGRL
FT                   MMLDSLRMEWNTMRIARQPDCPVCGERHRS"
FT   gene            complement(308469..310061)
FT                   /locus_tag="Bphy_0264"
FT   CDS_pept        complement(308469..310061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0264"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: bxe:Bxe_A4182 peptidase S41A; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF domain
FT                   protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69457"
FT                   /db_xref="GOA:B2JC93"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC93"
FT                   /protein_id="ACC69457.1"
FT                   /translation="MRKNLKNIGLIAAGLATGVFATLQLSASAQQPASAPLPLDQLRLF
FT                   AEVFGQIKHEYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYEELQEQTKGRFAGLG
FT                   IEISQEDGLIKVISPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDKAVKQMRGEPGTK
FT                   VTLTIFRKTDDRTFPLTVTRAIIKVQSVKSKVLAPGYAYVRITSFQERTVPDLAAKLQD
FT                   IARQQPNLKGLVLDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQVYRDTYD
FT                   NYRLPSFDSDPLKSLPSIFKTVPMIVLTNAYSASASEIVAGALQDQHRALIVGKTTFGK
FT                   GSVQTVRPMTADSALRLTTAYYYTPSGRSIQNKGIRPDIAVDQYADGDPDDALVTREVD
FT                   YSNHLANTQDPNEKKEQEQREQERMDQLRQLEEQNDKKTPEQRAKDRDRKPVEFGSADD
FT                   FMLQQGLNKLEGKPVTESKSLMERRLAQSKPAQSASAPVAVKPALPATPTASSPAAPAS
FT                   ATQPASQPATPVK"
FT   sig_peptide     complement(309972..310061)
FT                   /locus_tag="Bphy_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 30"
FT   gene            310206..310499
FT                   /locus_tag="Bphy_0265"
FT   CDS_pept        310206..310499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69458"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC94"
FT                   /protein_id="ACC69458.1"
FT                   /translation="MHDECALADTRSAKKCRRAARETREMKAEPAIPLHAHRYGLQPRT
FT                   HQRDRPCHLARGRMARTWREHVDQMAMPSGIGAASLKRTCRDLKRYRRGSRS"
FT   gene            complement(310518..311264)
FT                   /locus_tag="Bphy_0266"
FT   CDS_pept        complement(310518..311264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0266"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="KEGG: bxe:Bxe_A4181 phosphoglycerate mutase 1;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69459"
FT                   /db_xref="GOA:B2JC95"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC95"
FT                   /protein_id="ACC69459.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGTLLKD
FT                   SGYMFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAR
FT                   FGDEQVLVWRRSYDTPPPALEPTDSRTSYDDPRYAKVPREELPLTECLKDTVARVMPIW
FT                   NESIAPAIKSGRKVLIAAHGNSIRALVKYLDNISDSDIVGLNIPNGVPLVYELDENLKP
FT                   IKHYYLGDQEAIAKAQAAVAKQGKAG"
FT   gene            311357..311842
FT                   /locus_tag="Bphy_0267"
FT   CDS_pept        311357..311842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0267"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bxe:Bxe_A4180
FT                   putative rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69460"
FT                   /db_xref="GOA:B2JC96"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC96"
FT                   /protein_id="ACC69460.1"
FT                   /translation="MVGLPFPIYPVSFLFSGGSSVKFFTDYTNLVLIAIALISGALLLW
FT                   PSISRRGRGGLSAAAATQLINRRNAVVIDLRPAAEYAAGHLPSARQVEFGELQAKVGQL
FT                   VKNKSNPVLLVCQNGQQSNKAARIVRDAGYAEVHVLEGGVNAWQQAGMPVVKQGVAK"
FT   gene            311854..312102
FT                   /locus_tag="Bphy_0268"
FT   CDS_pept        311854..312102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0268"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   bxe:Bxe_A4179 putative glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69461"
FT                   /db_xref="GOA:B2JC97"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JC97"
FT                   /protein_id="ACC69461.1"
FT                   /translation="MYSTQVCPYCQMAERLLKSRGVEHIEKVLIDKDPARRQEMMTRTG
FT                   RRTVPQVYIGETHVGGYDDLSALDRAGGLTPLLEAVA"
FT   gene            312296..312766
FT                   /locus_tag="Bphy_0269"
FT   CDS_pept        312296..312766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0269"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: bxe:Bxe_A4178 protein export
FT                   chaperone SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69462"
FT                   /db_xref="GOA:B2JC98"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC98"
FT                   /protein_id="ACC69462.1"
FT                   /translation="MSDENNQPFFNIQRIYLKDMSLEQPNSPAIFLEQEMPSVEVEVDV
FT                   KAERLADTVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQIATQETGAGSAAHH"
FT   gene            312788..313786
FT                   /locus_tag="Bphy_0270"
FT   CDS_pept        312788..313786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0270"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: bxe:Bxe_A4177
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69463"
FT                   /db_xref="GOA:B2JC99"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JC99"
FT                   /protein_id="ACC69463.1"
FT                   /translation="MKVAVLGAGAWGTALAGHLAARHDTVLWARDATLISELSTSHENA
FT                   RYLAGVALPSTLRFQANLELALNHALDDAALCVVATPVAGLRAMLRTMRDMRKVPSHIV
FT                   WLCKGFEADSQLMPHQVVAQELSGHTSNGPLSGPSFAREVGQGLPVALTVASASAACRE
FT                   RTVAAFHHGAMRIYSGDDVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRGLAE
FT                   MSRLGAALGGRAETFTGLTGLGDLILTATGDLSRNRTVGMQLASGRSLDDILNALGHVA
FT                   EGVRCARSVLSLAQSHAIDMPITQAVCDVLFNGVAPRDAVSALLRRDAKPE"
FT   gene            313940..314491
FT                   /locus_tag="Bphy_0271"
FT   CDS_pept        313940..314491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0271"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   bxe:Bxe_A4176 putative appr-1-p processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69464"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA0"
FT                   /protein_id="ACC69464.1"
FT                   /translation="MLTIGHCMLEARVVDITTLDVDAVVNAANTSLLGGGGVDGALHRA
FT                   AGADLLRECQTLGGCVTGDAKITGGHRLKARHVIHAVGPVWHGGGRGEAELLASCYRRS
FT                   LELARDAKAKSIAFPAISCGVYRFPADEAVRIAMQTVIDTLPRVSTVERVIFACFDEAM
FT                   HARYKAEFGRRVQAPPSNPA"
FT   gene            complement(314464..314934)
FT                   /locus_tag="Bphy_0272"
FT   CDS_pept        complement(314464..314934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0272"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   bam:Bamb_2906 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69465"
FT                   /db_xref="GOA:B2JCA1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA1"
FT                   /protein_id="ACC69465.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDSKMR
FT                   RAGLDYHEYAQMHVHRNWDALIEMEAPNLARMFAFTTRGSRPFHSHAFLPGDWFVFGAE
FT                   TRGLPDAVVERFPNEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQAGFEGGA"
FT   gene            complement(314952..315758)
FT                   /locus_tag="Bphy_0273"
FT   CDS_pept        complement(314952..315758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0273"
FT                   /product="putative competence protein F-related protein"
FT                   /note="KEGG: bxe:Bxe_A4174 putative competence protein
FT                   F-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69466"
FT                   /db_xref="GOA:B2JCA2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA2"
FT                   /protein_id="ACC69466.1"
FT                   /translation="MPNRAFRWLGASRLGRSLQERVSGVARRSVSAWPALAHLALPNSC
FT                   ALCGNMSHQTLCCFCDEAWWNQARLRCTVCAVPLSGFRRASLMHYRCGDCLATPPAFDA
FT                   TVALADYRAPLDALAVGLKFRARLALANEFARRLAWSALDALDERDRPDVVAPVPLSAR
FT                   RLVERGYNQAWEIARPCAKALGVRSDATLVRRVVDTAPQSKLDLDARRQNVGRAFVVAT
FT                   RVRGLHVAIVDDVMTTGATLDALARTLKAAGARRVTNLVALRTPKN"
FT   gene            315848..316807
FT                   /locus_tag="Bphy_0274"
FT   CDS_pept        315848..316807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0274"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bxe:Bxe_A4173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69467"
FT                   /db_xref="GOA:B2JCA3"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA3"
FT                   /protein_id="ACC69467.1"
FT                   /translation="MSPTETGRPAYDSRRLRKIFDRRAATFDDVAFLPREIAQRMRERL
FT                   DYIKVNPVQVLDAGCGAGDDLPSLRERFPEAPVFGTDLSGAMLARAVTHDAADTGWRRF
FT                   LPASLGKALGSRGPRFAQADFSALPFASGAFELIWSNLALHWHSRPDLVFPEWQRVLKV
FT                   NGLLMFSTLGPDTLKELRGTYAEIEAAHGVNTHKHVIDFVDMHDLGDMLVESGFEIPVM
FT                   DQETLTITYKSPESLLADVRRWGAYPFRREALPGVASRRMHKALLAALEARRRGDGTIP
FT                   LTFEVIYGHAWKAVPRVTPEGHGIVRIEDIGRGRQGNR"
FT   gene            317078..317572
FT                   /locus_tag="Bphy_0275"
FT   CDS_pept        317078..317572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69468"
FT                   /db_xref="GOA:B2JCA4"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA4"
FT                   /protein_id="ACC69468.1"
FT                   /translation="MNATDLLAESEPVLKDWLMKRNCSVSPRQFVFFYVSLAAFSLAIA
FT                   FLLVLYGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFPNRLVIEQVSAEHLTQF
FT                   EFNPRWVRVEPGATPRDRIRLVSRGESVTVGQHLAQYRRAQFADELRLWIRQCQAQKVA
FT                   Y"
FT   gene            317629..319302
FT                   /locus_tag="Bphy_0276"
FT   CDS_pept        317629..319302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0276"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome c class I;
FT                   OmpA/MotB domain protein; cytochrome C oxidase subunit II
FT                   transmembrane region; KEGG: bxe:Bxe_A4171 putative
FT                   cytochrome c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69469"
FT                   /db_xref="GOA:B2JCA5"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA5"
FT                   /protein_id="ACC69469.1"
FT                   /translation="MEILGKEAMKTIKRALTGVLACSGLLFAGAALAVGDSPGGPRVNE
FT                   INLQPPVTRIAEELYSLHTFMLILCTVIFIGVFGVMFYSIFAHRKSKGYKAANFHESTT
FT                   VEIIWTVVPFIIVVLMALPATKTVVAMKDTTNADLTVKVTGYQWKWAYDYVKGPGEGIN
FT                   FFSTLTTPRAEVDGRQPITDTYLQEVDNPLVVPVNKKIRIITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFRAEKVGTYRGFCTELCGKEHAFMPVVVNVLSDEDYAKWVDDQKKKM
FT                   AAGQDDPNKNYTLAELMERGGKVYSANCAVCHQPTGKGAGAFPALDGSKVANGPLAEHV
FT                   SIVLKGKNAMPSWAPTLNDVEIASVITFERNSWGNHTGDILQPKQVADARNGRLPSGGD
FT                   HLAGAAAAAASDAAAASGAEGASGAPAASGEAGASATAPASGASDGAAASAPQASLPAS
FT                   VYFETNKSSLPTDAKAAIEAAAAYAKAHPDAKFALSGFTDATGSADKNAKLAKARAEAV
FT                   RDALKAAGIAEDHIILKKPETITGGADAKEARRVEISPAA"
FT   sig_peptide     317629..317730
FT                   /locus_tag="Bphy_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 34"
FT   gene            319348..320961
FT                   /locus_tag="Bphy_0277"
FT   CDS_pept        319348..320961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0277"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bxe:Bxe_A4170 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69470"
FT                   /db_xref="GOA:B2JCA6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA6"
FT                   /protein_id="ACC69470.1"
FT                   /translation="MSSIGHDVAAGHEHVHGDHAHETPHGWRRWLYATNHKDIGTLYLL
FT                   FSFIMFLSGGVMALGIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANW
FT                   MIPLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFVPGGATAAGWTLYAPLSTQMGPG
FT                   MDFAIFAVHIMGASSIMGGINIVVTILNMRAPGLTLMKMPMFVWTWLITAYLLIAVMPV
FT                   LAGAITMVLFDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPA
FT                   FARKPLFGYSSMVYATASIAILSFMVWAHHMFATGMPVTGQLFFMYATMLIAVPTGVKV
FT                   FNWVATMWRGSLTFETPMLFAVGFLFVFTFGGLTGLMLAMAPLDIQYHGTYFVVAHFHY
FT                   VLVAGSLFGLFAGWYYWSPKWTGWMYNETRGKIHFWSSLIFFNLAFLPMHFVGLAGMPR
FT                   RYADYPAQFADWNQVITIGAFGFGLAQVYFLFAVALPAYRGGGELEKASDKPWDGATGL
FT                   EWTVPSPAPFHTFENPPTVE"
FT   gene            321059..321196
FT                   /locus_tag="Bphy_0278"
FT   CDS_pept        321059..321196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69471"
FT                   /db_xref="GOA:B2JCA7"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA7"
FT                   /protein_id="ACC69471.1"
FT                   /translation="MSRNPQKRRTPEEIRAGNLRLGLILLAVVAVFFLGAVVKQVWFAS
FT                   "
FT   sig_peptide     321059..321175
FT                   /locus_tag="Bphy_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.444 at
FT                   residue 39"
FT   gene            321249..321860
FT                   /locus_tag="Bphy_0279"
FT   CDS_pept        321249..321860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0279"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: bxe:Bxe_A4169 putative cytochrome c
FT                   oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69472"
FT                   /db_xref="GOA:B2JCA8"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA8"
FT                   /protein_id="ACC69472.1"
FT                   /translation="MSTQPPAEADRSFNRPMLFKLVVVALLMFGFGFALVPMYRAICEV
FT                   TGINNLVQRDATAREAKNTQVDTSRTISIEFDANARGPLGFKPEQNSIDVHPGEVTTVM
FT                   YDVSNQQARTIQAQAIPSYAPKQATEYFKKIECFCFTQQTLKANESKRMPVVFVVDPKL
FT                   PKDVKTITLSYTFFELNAQPTTRGTDGQTADGAAKASNPA"
FT   gene            321900..322106
FT                   /locus_tag="Bphy_0280"
FT   CDS_pept        321900..322106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69473"
FT                   /db_xref="GOA:B2JCA9"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCA9"
FT                   /protein_id="ACC69473.1"
FT                   /translation="MNDSGHGRKSSFGQSMKAVMWSFFGVRKRRDLEADATQLNPLHVI
FT                   AAALIGAAIFIGVLILIVRVVVG"
FT   gene            322264..323121
FT                   /locus_tag="Bphy_0281"
FT   CDS_pept        322264..323121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0281"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bte:BTH_I0430 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69474"
FT                   /db_xref="GOA:B2JCB0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB0"
FT                   /protein_id="ACC69474.1"
FT                   /translation="MSGQNESPYYFIPHPSRHPISAAVGLLVMLGSFAAWVNGEPWAPI
FT                   TALIGLLWLLFTLYHWFGDAISESEGGMYGKRVDTSFRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIAMHQLGSLDYKLIWPDFTAVWPNIGPADLVSHFKSMTPWPVPTINTALLLSSG
FT                   ATLTVSHHALRDNHRTKAIAWLAATLVLGVSFLFLQGFEYFHAYNELNLTLASGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRLIRGHFTADHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   sig_peptide     322264..322368
FT                   /locus_tag="Bphy_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.633 at
FT                   residue 35"
FT   gene            complement(323355..323564)
FT                   /locus_tag="Bphy_0282"
FT   CDS_pept        complement(323355..323564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69475"
FT                   /db_xref="GOA:B2JCB1"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB1"
FT                   /protein_id="ACC69475.1"
FT                   /translation="MHILVPIAFALIIASMVSALYFMMHDRGKTKRMVWSLATRVGLSI
FT                   SLFLFILFAHWMGWIHSTGIPYGR"
FT   sig_peptide     complement(323505..323564)
FT                   /locus_tag="Bphy_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.642 at
FT                   residue 20"
FT   gene            323652..324419
FT                   /locus_tag="Bphy_0283"
FT   CDS_pept        323652..324419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69476"
FT                   /db_xref="GOA:B2JCB2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB2"
FT                   /protein_id="ACC69476.1"
FT                   /translation="MKIRLIPTLLILIVVAVTLRLGFWQRDRAHQKEALQAHIAQFESA
FT                   PAQRIGAAPIALKDIEFHRVRAVGQFMPQQVVYLDNRPYNDQAGFYVVMPFKLRDGGYV
FT                   LVNRGWLPRNMNERTAIAPYDTPKGEIEIEGIARADASRAYELGQGGSAAHQPIRQNLD
FT                   VASYAAETGLPLQPFVIQQTGDTGDKLVRDWPAPATGVERNYGYMFQWWGMAAAAVVFG
FT                   LYAARRGAKNAKRVDSKRPESNDAANNGPAPHA"
FT   sig_peptide     323652..323720
FT                   /locus_tag="Bphy_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.405 at
FT                   residue 23"
FT   gene            324480..325151
FT                   /locus_tag="Bphy_0284"
FT   CDS_pept        324480..325151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69477"
FT                   /db_xref="GOA:B2JCB3"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB3"
FT                   /protein_id="ACC69477.1"
FT                   /translation="MSTHNSRSQQTRQQRAQDGKGVVPGQPDGKGSWQRGRWTLLLIAL
FT                   VCAAPVLGSYFTYYVIKPKGGTTSYGALINPQRPIPEALVVMGEDGKPKKLASLRGRWL
FT                   MISVDRSACDKPCVTKLYFMRQVRATQAGERERIVNVFLRTDPGKVPDIVDNAYKDTEM
FT                   LIADPKEVAAWLPAEDGTQITDHIYMVDPSGNLMMRFPKDPNPTKIKGDVTKLLKNSGI
FT                   G"
FT   gene            325203..326312
FT                   /locus_tag="Bphy_0285"
FT   CDS_pept        325203..326312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0285"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   bxe:Bxe_A4163 putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69478"
FT                   /db_xref="GOA:B2JCB4"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB4"
FT                   /protein_id="ACC69478.1"
FT                   /translation="MFVLQLGLIGLCIALLPLSYVWVKADDNKFRKLVWVTTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAISAAYRAMPSGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIVAQTIIAWVARLKRRPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVI
FT                   VTTHLLLGLALLGTLGWLAARQTPVPAYEPEASRWRAAALFGLALLIVQIALGGWVSTN
FT                   YAVLACTDFPTCNGQWVPPMDFRHAFHLWRALGMTGDGDVITQDALVAIHWTHRTFAFV
FT                   VVLYLLWFALKLRRFESLRRPANGVLLVIVIQFVTGLSNIVLQWPLPIAVAHNGGAAIL
FT                   LLLLVMLNFRIAYSRPGRAVIHARDAAPA"
FT   sig_peptide     325203..325274
FT                   /locus_tag="Bphy_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.618 at
FT                   residue 24"
FT   gene            326318..327223
FT                   /locus_tag="Bphy_0286"
FT   CDS_pept        326318..327223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0286"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: bxe:Bxe_A4162 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69479"
FT                   /db_xref="GOA:B2JCB5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB5"
FT                   /protein_id="ACC69479.1"
FT                   /translation="MDSTTLPHSPGSRISQYIALTKPRVTQLAVFCAVIGMFLATPGMV
FT                   PWTVLIGGAVGIWLLAGAAFAINCLVEQKVDAKMRRTAWRPSARGEITTSQILLFSAVL
FT                   GAVGMWTLYTFTNALTMWLTIATFVGYAIIYTLLLKPYTPQNIVIGGASGAMPPALGWA
FT                   AVTGAVPGDAWILVLIIFVWTPPHFWALALYRRKDYENAGLPMLPITHGEQYTRLHIFL
FT                   YTVILFAVTMMPFISGMSGIVYLASAVLLGAVFLAYAWKIYREYSDDLARKTFRYSIVY
FT                   LSLLFAALLIDHYARALIGA"
FT   gene            327228..327845
FT                   /locus_tag="Bphy_0287"
FT   CDS_pept        327228..327845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0287"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: bxe:Bxe_A4161 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69480"
FT                   /db_xref="GOA:B2JCB6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB6"
FT                   /protein_id="ACC69480.1"
FT                   /translation="MLTERFARAARVAFVACALGGAALVSGCGKEQPAFTNVDITGNKQ
FT                   FGTDFSLPDSSGKTRTLADYKGKVVVLFFGYTHCPDVCPTTMAELSQALQQLGPEDAKR
FT                   VQVLFVTVDPERDTPELMAQYVPAFNPTFVGLRPADQAQLTKVTKDFRVYYAKVPGKSP
FT                   DSYTMDHTAASYVFDTDGKLRLFARDGQGASPWVHDLKLLLG"
FT   sig_peptide     327228..327311
FT                   /locus_tag="Bphy_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.528 at
FT                   residue 28"
FT   gene            complement(327923..328213)
FT                   /locus_tag="Bphy_0288"
FT   CDS_pept        complement(327923..328213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0288"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: bxe:Bxe_A4160 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69481"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB7"
FT                   /protein_id="ACC69481.1"
FT                   /translation="MYVVSLTYTASLDRVDDALEAHRAFLVRQFDAGVFIMAGPKVPRD
FT                   GGVIIAAGIERSRLDDILASDPFAQQKLARYDVTEFKATRMAPGMNLKVPE"
FT   gene            328433..330229
FT                   /locus_tag="Bphy_0289"
FT   CDS_pept        328433..330229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0289"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: bxe:Bxe_A4159 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69482"
FT                   /db_xref="GOA:B2JCB8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB8"
FT                   /protein_id="ACC69482.1"
FT                   /translation="MSRMSLNRKLWLSLVLVWLGLLGVGLWSAVETRSTMLDERKAGMV
FT                   NLVDAAQGIVNGYYALAQAGKMNEADAQREALARLATMRYGESGYLFVMDSKPVVLMHP
FT                   TLPQMNGKAVGDFKDPDGKLLYVSIVDAAKATGKGFAEYRGRLPHSEQAVPKISYAVRF
FT                   APWDWNIVSGVFVRDIDTAYYANLIEHFIVVLVIGAGISFAMLLIIRNVRGSLGGEPQD
FT                   AAKLAARIATGDLTQIVPVRPNDSTSMMAAMNEMQSRLQRAISEIRGSAESIASATQQI
FT                   AAGNGDLSQRTEQQAASLQETAASMEELTATVKQNADNARQASGLANNASDIATKGNEV
FT                   VSRVISTMTEINDSSRQISDIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRSLAQRSATAAKEIKQLIGDSVERVNNGYTLVEQAGATMSDIMQAVRRVTDIMGEIAA
FT                   ASEEQSSGISQVGRAVTQMDEVTQQNAALVEQAAAAAASLQDQATRLRQTIGAFRVNGS
FT                   DDVVTTVAAPPVAKPASKPMSRPAPKAPVESATAQTNPAPHDSVSRAAASHDGPTPPAA
FT                   RKPAPAPRPAAPKSSDDDWTTF"
FT   sig_peptide     328433..328519
FT                   /locus_tag="Bphy_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.978 at
FT                   residue 29"
FT   gene            330475..331287
FT                   /locus_tag="Bphy_0290"
FT   CDS_pept        330475..331287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0290"
FT                   /product="lipoprotein, YaeC family"
FT                   /note="TIGRFAM: lipoprotein, YaeC family; PFAM: NLPA
FT                   lipoprotein; KEGG: bxe:Bxe_A4158 ABC transporter,
FT                   periplasmic ligand binding protein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69483"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCB9"
FT                   /protein_id="ACC69483.1"
FT                   /translation="MQRRTLIKVFSAALASAALVTSFGAHADDKVIKVGTISGPDAQIW
FT                   SVVQKVAKREGLNVKVIEFNDYVQPNAALDAGDLDANSFQHQPYLDSQVKQRGYKIVNA
FT                   GLTYISPLGIYSKKLKSLKDLPQGAKVAVPNDPSNENRALLLLQAQGVIKLKAGAGTNG
FT                   NNATPLDVADNPKKVKLVELDAAQLPRSLSDVDAAAINTNYALAAGMQPTKDAIALEDV
FT                   HSPYANLIAVRAKDKDQPWVKKLVAAYQSEEVRQFIKTEFKGSVVPSF"
FT   sig_peptide     330475..330558
FT                   /locus_tag="Bphy_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(331378..332301)
FT                   /locus_tag="Bphy_0291"
FT   CDS_pept        complement(331378..332301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0291"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; regulatory
FT                   protein MarR; KEGG: bxe:Bxe_A4157 transcriptional
FT                   regulator, MarR family with acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69484"
FT                   /db_xref="GOA:B2JCC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC0"
FT                   /protein_id="ACC69484.1"
FT                   /translation="MNDPDRVRAEEVRHFNRFYTKHIGALHEHLQRSPFSLTEVRVMHE
FT                   LSRSEHQTAAALARDLGIDSGYLSRLLASFERRNLISRRPSEIDARQSLVSLTETGLAA
FT                   YRPLDAAAIDEVAAVLARLAPHSQEQLIAAMKLIERLLDERPRHSIVTLRAPRAGEYGL
FT                   LVSRQAQLFAHGHGWDHTFEALLAQRAARFAHAHDARREICWVAEQDGLIVGSALVATA
FT                   SDAQANVHMLYVEPDVRQLGIGTQLINECMRFAKRAGYRTLSVESESSLDDARRLFTQA
FT                   GFALRAAAPERRFGRDLVIEQWERSV"
FT   gene            332679..333413
FT                   /locus_tag="Bphy_0292"
FT   CDS_pept        332679..333413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0292"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bxe:Bxe_A4156 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69485"
FT                   /db_xref="GOA:B2JCC1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC1"
FT                   /protein_id="ACC69485.1"
FT                   /translation="METRWSALTPDVHNVTPLYLQLARNLATAIHCGVWSAGEALPSER
FT                   TLSDAIGVSRITARKAIALLVEQGLIRRARGAGSFITPRVEDPLSRLTGFTKKMEQRGF
FT                   RPDSVWLERGLRNASRDEIVHLGLSPGASVASLRRLRRADGIVMAVEHSSLPASIVPDP
FT                   QAIGGSLYSYLEQRGAPVVRALQHFRAVNASSEIATLMDLVPGSALLLITRVGYSADQR
FT                   AIELTDTYCRDDYYDFVAELRL"
FT   gene            333493..334596
FT                   /locus_tag="Bphy_0293"
FT   CDS_pept        333493..334596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0293"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: bxe:Bxe_A4155 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69486"
FT                   /db_xref="GOA:B2JCC2"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC2"
FT                   /protein_id="ACC69486.1"
FT                   /translation="MLTGNILTPEGWIHGTIEFESGRISAIKGDAVDPSKNDAPYILPG
FT                   FIDLHVHGGGGADVMEAGNAIEAITRTHARFGTTSLLATTMTAPRDELMSVVAGLGDVA
FT                   KNRVPGGARVLGVHLEGPYINPGKLGAQPDAAVSAVLDEVLKYLSIAPIRVVTIAPEIS
FT                   GHMDIISEINARGVRVQLGHSLGTYDDAVAAMKHGARSFTHLFNAMSALHHRNPGMVGA
FT                   ALAHAEYAEIIPDLLHVHPGAIRAAMRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSLGLPVADVSNRMSRYAADYLGIEDRGRLARGA
FT                   WADVVVFDRELALTATYVEGESIVEYA"
FT   gene            334589..335596
FT                   /locus_tag="Bphy_0294"
FT   CDS_pept        334589..335596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0294"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: bxe:Bxe_A4154
FT                   glutamine-fructose-6-phosphate transaminase(isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69487"
FT                   /db_xref="GOA:B2JCC3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC3"
FT                   /protein_id="ACC69487.1"
FT                   /translation="MLKEALASADVVAAQLNDTSRVEALAARLALEPRHVALTVARGSS
FT                   DHAASYFASLTMSRVGLPVASLPMSVATLQQAPLKVSNQLALGFSQSGKSPDLVGTMQA
FT                   LREAGALTVAAVNVPGSPLEQACEFYLPLVAGPELSVAATKSYIAMLSVSAQLVAHWQK
FT                   DDALLGALKSLPDALARAGALDWSKAVDELRDVERMIVIGRGLGLAIAQEAALKLKETS
FT                   GIQAEAFSSAEVRHGPMELIDRDYPLLVFAPRGPEQSGLLQLARDMQARGARVLLAAPG
FT                   DVPEATLPLVSTAHAALDPIAAILSFYVMAAGLAAARGRNPDAPRHLMKVTETH"
FT   gene            335610..338195
FT                   /locus_tag="Bphy_0295"
FT   CDS_pept        335610..338195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0295"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: PTS system, glucose subfamily, IIA subunit;
FT                   phosphocarrier, HPr family; phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: phosphocarrier HPr protein;
FT                   PEP-utilizing protein; sugar-specific permease EIIA 1
FT                   domain; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: bxe:Bxe_A4153 PTS system,
FT                   sugar-specific EIIA/HPr/EI components"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69488"
FT                   /db_xref="GOA:B2JCC4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC4"
FT                   /protein_id="ACC69488.1"
FT                   /translation="MRRVEESRLKSHSEGHIVLLAPMTGPVVPLANVPDPVFSGGMFGD
FT                   GIGIDPLEGKLVAPCDGVVMHLARTGHAVTITTAEGVEVLLHIGIDTVELNGKGFAPMI
FT                   EQGAKVRTGDVLIEFDQDAVARHAPSLVSVIAIANSDAFEVVDRAESGTLKAGESPLLT
FT                   LRVRDGAAVAASRQASSVSEEARQSIVLEHAGGLHARPAARAREAARGLDARVEVRFEG
FT                   KKAAIESVVGLLGLGAGQGASVEIVGIGAQAHAAVEAVVRELTREAHGEAEEKPARQMS
FT                   PAPVTVPKTGGEALVPNTLAGVCAAPGIAVGKLVRWDDADIEPPETTGNTPAAESRQLD
FT                   KALAAVDAELNTTVRDASQRGAHGEAGIFAVHRVLLEDPTLIDAARDLISLGKSAGFAW
FT                   RETIRAQIGVLSKVDDALLAERAADLRDIEKRVLRALGHSNAAARSLPEEAVLSADEFT
FT                   PSDLSSLDRKRVTALVMARGGATSHAAIIARQAGIPALVAMGDQLHAIAEGTQVVVDAT
FT                   AGRLEYAPSAQDVERARNERQRLAGVREANRRTSQQAAATSDGRAIEVAANIATLDDAT
FT                   AAVDNGADAVGLLRTELLFIHRQAAPTVDEHRQSYQSIVEALQGRTAIIRTLDVGADKE
FT                   VDYLTLPPEPNPALGLRGIRLAQVRPDLLEDQLRGLLSVQPAGKVRILLPMVTDAGELV
FT                   RLRRRIDELAAALGRTERIEVGAMIEVPSAALLADQLAEHADFLSIGTNDLTQYTLAMD
FT                   RCQPDLAAQADGLHPAVLRLVSVAVQGAEKHGKWVGVCGALAGDPLAVPLLVGLGVTEL
FT                   SVDPVSVPGIKARVRKLDYRLCHQRALDALALESAQAVRALSREIWPQD"
FT   gene            338304..340070
FT                   /locus_tag="Bphy_0296"
FT   CDS_pept        338304..340070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0296"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: bxe:Bxe_A4152 PTS
FT                   system, N-acetylglucosamine-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69489"
FT                   /db_xref="GOA:B2JCC5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC5"
FT                   /protein_id="ACC69489.1"
FT                   /translation="MDGNPFLKVQRLGRALMLPIAVLPVAGLLLRLGQPDVFNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAALAGAIGYLIEVAVMKDINDKLNMGVLSGI
FT                   IAGIVAGMLYNRYKDIKLPDYLAFFGGKRFVPIVTGVACLVLGIVFGYAWAPVQAAIDA
FT                   AGHWLTTAGAVGAFVFGLLNRLLLVTGLHHILNSLAWFVFGTFTPPGGAAVTGDLHRFF
FT                   AGDPTAGTFMTGFFPIMMFGLPAACLAMLHEAPKERRALVGGLLFSMALTSFLTGVTEP
FT                   IEFSFMFLAPVLYAIHAVLTGLSLAICSALGIKLGFTFSAGAIDYVLNYGLSTKGWEAI
FT                   PIGIAYSVVYYGLFRFFIRKFNMATPGREQETPDVANESFSADGFVAPVGGSAATSGTR
FT                   AQRYIAALGGAANLSVVDACTTRLRLSVVDSEKVSDNELKSIGARGVLKRGGGNVQVII
FT                   GPEADIIADEIRTTIASGGAAAASPAKPAVASAPVVTAATAATAAAGNGPLDPDPLRWL
FT                   AVFGGATNVVSLEAVAATRLRIVVRDASAIDRQRLDTLNVAWVSTDTFHIVVGDAAPRY
FT                   AQQLSTRLTATA"
FT   gene            complement(340141..340260)
FT                   /locus_tag="Bphy_0297"
FT   CDS_pept        complement(340141..340260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0297"
FT                   /product="cyd operon protein YbgT"
FT                   /note="TIGRFAM: cyd operon protein YbgT; PFAM: membrane
FT                   bound YbgT family protein; KEGG: bte:BTH_I2310 cyd operon
FT                   protein YbgT, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69490"
FT                   /db_xref="GOA:B2JCC6"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC6"
FT                   /protein_id="ACC69490.1"
FT                   /translation="MWYFSWILGIGLALALGIINVMWLEANNAVDAQAARDER"
FT   gene            complement(340272..341408)
FT                   /locus_tag="Bphy_0298"
FT   CDS_pept        complement(340272..341408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0298"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: bxe:Bxe_A4149 cytochrome bd ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69491"
FT                   /db_xref="GOA:B2JCC7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC7"
FT                   /protein_id="ACC69491.1"
FT                   /translation="MDYPTLKLVWWVLVGVLLIGFALTDGFDMGAAILLPFIGKTDAER
FT                   RIVVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFSLFFRPVGFD
FT                   YRGKRDDPRWRSACDWALFVGGFVPALVFGVAFGNLLQGVPFAFDQELRVTYHGSFFAL
FT                   LNPFALLCGVVSVSMLAAHGAAFVKMKADGVVARRASIALRAASLIAVGLFLIAGVLVA
FT                   TLIGGYQISEPAPLDTVANPLLKNVMGAPGLWLTNYAMYPWMIAAPLAGVVGGVLALVL
FT                   ANSRFERTAFLSTSLMVTGVILTAGFSMFPFIMPSSLDGRSSLTVWDSTSSQMTLQIML
FT                   IAVIVFLPLVLIYTSWVYRVMRGKVTADAIEQNHHSMY"
FT   gene            complement(341435..343024)
FT                   /locus_tag="Bphy_0299"
FT   CDS_pept        complement(341435..343024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0299"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bxe:Bxe_A1908 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69492"
FT                   /db_xref="GOA:B2JCC8"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC8"
FT                   /protein_id="ACC69492.1"
FT                   /translation="MPASDVVDLSRLQFAVTALYHFLFVPLTLGLSWLLVIMESVYVMT
FT                   GKQIYKDMTQFWGKLFGINFAMGVTTGLTLEFQFGTNWSYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWNRLSRVQHLMVTFLVALGSNLSALWILIANGWMNNPVGAEFNY
FT                   ETMRMELSSIFDVIFNPVAQVKFVHTVSAGYVTASMFVLGLSSWYLLKRRDIDFALRSF
FT                   AVAAGFGLAATLCVIVLGDESGYTTGEVQQMKLAAIESEWETAPPPAPFTIFGMPNQQE
FT                   ERTDYALRVPYALGIIATRSLDEPVVGLKELMAQNETRIRNGILAYGALQKIRQGDATD
FT                   ETHATFDSNKKDLGYGLLLRQFTPNVTDATADQIKQAAKKTVPPVLPVFWSFRLMVGLG
FT                   ILFLATFVLAFFFCAQRSLLFENRRWFLHWAVWAIPLPWLAAEFGWIVAEVGRQPWTIA
FT                   GILPTSLSSSSLTAGDLYLSLAGFVVFYTALFIVEITLMFKYARLGPSSLHTGRYHHEQ
FT                   STQAAIGANTAA"
FT   gene            complement(343014..343286)
FT                   /locus_tag="Bphy_0300"
FT   CDS_pept        complement(343014..343286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69493"
FT                   /db_xref="GOA:B2JCC9"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCC9"
FT                   /protein_id="ACC69493.1"
FT                   /translation="MATTLNHRNATHRALASRIVAWARGPTFARDILIVLAIKFLLLIA
FT                   LKFAFFNHPQARNMSLPPAQVAQALLSVPASVQSPLQHRGDNHAR"
FT   gene            complement(343600..344535)
FT                   /locus_tag="Bphy_0301"
FT   CDS_pept        complement(343600..344535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0301"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; KEGG: bxe:Bxe_A4146 sigma 32
FT                   (RpoH)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69494"
FT                   /db_xref="GOA:B2JCD0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD0"
FT                   /protein_id="ACC69494.1"
FT                   /translation="MSNTLTLPSTLSPSSAKAAPAGALALSHASLLPGQLGNIDAYIQA
FT                   VNRIPMLTPAEERQFATEYREQNNLESARKLVLSHLRLVVSIARNYLGYGLPHADLIQE
FT                   GNIGLMKAVKRFDPEQNVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLR
FT                   SHKQGLQSFTPDEIDGLAKELNVKREEVAEMETRLSGGDVALEGQVEDGEEAFAPIAYL
FT                   ADSHSEPTAVLAARQRDRLHSDGIASALESLDSRSRRIIEARWLQVEDDGSGGSTLHEL
FT                   ADEFGVSAERIRQIEASAMKKMRTALAEYA"
FT   sig_peptide     complement(344479..344535)
FT                   /locus_tag="Bphy_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.987 at
FT                   residue 19"
FT   gene            344862..345461
FT                   /locus_tag="Bphy_0302"
FT   CDS_pept        344862..345461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69495"
FT                   /db_xref="GOA:B2JCD1"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD1"
FT                   /protein_id="ACC69495.1"
FT                   /translation="MSSLKLASDGRTMEKKNRRWTNLAGKCAAAAVFLSLSGLASADQF
FT                   GIQITGATADEHVRKLDLGFVWDPHLTWWEIGGWHFALLGEAHAAWWHTDEGNVHQNIG
FT                   EFGVTPVIRFIKGSGAFRPFVEAGVGVRVLTSPRISSTFSLGSAFQFADMVGAGAQFGD
FT                   HQQYQLGYRFQHVSNGGIKEPNPGINFHQIYVQYNF"
FT   sig_peptide     344862..344990
FT                   /locus_tag="Bphy_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 43"
FT   gene            345507..345890
FT                   /locus_tag="Bphy_0303"
FT   CDS_pept        345507..345890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69496"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD2"
FT                   /protein_id="ACC69496.1"
FT                   /translation="MVAKVIEAIRGLERDRFRAMVEGNGQQLHALLSDNVIYVHTNGKR
FT                   ESKQQFIDGITAGRRRYRQIEVQSQEVLPVGREACVITGRALIEMEANNGALLFPIAYM
FT                   AVQAQEDGKWRLIAWQATRCAIE"
FT   gene            complement(346020..347675)
FT                   /locus_tag="Bphy_0304"
FT   CDS_pept        complement(346020..347675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0304"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: bvi:Bcep1808_2917 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69497"
FT                   /db_xref="GOA:B2JCD3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD3"
FT                   /protein_id="ACC69497.1"
FT                   /translation="MLRNPAEKYRPFPTVRLTGRKWPSRTIDRAPIWMSTDLRDGNQSL
FT                   IEPMSIPQKTEFFEMLVATGFKEIEVGFPSASQTDFDFVRKLINEKRIPDDVTIEVLVQ
FT                   SRADLIARTFEALEGVPRAIVHLYNAICPSFRRIVFNQSQEEVKALAVEGTRIIREHAD
FT                   ARPQTHWTYQYSPETFSMTELPFAREVCDAVAQTWRPTRDHKMIVNLPATVEAATPNVY
FT                   ADQIEWMDRNLGYRDSIVLSVHPHNDRGTAVAAAELALMAGADRIEGCLFGNGERTGNV
FT                   DIVTLAMNLYTQGIDPGLDFSDIDAVRRVVERCNQIPVHPRHPYAGDLVYTAFSGSHQD
FT                   AIRKGFAQQKAGAVWEVPYLPIDPADVGRSYDAVIRVNSQSGKGGSTYLLERGMGFAPP
FT                   RRVQIEFSHAVQTVADQSGEEVTGDAICALFAREYFETEGPAQRVNGSTVRWNKREIGV
FT                   PAAAAAVDGHEAYARAVAQEMTAAAKQDIEITSFETMRTTDGRTAVFVGCRIGDQPMRH
FT                   GVGVSKDEMTAVVDAVVSGVNRAGWPAVDRRVAA"
FT   gene            complement(348195..349163)
FT                   /locus_tag="Bphy_0305"
FT   CDS_pept        complement(348195..349163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0305"
FT                   /product="glycosyl transferase family 3"
FT                   /note="PFAM: glycosyl transferase family 3; KEGG:
FT                   bxe:Bxe_A4143 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69498"
FT                   /db_xref="GOA:B2JCD4"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD4"
FT                   /protein_id="ACC69498.1"
FT                   /translation="MTDLTNTTPVPCARFIKEIGRGPNGARALTPDDTQALYAAMLDGR
FT                   VCDLELGAILLAYRVKGESADELAAMLAAAHASFAPVDVKHGTHQAVSIPSYNGARKQP
FT                   NLVPLLALLLAREGVPVLVHGVTEDPGRVTSAEIFAHLNVAPAQTHSDIEADLARQRIA
FT                   FAPIGTLAPKLARLLSLRRRMGVRNSTHTLVKILQPFAPAGLRLVNYTHPPYRESLTQL
FT                   FVSHPELAIGGALLARGTEGEAVADTRRQVQIDWLHDGICETRVAAERSSPDAPEVDLP
FT                   EGRDAPTTAAWIADVLRGDAPVPAAITRQVELIVEIARKAA"
FT   gene            349409..350107
FT                   /locus_tag="Bphy_0306"
FT   CDS_pept        349409..350107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0306"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bxe:Bxe_A4142 putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69499"
FT                   /db_xref="GOA:B2JCD5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD5"
FT                   /protein_id="ACC69499.1"
FT                   /translation="MGYVFAPAPVTAVPVVGSDDQFAVRRIYCVGRNYEAHAREMGHDP
FT                   DREPPFFFAKPADAVLYVAPGATGEFPYPAQSKNVHYEMELVAAIGKAGKNIPASNALD
FT                   HVYGYALGLDMTRRDLQAEAKKLGRPWDTAKGFDYSAPLGPIHPVSKVGHVDKGAIFLT
FT                   VNGEEKQRSDVSQLIWSVAETIEYLSSFFELQPGDLIFTGTPEGVGAIVRGDLMKGGVE
FT                   GLGEFSVRMV"
FT   gene            350142..350786
FT                   /locus_tag="Bphy_0307"
FT   CDS_pept        350142..350786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0307"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: bxe:Bxe_A4141
FT                   maleylacetoacetate isomerase (HmgC)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69500"
FT                   /db_xref="GOA:B2JCD6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD6"
FT                   /protein_id="ACC69500.1"
FT                   /translation="MKLYSYFRSSASYRVRIALNLKNLPYEYVPVHLLRDGGEQFKPEY
FT                   RKLNHDAIVPTLVDNGHVITQSLAIIEYLEETHPEPALLPSKPADRAYVRSIVQQLACE
FT                   IHPLNNLRVLKYLKRTVGVSDEVKDAWYHHWISSGFAALEEYLVADGRAGMLCFGDTPT
FT                   IADICLVPQVFNASRFNVDLSPYPTIRRICDYANSLDAFARAEPSVQPDAE"
FT   gene            complement(350900..352078)
FT                   /locus_tag="Bphy_0308"
FT   CDS_pept        complement(350900..352078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0308"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: bxe:Bxe_A4140 signal recognition
FT                   particle-docking protein FtsY(cell division protein);
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69501"
FT                   /db_xref="GOA:B2JCD7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCD7"
FT                   /protein_id="ACC69501.1"
FT                   /translation="MFSFFKRFKGSKAPDDTPEASQTERGADLDMQDLAEPAAPAAARP
FT                   QALPDSADAPEFDPDYVPDAADFEDADKEADESDANVEIVPPPVPEAAARRSWLTRLRS
FT                   GLSKTSSSITGIFVGTRIDEDLYEELETALLMSDAGVDATEYLLETLREKVRSERLTDP
FT                   QQVKSALRTLLVDLLKPLEKSLTLGHYHPTVMMIAGVNGAGKTTSIGKLAKHMQRFNQS
FT                   VLLAAGDTFRAAAREQLAIWGERNNVMVVQQESGDPAAVIFDAVGAARARKINVVMADT
FT                   AGRLPTQLHLMEELRKVKRVIGKAMAGAPHEVLLVIDANTGQNALAQVKAFDDALGLTG
FT                   LIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAEEFSDALLG"
FT   gene            352403..353017
FT                   /locus_tag="Bphy_0309"
FT   CDS_pept        352403..353017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0309"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: bxe:Bxe_A4139 conserved
FT                   hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69502"
FT                   /db_xref="GOA:B2JCN3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCN3"
FT                   /protein_id="ACC69502.1"
FT                   /translation="MSRTSSARAKSAPSGRGQAHTIRIIGGDWKRTPLPVIDLDGLRPT
FT                   PDRVRETLFNWLGQRLDGQRCLDLFAGSGALGFEAASRGAARVLMVERNARAAAQLRAN
FT                   QAKLSAGAIEIAEADALRLAASLAPGSFDVVFLDPPFGEDLLGRSLEVAVPLVSANGFL
FT                   YVESGQSLDAAGFAALAGWSVVRQGKAGAVHYHLLQRENEE"
FT   gene            353135..353641
FT                   /locus_tag="Bphy_0310"
FT   CDS_pept        353135..353641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0310"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: bxe:Bxe_A4138 coenzyme A biosynthesis protein,
FT                   cytidyltransferase-related; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69503"
FT                   /db_xref="GOA:B2JCN4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCN4"
FT                   /protein_id="ACC69503.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKRPFF
FT                   NLEERLEIANEVLGHYPNVQVMSFKGLLKDFVRVNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEKRLQDKVAALEQA
FT                   RAANP"
FT   gene            353788..354045
FT                   /locus_tag="Bphy_0311"
FT   CDS_pept        353788..354045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0311"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bxe:Bxe_A4137 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69504"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCN5"
FT                   /protein_id="ACC69504.1"
FT                   /translation="MALMITDECINCDVCEPECPNDAISMGPEIYVIDPKKCTECVGHF
FT                   DEPQCVQVCPVECIPRNPDYLETAEQLMEKYNGLQAAKSA"
FT   gene            complement(354115..355206)
FT                   /locus_tag="Bphy_0312"
FT   CDS_pept        complement(354115..355206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0312"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: bxe:Bxe_A4136
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69505"
FT                   /db_xref="GOA:B2JCN6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCN6"
FT                   /protein_id="ACC69505.1"
FT                   /translation="MSRYWSDIVHRLTPYVPGEQPALAHPVKLNTNENPYPPSPAVLRA
FT                   IRDELGEHAESLRRYPDPTARVLRETVAAHHGLNADQVFAGNGSDEVLATVFQALLKHD
FT                   KPILFPDITYSFYPTYARLYDVEYRTIPLDDAFQIRIDDYMQHDGEANGGILFPNPNAP
FT                   TGHALPLSDIERVVAANPESVVVVDEAYVDFGAQSAISLIGKYPNLLVVHTTSKSRSLA
FT                   GMRVGFAFGDVELIDALNRVKDSFNSYPLDRLAQAAATAAYKDDAWFRECTERVIASRE
FT                   RLTSQLTALGFEVVPSSANFLFARHDGYDAATLAAQLREKEIFVRHFELPRIDQHLRIS
FT                   IGTDAECDTLVDALKDILGGYVG"
FT   gene            complement(355246..355848)
FT                   /locus_tag="Bphy_0313"
FT   CDS_pept        complement(355246..355848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0313"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   bur:Bcep18194_A6134 aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69506"
FT                   /db_xref="GOA:B2JCN7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCN7"
FT                   /protein_id="ACC69506.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLIDQLAREAGTTLRDERRFH
FT                   GFYAKARLYGEEVHLLEPMTYMNRSGQSVVALAHFFKILPDQILVAHDELDLPPGTVKL
FT                   KLGGGSGGHNGLKDISAHLSTQQYWRLRIGIGHPRDLIPDSARAGAKPDVANFVLKPPR
FT                   KEEQDLIDASIERALAVMPVVVKGELERAMMQLHRNP"
FT   gene            complement(355969..356580)
FT                   /locus_tag="Bphy_0314"
FT   CDS_pept        complement(355969..356580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0314"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   bxe:Bxe_A4134 ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69507"
FT                   /db_xref="GOA:B2JCN8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCN8"
FT                   /protein_id="ACC69507.1"
FT                   /translation="MKVVAFERNLQGTGASRRLRNSGKAPGIVYGAGEPQLIELDHNAL
FT                   WHALKKEAFHSSILELEVAGKSQQVLLRDVQYHPFRQLVLHVDFQRVDAKKKLHTKVPL
FT                   HFMNQETNPAVKLGGAIISHVINEIEIECLPAALPEFIEVDLAKIEAGQSLHATDIALP
FT                   AGVALVAHLVAENPVIVSAPIPAGAQSEEAAAEGEKPAAE"
FT   gene            complement(356737..357693)
FT                   /locus_tag="Bphy_0315"
FT   CDS_pept        complement(356737..357693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0315"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bxe:Bxe_A4133 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69508"
FT                   /db_xref="GOA:B2JCN9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCN9"
FT                   /protein_id="ACC69508.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPTNDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKVVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRKQN
FT                   HENLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGATKVFAYATHPVLSGGAGPRIAASALDELVVTDTIPLSE
FT                   EARQCAKIRSLTSAGLLAETFSRIRRGDSVMSLFAES"
FT   sig_peptide     complement(357634..357693)
FT                   /locus_tag="Bphy_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.657 at
FT                   residue 20"
FT   gene            complement(357741..357817)
FT                   /locus_tag="Bphy_R0024"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(357741..357817)
FT                   /locus_tag="Bphy_R0024"
FT                   /product="tRNA-Gln"
FT   gene            complement(357869..358750)
FT                   /locus_tag="Bphy_0316"
FT   CDS_pept        complement(357869..358750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0316"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: bxe:Bxe_A4132
FT                   4-diphosphocytidyl-2C-methyl-D-erythritolkinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69509"
FT                   /db_xref="GOA:B2JCP0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCP0"
FT                   /protein_id="ACC69509.1"
FT                   /translation="MIETNDSLRDCLAPAKLNLFLHITGRLPNGYHALQTVFQLLDWGD
FT                   TLHFTRRDDGAITRGTDIVDVPADADLTVRAAKLLKEHTGTREGVNIEIDKRLPMGAGL
FT                   GGGSSDAATTLLALNRLWKLNLPRAELQVLSVKLGADVPFFVFGKNAFAEGIGEELEQV
FT                   QLPPRHFLVVTPRVHVPTSAIFSEKELTRDTKPLTIADFLAQHSCSAEWPDSFGRNDMQ
FT                   QVVAGKYAEVAQVLRWFDNIAPARMTGSGASVFAAFRSKDEAVAAHAKLPVGWSGAVTA
FT                   SLDTHPLFAFAA"
FT   gene            complement(358777..359409)
FT                   /locus_tag="Bphy_0317"
FT   CDS_pept        complement(358777..359409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0317"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="PFAM: outer membrane lipoprotein LolB; KEGG:
FT                   bxe:Bxe_A4131 putative outer membrane lipoprotein carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69510"
FT                   /db_xref="GOA:B2JCP1"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP1"
FT                   /protein_id="ACC69510.1"
FT                   /translation="MHFSFPVFSSPAPRRAALGLATAAILALSGCASVKPQGPSTSNAA
FT                   TAVTAQTSRAYHGRFAVQYVDQNGQQRNAYGNFDWQERGDTVTLQLRNPLGQTMAIVTS
FT                   SPSAATLELPNRQPLTADNVSTLMQNALGFSLPVEGLRYWLQPSVAPTSKAKTEKDPQQ
FT                   VSRLKEIEQDGWTIDYIAYADAPATGVKRVNLARTEPPLDIKLVLDQ"
FT   sig_peptide     complement(359305..359409)
FT                   /locus_tag="Bphy_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.842 at
FT                   residue 35"
FT   gene            complement(359409..361250)
FT                   /locus_tag="Bphy_0318"
FT   CDS_pept        complement(359409..361250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0318"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   bxe:Bxe_A4130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69511"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP2"
FT                   /protein_id="ACC69511.1"
FT                   /translation="MNLSIVKQFLKRRARANSVPHAVSARRLLGAAALAAWTLAALPAH
FT                   AQDPSPDTDDNSVSVQDAFGPDSAEEKTNLPNVVLSSQIVFQVLAAEVALQRNQPAPAY
FT                   QTYLSLARDTHDPRMAQRATEIALAAQSPSDALAAAQLWQEYAPQSERAAQLDASLLVL
FT                   SGKPDDAKPMLAKELAKIPPENRGNGILALQLLISRGPNRVGGLHVLQDLLANDMNRPE
FT                   AQFAIARQQLIADDAPGARKSLEQALKLKPDYLPAALMLSQMGPEERKEGIASLEKYVQ
FT                   ANPKSHEARLALAQMYLASDRLDDAQKQFEFMQKDNPNDLTPLMALALIKIQQKNLPEA
FT                   QNYLQQYAQKAEKTPGADAGQAYIYLAQLSLEQKDTAGASRWLDKISATSTQYIPAQIT
FT                   RAQLLQRQGKVDDARKLLAGIRAQDPREQALIARTDAAILFDAKRYQEAETRLAQATGD
FT                   FPDDPDLTYDYAMAAEKNGHYDVMETQLRKLMRTQPDNAQAYNALGYSLADRGQRLQEA
FT                   DKLVEKALSLSPNDAFIMDSVGWVKYRLGDTSDAIRVLRKAYDLQPNAEIGAHLGEVLW
FT                   KSGDQDQARAAWRDARKLEPDNDTLVKTLKRFQVNDL"
FT   sig_peptide     complement(361110..361250)
FT                   /locus_tag="Bphy_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 47"
FT   gene            361338..362168
FT                   /locus_tag="Bphy_0319"
FT   CDS_pept        361338..362168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0319"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: bxe:Bxe_A4129 formamidopyrimidine-DNA
FT                   glycolase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69512"
FT                   /db_xref="GOA:B2JCP3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCP3"
FT                   /protein_id="ACC69512.1"
FT                   /translation="MPELPEVEVTRRGIEPYVAGRRVERVDVRTPALRWPIPPGFARLL
FT                   HGRLVRKVERRGKYLLFEIDEGWFIVHLGMTGTLRVLRNVPHPPAAAKHDHVDWIFDDF
FT                   ILRFRDPRRFGAVLWHPRSAGDVLDHPLLADLGVEPFAPSFSGALLHRKTRGRKVSVKQ
FT                   ALLAGEIVVGVGNIYASESLFRAGIRPTTPAGRISLVRYDLLADAVRVTLAAAIEKGGS
FT                   TLRDFVGSNGESGYFQLDYFVYDRAGQPCRVCGTPIKQIVQGQRSTYYCPTCQR"
FT   gene            362176..363285
FT                   /locus_tag="Bphy_0320"
FT   CDS_pept        362176..363285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0320"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein; KEGG:
FT                   bxe:Bxe_A4128 putative A/G-specific adenine glycosylase
FT                   MutY"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69513"
FT                   /db_xref="GOA:B2JCP4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP4"
FT                   /protein_id="ACC69513.1"
FT                   /translation="MSVSAPVSSAPRSTIPALSDFSVRLIAWQREHGRHDLPWQNTRDP
FT                   YRIWLSEIMLQQTQVSTVIPYYARFLARFPDVAALASAPADDVMTLWAGLGYYTRARNL
FT                   HRCAQVVVEQHGGRFPESVDALAELPGIGRSTAAAIASFAFGARATILDGNVKRVLARV
FT                   FGVEGYPGEKKVENGMWLLAESLLPVNATDDDISAYTQGLMDFGATLCARGKPDCVRCP
FT                   FAVDCVAHVTGRQRELPAARPKKTVPTRRTWMLLLRDGDSVMLEKRPPSGIWGGLWSLP
FT                   EAAGEDALSQLARDLGARAAVSPLAPLTHVFTHFRLEIEPRIAEFDHASKTVSARDADT
FT                   AWMSLNELDAYGVPAPVRKLLEALQGSLI"
FT   gene            complement(363296..363931)
FT                   /locus_tag="Bphy_0321"
FT   CDS_pept        complement(363296..363931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0321"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   bxe:Bxe_A4127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69514"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP5"
FT                   /protein_id="ACC69514.1"
FT                   /translation="MSSTPSVLADVPLFPLHTVLFPDGLLPLKIFEARYLDMARDCLRD
FT                   ETSFGVCLLKSGAEVAQPNEPAVPETIGCLAKIDVCDVDEFGMLLIRARGTERIRLLSH
FT                   RVESSGLLVGMAELIGSDVPLEGTQQMEKFGACAEVLERIIATIRERDPESLPFLEPFR
FT                   LDDPTWVSNRLSEVLPIALKARQKLMELQDAGARIDVVHHYMQQHQLL"
FT   gene            complement(363991..364884)
FT                   /locus_tag="Bphy_0322"
FT   CDS_pept        complement(363991..364884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bxe:Bxe_A4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69515"
FT                   /db_xref="GOA:B2JCP6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCP6"
FT                   /protein_id="ACC69515.1"
FT                   /translation="MRIILITGISGSGKSVALNALEDAGYYCVDNLPPRFLPELATYLA
FT                   GDGKDRLAVAIDARSGASLDDMPQMIRDLSGQHDVRVLFLNASTQALIQRFSETRRRHP
FT                   LSGSPAHDADVGLLTSLAEAIERERELVAGLAEFGHQIDTSNLRANVLRMWVKRFIEQE
FT                   HTGLALMFESFGFKRGVPLDADFVFDVRTLPNPYYDRELRPLTGLDRPVIDFLEALPVV
FT                   QQMMGDIESFLQKWLPGFRDDNRSYLTVAIGCTGGQHRSVFIAETLAARFASEGNVIVR
FT                   HRDAPIDVDDSSKLVA"
FT   gene            complement(364962..365930)
FT                   /locus_tag="Bphy_0323"
FT   CDS_pept        complement(364962..365930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0323"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   bmn:BMA10247_2939 HPr(Ser) kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69516"
FT                   /db_xref="GOA:B2JCP7"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCP7"
FT                   /protein_id="ACC69516.1"
FT                   /translation="MDTSSINAQSIFDDNAAALKLSWLTGHEGWERGFSAETVATATSS
FT                   ADLVGHLNLIHPNRIQVLGEAETNYYQRQSDEDRSRHMAELIALEPPFLVVAGGVAAPP
FT                   ELVLRCTRSSTPLFTTPMSPAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLI"
FT   gene            complement(366165..366680)
FT                   /locus_tag="Bphy_0324"
FT   CDS_pept        complement(366165..366680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0324"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bxe:Bxe_A4124 PTS
FT                   IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69517"
FT                   /db_xref="GOA:B2JCP8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP8"
FT                   /protein_id="ACC69517.1"
FT                   /translation="MERLSNATARRIQATFAPVNMNRLAKYLPLENVVVGLAVTSKKRV
FT                   FEQAGLIFENQNGIARSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLA
FT                   DAIPFESPDGQPVSLLIFLLVPEQATQQHLEILSEIAQLLSDREARERLHTEEDREALH
FT                   RLLTQWQP"
FT   gene            complement(366930..367289)
FT                   /locus_tag="Bphy_0325"
FT   CDS_pept        complement(366930..367289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0325"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   bxe:Bxe_A4123 sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69518"
FT                   /db_xref="GOA:B2JCP9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCP9"
FT                   /protein_id="ACC69518.1"
FT                   /translation="MNLKISGHHLDVTPALREYVITKLDRVLRHFDQVIDGSVVLSVDN
FT                   HKEKEKRQKVEINLHLKGKDIFVESCDGDLYAAIDLMIDKLDRQVIRHKDRLQGHQHEA
FT                   IKYQPLAAQPEVPPQ"
FT   gene            complement(367463..368980)
FT                   /locus_tag="Bphy_0326"
FT   CDS_pept        complement(367463..368980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0326"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor core-binding region;
FT                   sigma-54 DNA-binding domain protein; KEGG: bxe:Bxe_A4122
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69519"
FT                   /db_xref="GOA:B2JCQ0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ0"
FT                   /protein_id="ACC69519.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVSMAIAQNP
FT                   LLEAEDDWIASPLRVAADGTVIAQTAQNAAPEEMSGAPPSSASTSSSESSDNAEPQGVD
FT                   EYNGLGSDANGDSSQWNLDDYGRSGNASDDDDLPPLQIHESTTTLRDHLTAQLRVTQAS
FT                   PRDRALVTFLIESLDDDGYLTATFDEILADLPEELEVDTDELNAALALLHSFDPAGVGA
FT                   RSASECLRLQLCRLDPSPTRTLALDIVAHHLELLAARDFTRLRKYLKASDDDLRDAHAL
FT                   IRSLEPFPGAAYGKAEADYVVPDIMVRRTAQGWQAELNPEVVPKLRINHLYANILRNNR
FT                   GDPGSGSLRQQLQEARWLIKNIQQRFETILRVAQAIVERQKNFFAHGEIAMRPLVLREI
FT                   ADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIG
FT                   AEDTKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(369208..369990)
FT                   /locus_tag="Bphy_0327"
FT   CDS_pept        complement(369208..369990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0327"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A4121 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69520"
FT                   /db_xref="GOA:B2JCQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="PDB:4WBS"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ1"
FT                   /protein_id="ACC69520.1"
FT                   /translation="MSAPALPNRKPAGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGEV
FT                   VGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQEASVF
FT                   RKLSVEENIRAVLELQVGDDGKRLSKDAIASRTEALLDELQISHLRENPALSLSGGERR
FT                   RVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLGI
FT                   CDHAYIISDGSVLAAGAPGDIIENESVRRVYLGEHFRM"
FT   gene            complement(369987..370664)
FT                   /locus_tag="Bphy_0328"
FT   CDS_pept        complement(369987..370664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0328"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG:
FT                   bxe:Bxe_A4120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69521"
FT                   /db_xref="GOA:B2JCQ2"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ2"
FT                   /protein_id="ACC69521.1"
FT                   /translation="MNESFPRFESGRTRALRASRAGLAALLIALPFAGFAPLAHAERAD
FT                   KDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTILIRADRVEVTQDPQGYQYATGTSTG
FT                   KNLAYFRQKRDGVNEYIDGDAERIDYDGKQDLTTLTTRATVRRLQGTNTIMDEVHGSVI
FT                   TYDGQNDFYTAKAGKDVASPGNPNGRVRAMLSPRNGGSQPLSGPSATLQPANQFPAQGT
FT                   TKP"
FT   sig_peptide     complement(370539..370664)
FT                   /locus_tag="Bphy_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 42"
FT   gene            complement(370697..371290)
FT                   /locus_tag="Bphy_0329"
FT   CDS_pept        complement(370697..371290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0329"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   bxe:Bxe_A4119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69522"
FT                   /db_xref="GOA:B2JCQ3"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ3"
FT                   /protein_id="ACC69522.1"
FT                   /translation="MNQFRWTSLVPLITMAALAGVTYWLLQATRPHQDEGLIKPKQHTP
FT                   DYFADNFSVSELDQSGSTQYRLTAANLVHYEDDEVSDLIRPAMRAFQPAKPVVTATGDT
FT                   GKVNGDVSIVDLYGNARIVREAGGGDPRMQADSSHFRVLVNDDVIETEKPVKLQRGQSI
FT                   MTASGMNYNNVTRVIQLFGNVRGAIAPADSGGSQ"
FT   sig_peptide     complement(371231..371290)
FT                   /locus_tag="Bphy_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.913 at
FT                   residue 20"
FT   gene            complement(371287..371850)
FT                   /locus_tag="Bphy_0330"
FT   CDS_pept        complement(371287..371850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0330"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; KEGG: bxe:Bxe_A4118 phosphatase YrbI"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69523"
FT                   /db_xref="GOA:B2JCQ4"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ4"
FT                   /protein_id="ACC69523.1"
FT                   /translation="MALAALTAAERASRVKLMIFDVDGVLTDGGLLFTAQGDTMKAFNS
FT                   MDGHGAKLLREAGIDTAIITGRQSEIVAKRAENLRITHVYQGVEHKLAAFEQLLKQTGR
FT                   TPEQCGYMGDDWVDLAVMLKVGFAAAPANSHPEVIARAHWVSEARGGHGAVREVCDALL
FT                   RAQGRYDELLAAACSGAMPRGLVG"
FT   gene            complement(371850..372890)
FT                   /locus_tag="Bphy_0331"
FT   CDS_pept        complement(371850..372890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0331"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: bxe:Bxe_A4117 KpsF/GutQ; TIGRFAM: KpsF/GutQ
FT                   family protein; PFAM: CBS domain containing protein; sugar
FT                   isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69524"
FT                   /db_xref="GOA:B2JCQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ5"
FT                   /protein_id="ACC69524.1"
FT                   /translation="MSGKVVPGAANMRLCYTPRMIAKINGDRALALARDVLDIEADAVR
FT                   SLRDHLDDAFVEAIDFILGCRGRVVVSGIGKSGHIARKLAATLASTGTPAFFVHPAEAS
FT                   HGDLGMVTADDVFIGMSNSGESEELVAILPLVKRLGAKMIAMTGRPGSSLAKIADVHLY
FT                   CGVEKEACPHNLAPTASTTAALALGDALAVAVLEARGFGADDFARSHPGGALGRRLLTY
FT                   VRDVMRTGDQIPKVLSDATVRDALFQLTAKRMGMTAIVDENERVKGIFTDGDLRRVLER
FT                   DGDFRALTIDSVMTHGPRTIGSDRLAVEAVELMERHRINQMLVVDEAGKLIGALNMHDL
FT                   FSKKVI"
FT   gene            372982..374985
FT                   /locus_tag="Bphy_0332"
FT   CDS_pept        372982..374985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0332"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: bxe:Bxe_A4116 putative
FT                   glutathione-regulated potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69525"
FT                   /db_xref="GOA:B2JCQ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ6"
FT                   /protein_id="ACC69525.1"
FT                   /translation="MISPLEMTLFLLLASVVGVVVFRYLNLPPMLGYLSVGIVVGPHAF
FT                   GIVPDSVGAQNLAEFGVVFLMFSIGLEFSLAKLRSMRRLVFGLGLLQVLGTIAIAVSLG
FT                   FVFERWVHISWQASVALGGALAMSSTAIVSKMLAERLEIETEHGRNIFGVLLFQDLAVV
FT                   PLLIVIAALGGSSDDLVRSLGIASIKIVIALALLLIVGQKFMTRWFNVVARRRSQELFV
FT                   LNLLLVTLGAAFITDKFGLSLALGAFIAGMLIAETPYRHQVEEDIKPFRDVLLGLFFVT
FT                   TGMLLNPRVIWEHPLIVLAFLIGPVLLKAVMITGLARLFGATPGVAMRTGIGLAQAGEF
FT                   GFVLLNLILDKHLVDATLLQAILAAMLLSMLAAPFMIQNADRIVLRLSSTEWMMQSLQM
FT                   TRIATQSLKQSGHVIICGYGRAGQNLARMLEHEGLSYVALDLDPDRVAAAAAAGESVVF
FT                   GDAGRRESLLAAGIHRAATVAITYANTPSALRVLHNIHELEPTLPVIVRTVDDSDLEKL
FT                   LAAGATEVIPEIVEGSLMLASHTLVVMGVPMRRVVRRVEELRDERYSLLRGYFHGADDV
FT                   DDDDGHEQVRLQSVPVDEKADAVGRTLEELGLFDLGVEVTAIRRHGIRGVEPDPSTKLR
FT                   ASDIVVLRGLPEALAEAEERLSKHRRAGAAAA"
FT   gene            375110..375676
FT                   /locus_tag="Bphy_0333"
FT   CDS_pept        375110..375676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0333"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: bxe:Bxe_A4115 adenine phosphoribosyl
FT                   transferase; TIGRFAM: adenine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69526"
FT                   /db_xref="GOA:B2JCQ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCQ7"
FT                   /protein_id="ACC69526.1"
FT                   /translation="MSHAPANRPFDPAEYINSEIRTVPDWPQAGVQFRDITPLLQKPKS
FT                   LRVLIDLFVQRYIDQKLDYVAGLDARGFIIGPILAYELNLGFIPIRKIGKLPFRTVSES
FT                   YELEYGSATVEIHEDACKPGDRVVIVDDLIATGGTMMAGKKLLERLGATVIEGAAIVDL
FT                   PDLGGSKLLRGAGLPLFTVTSFGGH"
FT   gene            375702..376316
FT                   /locus_tag="Bphy_0334"
FT   CDS_pept        375702..376316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0334"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_A6113 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69527"
FT                   /db_xref="GOA:B2JCQ8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ8"
FT                   /protein_id="ACC69527.1"
FT                   /translation="MPNFLLFLATSIAITFAPGPDNLQVLARGISQGRAAGFVAALGFA
FT                   AGISFHTTLAALGIAAVLRSSPIAFEVLKLAGAAYLIWIGIKALRSKGLATAHERAPQP
FT                   LSSIFRQSVIGNMLNPKVTLFFVVFLPQFVDPHGAQSVTLQMLELGALFMLQTVIVFSL
FT                   FGVCAGMIGGWLKRRPRAGVWLDRLAGATFIAIGIRVALRD"
FT   sig_peptide     375702..375773
FT                   /locus_tag="Bphy_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.745) with cleavage site probability 0.687 at
FT                   residue 24"
FT   gene            376371..377219
FT                   /locus_tag="Bphy_0335"
FT   CDS_pept        376371..377219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0335"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A4113 putative
FT                   NTP pyrophosphohydrolases including oxidative damage repair
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69528"
FT                   /db_xref="GOA:B2JCQ9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR031804"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCQ9"
FT                   /protein_id="ACC69528.1"
FT                   /translation="MSLPCIVAARRFDRALHLPFVIGDERVGWIRANGVPLLARWPDVF
FT                   DIDAQRVVLAPQFDTVDLRSAALGSVIGALAAEGRIPGWRDETYAIRNAFDAPPLAYIE
FT                   RAASRFFGTMTYAVHLNGVVEYVGRAPQLWIARRSETKATDPGMLDNVVAGGIGWGFSL
FT                   AGTIVKECWEEAGIPEEIAARAVAGRTAHVLQSLPEGTQAEQIFIYDLALPEDFAPRNQ
FT                   DGEVGEHRLARIEDVAQAIEEGAMTVDASLATLDCLLRRRWIDEDACAGIDALFEPPVL
FT                   D"
FT   gene            377293..378156
FT                   /locus_tag="Bphy_0336"
FT   CDS_pept        377293..378156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0336"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: bxe:Bxe_A4112 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69529"
FT                   /db_xref="GOA:B2JCR0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR0"
FT                   /protein_id="ACC69529.1"
FT                   /translation="MSTEHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSHT
FT                   GEFFMRVHFQQVGGDPGLDALREAFATLAEQFGMRWELHDANVKPRVVIMVSKIGHCLN
FT                   DLLFRYRTGQLNIEIPAIISNHKEFYQLAASYDIPFHHFPLTSSDTKAHQEARVLEVID
FT                   ECKADLVVLARYMQILSPQLCARLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGAT
FT                   AHYVTTDLDEGPIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGS
FT                   KTVVFR"
FT   gene            complement(378233..379471)
FT                   /locus_tag="Bphy_0337"
FT   CDS_pept        complement(378233..379471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0337"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: bxe:Bxe_A4111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69530"
FT                   /db_xref="GOA:B2JCR1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR1"
FT                   /protein_id="ACC69530.1"
FT                   /translation="MRPLLVRLHRWFGIGTALCLFVAGLTGAAIAWDHELDAMLNPTFF
FT                   YARSDAQPLPSLELARRVEAKDPRLQVTYLPLAVEPGHALQMMVLPRVDPKTKQPYPLD
FT                   FNQIAVDPATGAIQSRREWGALSIARLNVMPFIYRLHYTLFLPFTRGIDIGTWLMGIVG
FT                   IVWSFDSVIALVLAFSSLKAWKKSFAFRVRRGAYALTFDLHRSGGVWIWGLLLMMAVTS
FT                   VSMNLSEPVVQPIIKRFSTVTPTPFTDPSMLPGAKPDEAPIAREQVMTLAERARADKHI
FT                   EAPAGAIYYAPMLHVYGVGYFTAGGDHGDGGLGNAWTYWNAQNGQPLGAQIPGKGTAGD
FT                   LFMQAQFPLHSGRILGIGGRIAISCVGLMVAVLSATGLLIWLKKMNARRRTSSARKTAA
FT                   RVVQAQTESAASR"
FT   sig_peptide     complement(379376..379471)
FT                   /locus_tag="Bphy_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.637 at
FT                   residue 32"
FT   gene            complement(379722..380807)
FT                   /locus_tag="Bphy_0338"
FT   CDS_pept        complement(379722..380807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69531"
FT                   /db_xref="GOA:B2JCR2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR2"
FT                   /protein_id="ACC69531.1"
FT                   /translation="MAKRNQARDDGQVQDLRPRPVRLTSDMSLPKLSPVEVGSYVVALL
FT                   AMWAVLELKLLGALLAGMLVFQLVHTLAPRIEKHMSSGRARWLAVVILSVVIVGTLTGF
FT                   TVAVIEHFEKDVPSVQKLLDQAMSLIDQARGRLPEFIAQNLPVSTEQMKEKAAVLMQTH
FT                   ASTLSQGGKNAARIFTHVLIGMIIGAIIAVGAQRHLQRLPLSTAFIARVSRFADAFRRI
FT                   VFAQVKISAINTVFTGIFLLLLLPIFHAPLPMAKTLVMITFIVGLLPVIGNLISNTLIV
FT                   AVALSVSFPAAVTALIFLILIHKLEYFLNARIVGGQIEARAWELLIAMLVMEAAFGIPG
FT                   VIAAPIFYAYIKRELIYLRLV"
FT   gene            complement(380830..383928)
FT                   /locus_tag="Bphy_0339"
FT   CDS_pept        complement(380830..383928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0339"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: bxe:Bxe_A4108 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69532"
FT                   /db_xref="GOA:B2JCR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR3"
FT                   /protein_id="ACC69532.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARVGTPYCPDHEIPLEAQSVSQMVDAALALPDDTKLMILAPVVANRKGEHT
FT                   ELFEDMQAQGFVRFRVRSGGGTANEGVAKIYEVDSLPQLKKNDKHTIDVVVDRLKVRAD
FT                   AKQRLAESFETALRLADGRAIALEMDTDKEHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYEFDI
FT                   DTAFEDLPEKVRNILLYGSGKQTVPFSYINERGRTSVREHGFEGIIPNLERRYRETDSV
FT                   AVREELAKYQNNQACPSCEGTRLRREARFVRIGADKDARGIYEVSGWPLRDTLGYFQTL
FT                   RLEGAKREIADKVIKEIVARLMFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLISTLKHLRDLGNSVIVVEHDEDMIRMADYVVDMGPGA
FT                   GEHGGMVIAEGTPVEVQADPASMTGQYLAGARRIEFPDDRKQADERHLRIIEAYGNNLK
FT                   RVTLDLPVGLLTCVTGVSGSGKSTLINDTLYHAVAQHLYGSSTEPSPFEAIEGLEHFDK
FT                   VINVDQSPIGRTPRSNPATYTGVFTPIRELFAGVPAAKERGYDPGRFSFNVKGGRCEAC
FT                   QGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDILYKGQNISEVLEMTVEHAYDFFKA
FT                   VPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPTT
FT                   GLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIIAQGT
FT                   PEQVSKSKASFTGRYLAPLLQRDRAAVRASHEDEPDEEEAEATIGDAETAESANPAVKA
FT                   VRPKKAVAADAPKPASKSTAKSTAGTAKAAAKPAKAGKPSVKT"
FT   gene            384242..385399
FT                   /locus_tag="Bphy_0340"
FT   CDS_pept        384242..385399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0340"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4107 major facilitator superfamily (MFS) multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69533"
FT                   /db_xref="GOA:B2JCR4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR4"
FT                   /protein_id="ACC69533.1"
FT                   /translation="MSAPELRATVSLAAIFALRMLGLFMIMPVFSIYAKTIPGGDNVLL
FT                   VGIALGAYGVTQSLLYIFYGWISDKVGRKPVIATGLLIFALGSFVAAFAHDMTWIIVGR
FT                   VIQGMGAVSSAVIAFIADLTAEEHRTKAMAMVGGSIGVSFAVAIVGAPIVFHWLGMSGL
FT                   FALVGIFSILAIGVVLWVVPDAPKPVHVPAPFHEVLHNAELLRLNFGVLVLHATQTALF
FT                   LVVPRILEAGGLPVSSHWKIYLPVMGLAFVMMVPAIIAAEKRGKMKAVLLSAIGLILIG
FT                   QLLLAVAPHTIVTVAAILFVYFLGFNILEASQPSLVSKLAPGTRKGAAAGVYNTTQSIG
FT                   LAMGGVIGGWLLKVDGQSAVFFACSGLVGCWLIIAASMKQPPRKA"
FT   sig_peptide     384242..384346
FT                   /locus_tag="Bphy_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.881 at
FT                   residue 35"
FT   gene            385525..386043
FT                   /locus_tag="Bphy_0341"
FT   CDS_pept        385525..386043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0341"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: bxe:Bxe_A4106 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69534"
FT                   /db_xref="GOA:B2JCR5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR5"
FT                   /protein_id="ACC69534.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKQSG
FT                   EFKEMTEWHRISFFGRLAEIVSEYLKKGSSVYIEGRIRTRKYQAQDGTDRYSTEIVADQ
FT                   MQMLGGRSGGGGGGDDGGYSRGEPMERGGGRMSGGGGGRVAGGGGGGQSRPSAPAGGGF
FT                   DEMDDDIPF"
FT   gene            complement(386164..386907)
FT                   /locus_tag="Bphy_0342"
FT   CDS_pept        complement(386164..386907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0342"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bxe:Bxe_A3012 putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69535"
FT                   /db_xref="GOA:B2JCR6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR6"
FT                   /protein_id="ACC69535.1"
FT                   /translation="MNNVRNAQVAIVTGASRGIGAAISRRLASDGFAVVVNYAASSKEA
FT                   DALVAELKAQGAAAIAVKADVSNPDDVRRMFDATEQQLGRIDVLVNNAGILKTVPLADT
FT                   SDALFAQAFDINVRGTFNTLREAAARMNNGGRIVNFSSTTLALNMPGYAVYNATKAAVE
FT                   SFTHVFAKELRGRSITVNAVAPGPVATSLFLDGKTDEQIQSFAKMPPLQRLGQPEDIAS
FT                   VVAFLAGPDGAWMNGQILRANGGLA"
FT   gene            387038..387943
FT                   /locus_tag="Bphy_0343"
FT   CDS_pept        387038..387943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II1156 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69536"
FT                   /db_xref="GOA:B2JCR7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR7"
FT                   /protein_id="ACC69536.1"
FT                   /translation="MDRFQEMQVFVRIAERQSFTRAADDLHIPRATVTNLMKRMEARLG
FT                   ARLLERTTRTVRLTHDGEAYYGRCVRLLADMEEAEGSFRDAAPKGLLRVNLQGTLARHF
FT                   VVPALPAFLSRYPGIELHIGEDDRLVDLVREGVDCVLRAGNLQDSSMVGRRVARLEQVT
FT                   VASPAYLERHGMPCSPDALAMHCAVNYVSSATGHALPLEFTVDERVVEVKLEAIVSVTG
FT                   TDLYSGSAVAGLGLVQVPRYRVQNEIAAGSLVVVLPQFPPPPMPVTVLYPQSRQLSSRV
FT                   RVFAQWLREIFEAAGGLEVG"
FT   gene            complement(387950..388753)
FT                   /locus_tag="Bphy_0344"
FT   CDS_pept        complement(387950..388753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69537"
FT                   /db_xref="GOA:B2JCR8"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR8"
FT                   /protein_id="ACC69537.1"
FT                   /translation="MQETTSALVVFVLLLAATAVGFFGKPYLPEEHRKHETMQLIQLVI
FT                   TMLVTFAALVLGLLTASAKSSFDTVGNGFRSYAAELIQLDTALRQYGPDADHARELLRT
FT                   YTAAAIAATWPREQPPAGHYPRISTDLSHDKLEDVQLGDMLNAAYVAVRKLKPSDSYQQ
FT                   TTLTECISRFERVIEARWTLIEQAHSSISKPFLTTLTFWLMVIFLCFGLVAPRNALALV
FT                   MIMLGAVSIASAVYVIVDLDTPLTGPIVASSDPMRDALTHLERIR"
FT   sig_peptide     complement(388694..388753)
FT                   /locus_tag="Bphy_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.554 at
FT                   residue 20"
FT   gene            389091..390734
FT                   /locus_tag="Bphy_0345"
FT   CDS_pept        389091..390734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0345"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bxe:Bxe_A4080
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69538"
FT                   /db_xref="GOA:B2JCR9"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCR9"
FT                   /protein_id="ACC69538.1"
FT                   /translation="MLKGLSIRAYLTLMIVLFGIVLLIGAAAGLLSLRASNASLQQMYT
FT                   VDTPAVADLEGSAGQLLRLRLALATYASLDELNDREGADAVLKRFDTYLKVSNERLAHF
FT                   ISKASNDPDEQRLIKDMQDKRDSFLREGVEPALAALKSGDKTAFQQLQGHKLSPLYSAY
FT                   EKAMLTLEKLQLDHAEQRYQDAQQLFYTISVGVAIGMAATLMFAWIGRLIMVRAIVHPV
FT                   DATIEQFQRIANGDLTGRIDIHGDNEMGRLAAALRKMQESLIATVSTVRHGTDSIDTGV
FT                   SEIAAGNTNLSQRTEEQAASLEETAASIEELTSTVKQTADNAKQASTLAHGASTLAAQG
FT                   GDLTQQVVGTMQAIVDDSRRIADIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ASEVRSLAQRSAAAAKEIKGLIGESNERVTAGADLVQRSGSTMTEIVDAIARVSAIMGE
FT                   IAEAATEQSTGIDQVNLAVAQMDEVTQQNAALVEQAAAAASSLEEQARRLTEAVSVFKT
FT                   DSGQGASSRMMALRARRQQSAMPLEAAEAV"
FT   sig_peptide     389091..389207
FT                   /locus_tag="Bphy_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.507 at
FT                   residue 39"
FT   gene            complement(390851..391660)
FT                   /locus_tag="Bphy_0346"
FT   CDS_pept        complement(390851..391660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0346"
FT                   /product="putative cytochrome c, class I"
FT                   /note="KEGG: bxe:Bxe_A4079 putative cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69539"
FT                   /db_xref="GOA:B2JCS0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS0"
FT                   /protein_id="ACC69539.1"
FT                   /translation="MSEERVFSFSNRWFTSSVGGVIAIAVVSILIGFVWLPSKHPDFTQ
FT                   RGLWATICSAAGAPSSWYTQSANIAGPAPSNVLVLPPAPPWGRTRPSADSIGRGATLAQ
FT                   NCSMCHGVQSLIQVTAPVLAGQYADVIYKQLRDYQSGQRVNSIMPPIIARLNDADLHDL
FT                   ANYYSTLPRPAAVEQRTAEDDSIRKLVSEGSPMRNIAPCAACHGDRDRKGAAPWLGGQS
FT                   SAYMAAQLRAFADGNRRNDINEQMRNVARHMTPEEIDGVAKYYATRP"
FT   gene            complement(391657..393282)
FT                   /locus_tag="Bphy_0347"
FT   CDS_pept        complement(391657..393282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0347"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   bxe:Bxe_A4078 putative cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69540"
FT                   /db_xref="GOA:B2JCS1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS1"
FT                   /protein_id="ACC69540.1"
FT                   /translation="MFHAKRLVLAHFWLAFIAFGVALLLGAWQMLVRSPLLPWIGEPEL
FT                   YYRSVTAHGTVMAYVLPTLVAMAFGYAIVELALQQALVGLKWAWAAFILLVVGAVMAMV
FT                   PVAAGQASVLFTFYPPMIGSPFYYLGVVLVVVGSWIWVALMSINLHVWKRANPGKPVPL
FT                   AMYANVAGAYLWAWTAVGAALEILLQILPVALGLKSTIDAGLARVLFSWTLHAIVYFWL
FT                   VPSYIAYYTLVPRAIGGRLYSDSMARVSFILFLVFAMPIGIHHLFADPQVGSGFKFVHA
FT                   VFTGMVSVPTLLTVFTICASVEIAGRLRGGTGAFGWLKALPWDNPMMLVIAFSFIMLGL
FT                   GGAGGLINMSYQLNETVHNTQWVTGHFHLIFGGAIVIMYFAIAYELWPQLTARAICSVR
FT                   LVRWQLWLWFIGMMVVTLPWHYVGLLGAPRRMAYYDYSNPAIAPQAIWVAVSAIGGVVL
FT                   VISGLLFIYILAKSQFGTVEQPKQFRFSAPAHPVERVPAALNSFGLWVALMIGLTVVNY
FT                   SVPIAQLLGLQQTSVPAVSVGARP"
FT   sig_peptide     complement(393202..393282)
FT                   /locus_tag="Bphy_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.687) with cleavage site probability 0.382 at
FT                   residue 27"
FT   gene            complement(393269..393841)
FT                   /locus_tag="Bphy_0348"
FT   CDS_pept        complement(393269..393841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0348"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   bxe:Bxe_A4077 putative cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69541"
FT                   /db_xref="GOA:B2JCS2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS2"
FT                   /protein_id="ACC69541.1"
FT                   /translation="MSTQPSHSPDNGHAVAERSEKRWAYFVIAIIVFMLVVVVYSGLHW
FT                   AMMPPSRVETVDPSRLQMSGEFVESNLGSAVEPDGSVVVRFIAQQYSFTPQCLLVPADT
FT                   DITFRTTSADVVHGLLVTDTNINTMVIPGYVATFSSSFPQPADHLMPCHEFCGFGHQTM
FT                   WAHVKVIDKAAFFEQAKQTRRLSCVSR"
FT   gene            complement(393844..394026)
FT                   /locus_tag="Bphy_0349"
FT   CDS_pept        complement(393844..394026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69542"
FT                   /db_xref="GOA:B2JCS3"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS3"
FT                   /protein_id="ACC69542.1"
FT                   /translation="MDPSKHSGDHDGHASDAEVERIVAQGPHGAIAVAGVAAVVVLAIW
FT                   IGFYFLVFLPRGVIH"
FT   gene            complement(394068..395453)
FT                   /locus_tag="Bphy_0350"
FT   CDS_pept        complement(394068..395453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0350"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_A4075
FT                   putative cytochrome c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69543"
FT                   /db_xref="GOA:B2JCS4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS4"
FT                   /protein_id="ACC69543.1"
FT                   /translation="MKTLFFGAVPPGLIWTNSVSMNAVTRMQRAARVTRRVTFSLAAGA
FT                   AFAVAAITPHSPFIATANAAEAATPAGTDNRPAQVVRGEYLARAGDCVACHTAPRGKTF
FT                   GGGLAMETPFGTLYTPNISPDSEYGIGKWSADDFFKMMRTGKSPDGKLIYPAMPIAQYT
FT                   KVTREDSDAIFAYLKSVEAVHQPNRKHDLRFPFNQRELLIGWRSLYFREGEYQPNPSRS
FT                   VEWNRGAYLVEGLGHCTMCHTKINLLGGSSKSEQFAGGLIPVQNWYAPSLTSDKDGGLG
FT                   DWSIKDIVDLLQAGISDRGAVYGPMAEVTYHSLQYMTDDDVKAMAVYLKTLPDNDPGRK
FT                   TGPSATVKPAVFEAGQRIYMDKCSMCHGEHGEGKLQHYPPLARNQSIEMDSAVNPIRIV
FT                   LNGGFPPGTRRNPEPYGMPPFAQELNDADAAAVVTYIRTAWGNHGQPVTAKQINELRKA
FT                   PQR"
FT   sig_peptide     complement(395259..395453)
FT                   /locus_tag="Bphy_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.869 at
FT                   residue 65"
FT   gene            complement(395450..396172)
FT                   /locus_tag="Bphy_0351"
FT   CDS_pept        complement(395450..396172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0351"
FT                   /product="putative periplasmic cytochrome c protein"
FT                   /note="KEGG: bxe:Bxe_A4074 putative periplasmic cytochrome
FT                   c protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69544"
FT                   /db_xref="GOA:B2JCS5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS5"
FT                   /protein_id="ACC69544.1"
FT                   /translation="MHRRTIGSSILLLLCALCAVWAKTSFAASNDASAPSAMDEKMHAC
FT                   TTCHGVQGQGRNNDYFPRIAGKPAEYLFNQLQAFRDGGRTYPPMGYLLAFLPDEYLRKI
FT                   SQYFADMQPPYPNADTNPLPQATLDYGKQLVVQGDTKRGIPACVACHGERLTGQQPGVP
FT                   GLLGLHASYIAGQMGTWRSGTRHALAPDCMHSIAVKLNDKDITAVSSWLARQPRPADPR
FT                   PVPRLPGKLPLACGSQPE"
FT   sig_peptide     complement(396089..396172)
FT                   /locus_tag="Bphy_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 28"
FT   gene            complement(396568..397461)
FT                   /locus_tag="Bphy_0352"
FT   CDS_pept        complement(396568..397461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A4073 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69545"
FT                   /db_xref="GOA:B2JCS6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS6"
FT                   /protein_id="ACC69545.1"
FT                   /translation="MNPRVFDLAQLRTFVAVAEAGSVSAGAERVFLSQSSASEQLKKLE
FT                   ERAGQPLFLRGKLGVTATPAGAKLLDHARRILAMSEAAFEDLQGRALDGELRIAITDYY
FT                   RPHDVARVLKTFSEQHPRLRLHVTVLPSAVIDSGIEDDGTFDIGLSLRIVAPAAKRAAS
FT                   GRPQSASTVVRREKLVWAMSANADPRHIVTPFHLVLLPATCQLQRFVVRLLDESKVPYL
FT                   ISHSASGMAGLQLALKAGLGISCLNESSIGSGMVPCPPAVDLPPLPAVEFHLLPARPGE
FT                   SDLVSNARETFMRLLA"
FT   gene            397559..398812
FT                   /locus_tag="Bphy_0353"
FT   CDS_pept        397559..398812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0353"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4072 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69546"
FT                   /db_xref="GOA:B2JCS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS7"
FT                   /protein_id="ACC69546.1"
FT                   /translation="MGQELQAFETSGRRGVNHRWKVLGVGFAANASFAAAFSGIPTTAI
FT                   FLRNGYHIDNRGLGLVLGMLGLGIAASELPWGLLTDRWGDRRVLLLGLLATAAALAAMA
FT                   GFVVPRGGAAPGIVPLALGLLAVGLLGGSVNGSSGRAVMAWFREAERGLAMSIRQTAVP
FT                   AGGGLGALTLPSLAAHFGFVAVYGTLAALCTMTAWFAWRWLHEPPESAARGVPAVVAGQ
FT                   GAQAGGGKPGVSAGLVPPLRDIGVWRVALGIGVGGVSATMAAVQAGAAVARVWSGHWTD
FT                   RRGNRRQYMRACSVLTALLFAALALVAAGAGGAQGLITAVLAAMVVLGGVSASAWHGVA
FT                   YTELATLAGTRRAGTALAMGNTCAFMTLFVTPLAIPPLLTATSWPVVWAVASLCALLAL
FT                   PIFPRPLRAPRYVPRIRV"
FT   gene            399472..400125
FT                   /locus_tag="Bphy_0354"
FT   CDS_pept        399472..400125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0354"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bxe:Bxe_A4071 two
FT                   component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69547"
FT                   /db_xref="GOA:B2JCS8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS8"
FT                   /protein_id="ACC69547.1"
FT                   /translation="MLADDHPFVLLGIRATLIAHGGFTIVGEATSPSSLVQLMEKASCD
FT                   VLVTDLTMPDASGDADDGLRLIRRIRSGWPEVHIVVLTSLTNAAILRSIMSDGVIGMLN
FT                   KSESMDELAAAIRAAGAGRSYVSRSILQTLAEASGEPLGMSPMRHLSPRQSEVIRMFVR
FT                   GKSISEIARDLGRDVRTVSRQKRDAMAKLGVSNDPGLFAFVRAYGLASEFILDR"
FT   gene            400234..400944
FT                   /locus_tag="Bphy_0355"
FT   CDS_pept        400234..400944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0355"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bxe:Bxe_A4070 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69548"
FT                   /db_xref="GOA:B2JCS9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCS9"
FT                   /protein_id="ACC69548.1"
FT                   /translation="MNIRKDGTLPIRTIIADDHPLVLLAMENLMSGFPNIEIVGKATDS
FT                   SELFAEAQRVKCELVVMDLYMPGGLHGDGVEMVRQFKERHPDVVVVVLTMETSADALQK
FT                   VIALGVGAVVSKRDRIDLIHVAIITALARECYVGPAIRALLADATLSRRIDYVRQVLSR
FT                   RELEVLTHYATGRGVTEIAMRLGRSVKTISAQKCTAMRKLSLQSDADLFRFAVEHGLVT
FT                   DEQSTAAGRTGGRG"
FT   gene            400999..401670
FT                   /locus_tag="Bphy_0356"
FT   CDS_pept        400999..401670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0356"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bxe:Bxe_A4069 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69549"
FT                   /db_xref="GOA:B2JCT0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT0"
FT                   /protein_id="ACC69549.1"
FT                   /translation="MTVQEQEQNKMEDKIRVIVADDHACVRAGVRSLLGQIGHVAVAGE
FT                   ADSTQALAELLDSCACDVVVTDLGMPGIDGESNAIQFLRRLLDQAPHLPVVVLTMIHQP
FT                   SILMGLLQHGVAAIVDKRDMTASLIHAIDAGLTGQGYLSDHACAAIAKAEAPQPRAGVM
FT                   SAGEWKVFTMYVSGMTISQIAVRLNRSAKTISTQKRNAMRKLGLETEADVIDYACQIGL
FT                   T"
FT   gene            401854..402597
FT                   /locus_tag="Bphy_0357"
FT   CDS_pept        401854..402597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0357"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: bxe:Bxe_A4068
FT                   aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69550"
FT                   /db_xref="GOA:B2JCT1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT1"
FT                   /protein_id="ACC69550.1"
FT                   /translation="MSGLGKRLIVEGAGTAWLVFIGCGTAALNTGAQGNSIIAVPLAFG
FT                   FALATATYVLGRFSGAHFNPAVTVAFVTAQRFSVRDLAPYIAAQVLGAVAGAALLVYIA
FT                   SGRPGFELASSQFGATGFGDHSPADYSLHSALAVEVTLSFAFVLARMLMSSGRSANLIG
FT                   PLVTGLWLMLSYVVAAPVTNASLNPARSTGPALLVGDWALDQLWLFWAAPLTGGVLAGL
FT                   LHSRVFGQPRDMFAGRREGRRGESA"
FT   gene            402606..407063
FT                   /locus_tag="Bphy_0358"
FT   CDS_pept        402606..407063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0358"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: bxe:Bxe_A4067 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: extracellular solute-binding protein family
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69551"
FT                   /db_xref="GOA:B2JCT2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT2"
FT                   /protein_id="ACC69551.1"
FT                   /translation="MHCLRVRMPFRAHSLCHTSRVLVREALIAGFLLVFVLLGAQSALA
FT                   ALGPRPHGFAPRLSVGVLASGWSPFETFQDGRYTGLSVDYLRAIVGPDVEITTRTYPDM
FT                   EQLLAAACANRVDLVMSIARTPERERCLSFSAPYFRGSTSAVTLASKAISLSRQSQVQD
FT                   ARVAVERGFALGAVLRERFPHAHFDAFADTLSAMRAIRQGRDDVYFGFTPAVRHYLADP
FT                   EFGGLVVAFEETGQVSEMRFAVPVAKSELRDKLERGLAALQPEDEAAIRARWLGGSFEA
FT                   WPASATSNLVLSREEQAWLRTLPPLSVGFDSDWAPFSALDELGRPSGIAADYLDYLGRT
FT                   LGLTFHREPAKDWTATLAAFNRGDVALLATANRNDPRLDRATFTHAYETYPLVIVAREG
FT                   EPAARSLNDFAARRVMVSVHSKGAVPFQAYGVAATHVTVAPGLDAALKLLAAGGADALV
FT                   GNVAEVDAALTGQYAGVLKIVGTVREADPVGFAVRADLAPLAGLIDRALLAMPASEHQR
FT                   IHQKWVTGEGRRRGGWSVTALRLLPVLIGIAVILLLTLRAYVLLQREVARRERTERELE
FT                   SQLNFQQTMMEMVPYPLVAKDLQGRYIAVNRAYEEATGLRRERVIGRTSADVHAWGEEN
FT                   SLRLEQLSRSALQSGSATQIELAFEDCDGDSRHGLFCVCVCDDADGAPLCLLGTLVDIT
FT                   DIRRAEMLASETQRRLVDVTSSLPAVVFQLRRGLDGAYSFLYVGGDTEHLLGYDSAALM
FT                   RSAALDFGTIFADDRPGVVAALGRSAELSEPLHLEFRINCPAEQRWVRAELAPRREPSG
FT                   ATVWSGYWVDASIERLRADELAHARDLAEAASRAKDDFLAMMSHEIRTPMNGVLGLVEV
FT                   LERTRLDADQGEMLGMIHESAGALLQILDDLLDYSKIEAGRLTIESEPIDLRDLVDTAV
FT                   GLLAGRAHEKGLKVRVDVDPQVAATLRGDSVRLRQILFNLLGNAIKFTPQGEVDVQVQV
FT                   AEQNASGQTVEITVDDTGIGIAPDVQARLFEPFVQAESSTTRRFGGTGLGLTICRKLVA
FT                   LMGGTLSLYSTPGEGTRMTLRLLMPVDTQHYSAGGLRGKRGIVLTSDAPVATALVHFGA
FT                   ALGLELRCAHAAGWPDPKSLEGMDLIFVGDGVDLPAEVAQSRAKLISLTEKPKPTGYRI
FT                   VDNAVRVSINPISWRGLSAACAAALTGLSPTPARQSGAADAVTTPPDRERAVACGRLVL
FT                   VAEDHPVNQELIRHQLALLGFACDVVNDGAEALEALDATPYGFLITDCHMPRMSGYELA
FT                   QSVREKERLTGGRLPILGITANTAPEDLNACREAGMDDCLVKPTRLATLREYLSRWFGA
FT                   DNARPAAETETTTSFVARDTEPDDADNIAFVPVDLNQLTQIWGSESTVKSLLDAFVSAV
FT                   RDDLRALPPLLNEPDVAALREWLHRVSGAVGVLRYPPLLGALEHYRRQLTNPPSETLRS
FT                   EGIALVRQCNTMLDGIEEQAALLP"
FT   sig_peptide     402606..402743
FT                   /locus_tag="Bphy_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.994 at
FT                   residue 46"
FT   gene            407255..407689
FT                   /locus_tag="Bphy_0359"
FT   CDS_pept        407255..407689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0359"
FT                   /product="CHRD domain containing protein"
FT                   /note="PFAM: CHRD domain containing protein; KEGG:
FT                   bxe:Bxe_A4065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69552"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT3"
FT                   /protein_id="ACC69552.1"
FT                   /translation="MIAIRKLSMVAVICALASGVALADTVELKADLEPSSEVPPRVSHG
FT                   HGALEATFDTSTRTLKWTTTYDGLSGPVTMAHFHGPAPVGQNAKVQVPIEKNALASPMK
FT                   GSATLTEQQVTDLMAGQWYFNIHTAQNPSGEIRGQVLPAN"
FT   sig_peptide     407255..407326
FT                   /locus_tag="Bphy_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            407857..408807
FT                   /locus_tag="Bphy_0360"
FT   CDS_pept        407857..408807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0360"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bte:BTH_I0539 esterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69553"
FT                   /db_xref="GOA:B2JCT4"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT4"
FT                   /protein_id="ACC69553.1"
FT                   /translation="MSWQSALACWFLRRQFHPQTRHPIIDARRARRMTAKRAYTPRVPS
FT                   GWTLHERYGAHDAPLRGEWLTRVDGVHKATILYLHGGGYYFCSPQTHRAASFGLAARSG
FT                   ARVFSLDYRLAPEQPFPAALDDALAAYRRLMEEGSKAESIVIAGDSAGGGLALATLVAL
FT                   RDAGEPMPAGAILFSPWTDLAATGASLQTNDGADPMFHGPSIARAAHLYLGGTPATHPY
FT                   ASPLYADLKGLPPLFMQVSSTEVLLDDSRRVADKARAAGVEIDFEIWPNMPHVWQLWVP
FT                   FIPEAGRALDLAARFVVRVTDESRNVQPSSETSIA"
FT   gene            complement(408777..409619)
FT                   /locus_tag="Bphy_0361"
FT   CDS_pept        complement(408777..409619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69554"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT5"
FT                   /protein_id="ACC69554.1"
FT                   /translation="MEPATLAALPLSADDLEALRRARYKLESPALAMKLASIVGSPMEK
FT                   LISRMPALASDKVNDATQLALRKCLQIALRTLGRPMGGASLGVNDRPSNLLHKFAVATT
FT                   GAAGGAFGLLALPVELPVTTTLMFRSICDIARSEGENLTSVDIQLQCLTVLGMGGTSKA
FT                   DDDADYGYFIMRGALAQAVSKASSEIATKGFSTHGSAALLRLLNTIASRFSVQVSEQIA
FT                   AKSIPAIGAVLGAMVNTVFIDHFQQVAHGHFTVRRLERQYGTDVVQAAYQAIEVSLDG"
FT   gene            409827..411353
FT                   /locus_tag="Bphy_0362"
FT   CDS_pept        409827..411353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0362"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A4062 major facilitator superfamily (MFS) multidrug
FT                   efflux pump, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69555"
FT                   /db_xref="GOA:B2JCT6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT6"
FT                   /protein_id="ACC69555.1"
FT                   /translation="MLGVSFVSMLVALDQTVVGTALPTIVADLKGFELYAWVATSYLLT
FT                   SVITVPIFGRLGDYYGRKPFVIASIVVFTAASVLCGAANNMLFLVIARGLQGIGGGMLV
FT                   GTAFACIPDLFPDSVVRLRWQVLMSTAFGIANAVGPSLGGFLTQYYGWRSVFYVNLPVG
FT                   LLSLFFVWRYLPHLRHVVHEGKMRLDWPGALLIALSLGSLQVFVELLPKHGVTASAAGL
FT                   LVLSVASAIALWQWEKRFPQAILPVDMFRNGSLSALFMLAVLGGFAMFSLLFYAPLLFQ
FT                   GGFGMMPNEAGLVITPLVVFITIGSIANGRIVSRIPNPNVMLFVGFALFAAASLGVVIA
FT                   TRSMPHWLLMLFMTLGGLGLGFVLPNLTVFAQQTAGREHLGIATALLQSLRMIGGMIGT
FT                   ALTGTLVTHMYASGVRSALDGDHAYKWFADLGDPQILVNRDAQQTLLGEMARAGHNGAL
FT                   LLESARESLVGAIHMGLALGALVSILAIWQSRRVPPVKLRKQVEPVVHVD"
FT   gene            411390..411860
FT                   /locus_tag="Bphy_0363"
FT   CDS_pept        411390..411860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0363"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_A4061
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69556"
FT                   /db_xref="GOA:B2JCT7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT7"
FT                   /protein_id="ACC69556.1"
FT                   /translation="MEEQDRVAILHQFGRTYRAFMSAFEGRVGHPMPRWRILLALYEQA
FT                   GESSQKKLVERLRIDPGALTRQLKSLEAMGWIARSMDERDNRITNVKLTTEGRAAIETS
FT                   LPSRNAFLHDTMAALPDHVLAGLSSALTMLEARIGEVAAGASTDAESADAGR"
FT   gene            complement(411930..413207)
FT                   /locus_tag="Bphy_0364"
FT   CDS_pept        complement(411930..413207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0364"
FT                   /product="putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /note="KEGG: bxe:Bxe_A4060 putative D-serine deaminase
FT                   (d-serine dehydratase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69557"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT8"
FT                   /protein_id="ACC69557.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGNVPGTSIQLSDASRLEWNLLDEDVSL
FT                   PAAVLYADRIEHNLNWMQKFVAEYGVKLAPHGKTTMAPQLFRRQIETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGKRNMLMIAELLSDPDFEFFCLVDSVEGVEQLGKFFGSVK
FT                   KQLQVLIELGVPGGRTGVRNDAQTQAVLDAIARFPDSLKLAGIELYEGVLKEEQEVRDF
FT                   LRSAVKLTLELSDKGRFARTPAVLSGAGSAWYDVVAEEFQKASRKDRIEIVLRPGCYLT
FT                   HDVGIYRKAQTDIFKRNPVAKRMGEGLLPALHLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GYPEPAKHYRPGAEKPRDITADEGWEIFGMMDQHAYLRIPVGADLKVGDMIAFDISHPC
FT                   LTFDKWRQVLVVDPSYRVTEVIETFF"
FT   gene            413349..414242
FT                   /locus_tag="Bphy_0365"
FT   CDS_pept        413349..414242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0365"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: bxe:Bxe_A4059 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69558"
FT                   /db_xref="GOA:B2JCT9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCT9"
FT                   /protein_id="ACC69558.1"
FT                   /translation="MNSSAEPVAFDIVARIAECAPGLRSAERKVAALILDDLTGASRAS
FT                   IGALAERAEVSVATVTRFAKAVGCRDVRELKLRLAQAAAVGQRFLQTSAQNDDTPEPLA
FT                   TRVFDELQTALTHNHQLLCQAPVEQAAAALREARMIYVFGMGGGSTALADEMRFRLVRL
FT                   GRPVATYQDALLQRMVASTVSRDTVVIALSTTGRVPEMVDSCKIARSYGATLITVTAPA
FT                   SPLAKLADWVIPIVAFETDFIYKPSSSRYAMMMALDVLVTELALSLGDESRELLRRMKH
FT                   ALDAHRGGGDRQPLGD"
FT   gene            414246..415733
FT                   /locus_tag="Bphy_0366"
FT   CDS_pept        414246..415733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0366"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3; KEGG: bxe:Bxe_A4058 N-acyl-D-amino-acid
FT                   deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69559"
FT                   /db_xref="GOA:B2JCU0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU0"
FT                   /protein_id="ACC69559.1"
FT                   /translation="MHSHPEAADTLIVGAQLYDGTGAPPVERDVALRNGRIAAIGNLSN
FT                   WLAEEVIEANGRALAPGFIDVHTHDDTHVIRSPEMLPKITQGVTTVIVGNCGISASPVS
FT                   LHGDPPDPMNLLGPRDAFQYPTFAAYVAAVNAAKPSVNVGALIGHTALRNNHMNRLDRA
FT                   ATAREIDGMRAQLEEALANGALGLSSGLAYGSAFAAPTEEVMALAEPLAASGALYTTHM
FT                   RTEFDAILDAMDEAYRIGKHARVPVIISHLKCAGPSNWGRSVEVLASLEGARQFHPVGC
FT                   DCYPYNRSSSTLDLKQVTGDIDITITWSTPHPEMAGKTVKEIAAEWGVTQQDAGKRLQP
FT                   AGAVYHNMSEDDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGHYARDQKLIAL
FT                   EEAIRKMTSLSARRFGLKERGEVHIGYHADLVLFDPLRVRDAATFEEPQQAADGIDAVW
FT                   VNGVLSYRDGVHTGERAGRFVARGATAASRAELADVF"
FT   gene            415792..416178
FT                   /locus_tag="Bphy_0367"
FT   CDS_pept        415792..416178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0367"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bxe:Bxe_A4057
FT                   putative translation inhibitor, YjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69560"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU1"
FT                   /protein_id="ACC69560.1"
FT                   /translation="MKRYGVEGGKGTGGQVMPFARAVEADGWLFVSGQTPMENGEVING
FT                   GIVEQSHKAIQNVMAILSEAGYGPEHVVRCGVWLDDPRDFASFNKVFKEYFGANPPARA
FT                   CVVSSMVIDCKVEVDCVAYKKPAA"
FT   gene            complement(416342..417166)
FT                   /locus_tag="Bphy_0368"
FT   CDS_pept        complement(416342..417166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0368"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I; KEGG: bxe:Bxe_A4056 putative GTP
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69561"
FT                   /db_xref="GOA:B2JCU2"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCU2"
FT                   /protein_id="ACC69561.1"
FT                   /translation="MTPEQSPLGKPSSYTEQYDASLLFPIARKNARDQIGIGATLPFFG
FT                   TDIWNAYELSWLNARGKPQIAIATFYVPADSPNIVESKSFKLYLGSFAQSSFDSIDVVR
FT                   DTIKRDVSAACGSSVSLHLYPPAEFSKLGLEEFEGTSLDRLDLDAEVYQPDASILKAAL
FT                   DEAPVEETLFSNLLKSNCPVTGQPDWGSVQIHYVGPQIDHAALLRYIISYRNHTGFHEQ
FT                   CVEKIFLDVMKVCQPVKLAVYARYTRRGGLDINPFRTNFNLPMPDNLRTARQ"
FT   gene            complement(417163..418065)
FT                   /locus_tag="Bphy_0369"
FT   CDS_pept        complement(417163..418065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0369"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /note="PFAM: 5-nucleotidase; KEGG: bxe:Bxe_A4055
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69562"
FT                   /db_xref="GOA:B2JCU3"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU3"
FT                   /protein_id="ACC69562.1"
FT                   /translation="MAFSLNDKLVVAISSRALFDFEEENGVYEEGDLHAYETLQRARLN
FT                   VPAKPGVAFPLIRKLLALNAGAHRVEVVILSRSDPISGLRAFSSCREHGLAIERGVFTR
FT                   GRAPFAYLKPLNASLFLSANQDDVRDALAAGFPAARVLPESAKMAGKYPDEIRIAFDGD
FT                   AVLFSDEAERVFQKDGLGAFVGHETDNKDLPLADGPLKPLLKALHRLQTLADEAAPMHI
FT                   RTALVTARSAPAHERAIRTLMAWNIEIDEAMFLGGLDKGAFLREFEPDFFFDDQIRHCE
FT                   SARDVTAIGHVVSGIVNVS"
FT   gene            complement(418075..419598)
FT                   /locus_tag="Bphy_0370"
FT   CDS_pept        complement(418075..419598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0370"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: bxe:Bxe_A4054 threonine dehydratase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69563"
FT                   /db_xref="GOA:B2JCU4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU4"
FT                   /protein_id="ACC69563.1"
FT                   /translation="MASHDYLKKILNARVYDVARETELEYARNLSARLRNPIYLKREDN
FT                   QPVFSFKLRGAYNKMAHIPADALARGVITASAGNHAQGVALSAARMGVKATIVVPVTTP
FT                   QVKVDAVRAHGGPTVEVVQAGESYSDAYAHAVKLQEQHGMTFVHPFDDPYVIAGQGTVA
FT                   MEVLSQHQAPIHAIFVPIGGGGLAAGIAAYVKSVRPEIKVIGVQTDDSCAMAQSIKAGK
FT                   RVTLNEVGLFSDGTAVKLVGEETFRLCQAYLDEVLTVNTDALCAAIKDVFQDTRSVLEP
FT                   AGSLAVAGAKQYAEREGIENQTLIAVTSGANMNFDRMRFVAERAEVGEAREAVFAVTIP
FT                   EERGSFKRFCELVGTRSVTEFNYRIADANSAHIFVGVQIRNRGESAQIAGTFEEHGFAT
FT                   VDLTGDELSKQHIRYMVGGRSPLAHDERLFRFEFPERPGALMKFLSSMAPNWNISLFHY
FT                   RNQGADYSSILVGIQVPSAEDAEFARFLATLGYPYWEETSNPVYRLFLA"
FT   gene            420306..424421
FT                   /locus_tag="Bphy_0371"
FT   CDS_pept        420306..424421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0371"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; FAD linked oxidase
FT                   domain protein; KEGG: bxe:Bxe_A4053 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69564"
FT                   /db_xref="GOA:B2JCU5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU5"
FT                   /protein_id="ACC69564.1"
FT                   /translation="MNAPQVFDPHGAAATVAADAEPRLREIPYNYTSFSDREIVIRLLG
FT                   DEAWAALDELRAERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRALLIEALNH
FT                   RLAEIEKRRRADLVEHTDDAGVDRAARVETLVAAARRAVDAFASEFDKMADLRRRATKV
FT                   LGRQTQKDNIRFDGIARVSHVTDATDWRVEYPFVVLTPDTEAEIAGLIKACFELGLTVI
FT                   PRGGGTGYTGGAVPLTPFSAVINTEKLEQLGAVELTELPGVAHKVPTIFSGAGVVTRRV
FT                   TEAAEQAGYVFAVDPTSLDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWL
FT                   EVTRLDHNLGKIHDIPVARFELKWFDGEYAPGEKLLRTELLDIEGRRFRKEGLGKDVTD
FT                   KFLAGLPGIQKEGCDGLITSARWVLHKMPAHTRTVCLEFFGQAREAIPSIVEIKDYLFE
FT                   TSKQGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGNDADAVATATSEVI
FT                   RMANGKSGEGFVAVSAEARKRFWLDRSRTAAIARHTNAFKINEDVVIPLNRMGEYTDGI
FT                   ERINIELSIKNKLQLIDALEAFFKSGKLPLGKSDDANEIPSAELLEDRVQQALELLAHV
FT                   KKRWEFLRDKLDLSLREAQHYLVQLGYAGLAEKFADRVDDQPDANVFHIVQDRTVRVSW
FT                   KQEIRAELRQIFNGGEFKPILDEAQAIHKQVLRGRVFVALHMHAGDGNVHTNIPVNSDN
FT                   YEMLQDAHIAVARIMKLARSLDGVISGEHGIGITKLEFLTDDEIGEFRAYKQRVDPHGR
FT                   FNKGKLLEGADLRNAYTPSFGLMGYESLIMQQSDIGAIADSVKDCLRCGKCKPVCATHV
FT                   PRANLLYSPRNKILATSLLVEAFLYEEQTRRGVSIKHWDDFNDVADHCTVCHKCVTPCP
FT                   VKIDFGDVTMNMRNLLRKMGKKKFNAGNAAGMFFLNATNPQTINLARTAMMGVGYKAQR
FT                   LGNDVLKKLARKQTAHPPATTGKPPVVEQVIHFVNKKMPGNLPKKTARALLDIEDNKIV
FT                   PIIRNPKTTTVDSEAVFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQ
FT                   RGSGQFDKAEQIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFEKIFPGCR
FT                   IIDIHEFLLEKGIKLDGVTGTRYMYHDPCHTPIKTIDPVKLVNELMGTEKNDGYKIEKN
FT                   DRCCGESGTLAVTRPDISTQVRFRKEEEIRKGAAKLRGIPVVADAGANAINMANAAAGA
FT                   AGAPAGSVLKAGDGPQPNGAKGPNGATDVKILTSCPSCLQGLSRYNEDANVEADYIVVE
FT                   IARHVLGENWMADYVQHANNGGIERVLV"
FT   gene            424454..424882
FT                   /locus_tag="Bphy_0372"
FT   CDS_pept        424454..424882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0372"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bxe:Bxe_A4052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69565"
FT                   /db_xref="GOA:B2JCU6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU6"
FT                   /protein_id="ACC69565.1"
FT                   /translation="MDCIFCREDGGDVLWQDETLRVVLADEHDYPGFCRVIWNRHVAEF
FT                   SDLGDGERDRVMRVVYAVERAIRRILQPVKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEVMLSQRRAQATLLREAVRSEIEHALV"
FT   gene            424891..425304
FT                   /locus_tag="Bphy_0373"
FT   CDS_pept        424891..425304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0373"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   bxe:Bxe_A4051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69566"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU7"
FT                   /protein_id="ACC69566.1"
FT                   /translation="MSGLTPDTPVPTGVVVHAVSRVLELQYANGNSYRVPFELMRVYSP
FT                   SAEVRGHGPGQETLQTGKREVTITALEGVGNYALQPTFSDGHNTGIYSWDLLWDLATRQ
FT                   DELWAEYLDKLQAAGVDRDAPMPVSSPAHGHRH"
FT   gene            425374..426105
FT                   /locus_tag="Bphy_0374"
FT   CDS_pept        425374..426105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0374"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bxe:Bxe_A4050 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69567"
FT                   /db_xref="GOA:B2JCU8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCU8"
FT                   /protein_id="ACC69567.1"
FT                   /translation="MTQTHFGYQTVDEQEKAKKVAGVFHSVASNYDLMNDLMSGGLHRA
FT                   WKAFTIAQANVRPGYKVLDIAGGTGDLSKAFAKRAGETGEVWHTDINESMLRVGRDRLI
FT                   DKGVITPTLLCDAEKIPFPDNYFDVVTVAFGLRNMTHKDAALAEMRRVLKPAGRLLVLE
FT                   FSKVWDPLKKAYDVYSFKVLPWLGDRFAKDADSYRYLAESIRMHPDQETLKTMMEQAGL
FT                   DAVKYYNLSAGVVALHVGTKY"
FT   gene            426142..427137
FT                   /locus_tag="Bphy_0375"
FT   CDS_pept        426142..427137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0375"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: bxe:Bxe_A4049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69568"
FT                   /db_xref="GOA:B2JCU9"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCU9"
FT                   /protein_id="ACC69568.1"
FT                   /translation="MSDSNMSSRCKVKGSWARRIGLIAMVGLISVGTLASLDAEAKRMG
FT                   GGRTMGRQSNITQPQQQTSPSPSQSPGAPSQAMQQQRPATPAPTPAAQPNRSRWLGPIA
FT                   GLAAGLGIAALLSHFGLGEAFAGMMANMIVIALIAFVAIWLIRKFVGRKRNAQTPAYAG
FT                   GSPTLNAGGTGYSQEPRYTAPPTGSYLGPQGNPLTTPDIAATPAVPAGFDSEAFLRNAK
FT                   VYFVRLQAAWDAGNMDDIREFTTPEMFAEVRVDLSSRGAEKNQTDVVKLDADLLGVEDR
FT                   GSEYLASVRFHGLIRETVGGSAEPFEEIWNLSKRTGEGWLLAGIQQANLH"
FT   sig_peptide     426142..426249
FT                   /locus_tag="Bphy_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.716 at
FT                   residue 36"
FT   gene            427246..427890
FT                   /locus_tag="Bphy_0376"
FT   CDS_pept        427246..427890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0376"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   bxe:Bxe_A4048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69569"
FT                   /db_xref="GOA:B2JCV0"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV0"
FT                   /protein_id="ACC69569.1"
FT                   /translation="MTLAAKPFAAAVNHLLARETWARERLTPYAGKTARLSCPPITLIL
FT                   LVQPDGYLTAVDESEAHAFDVAVAVPSEAVPAFLQGGQAAVMKHVKIEGDAEFATVIAK
FT                   LAEHLRWEPEEDLAKLVGDGPAWRIASVARTVGDHVVRTGRNLLESVAEYLLDENPQLV
FT                   RRAALDDFNAELARARDALARVEKRIERLEQKVVARGADAPGAAAMSRGTR"
FT   gene            427906..429489
FT                   /locus_tag="Bphy_0377"
FT   CDS_pept        427906..429489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0377"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: bxe:Bxe_A4047
FT                   2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69570"
FT                   /db_xref="GOA:B2JCV1"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCV1"
FT                   /protein_id="ACC69570.1"
FT                   /translation="MRFLRFLKIFFTVIRFGLDEMMLSRVNDRRVRLLLRITTIGRKFD
FT                   QPPGVRLRLALESLGPIFVKFGQVLSTRRDLLRPDIATELAKLQDQVPPFDSAVAIAII
FT                   EKSLGAPVDTIFDDFERVPVASASIAQVHFATLKIGQHAGKQVAVKVLRPNMLPVIDSD
FT                   LALLRDIAVWAERLWADGKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMYWEYCTANVLVMERMVGVPISQVDTLRVAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPAHFGRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPATTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMNEQIGAKGWYERLKIEAPQWSKTL
FT                   PQLPRLIHHVLAQRHDAQQRGINDETIRQILLEQKRTNRLLQGLLMFGVAVGVGAVLAR
FT                   AWLAIAYGGY"
FT   gene            429512..430153
FT                   /locus_tag="Bphy_0378"
FT   CDS_pept        429512..430153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0378"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bxe:Bxe_A4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69571"
FT                   /db_xref="GOA:B2JCV2"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV2"
FT                   /protein_id="ACC69571.1"
FT                   /translation="MSDKRPSVPPSAPDFENRDPNAPGFWDERFGRGFTPWDQAGVPPA
FT                   FKAFVERHSPVPVLIPGCGSAYEARWLAEKGWTVRAIDFAPNAVEAARAQLGSHASLVH
FT                   EADFFTYRPPFDPGWIYERAFLCALPPARRSDWVARMAQLLSPGGLLAGFFFIGATEKG
FT                   PPFGIERAELDALMSPDFTLVEDEPVDDSIAVFAGRERWLTWRRRGAARG"
FT   gene            430292..430636
FT                   /locus_tag="Bphy_0379"
FT   CDS_pept        430292..430636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0379"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: bps:BPSL0642
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69572"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV3"
FT                   /protein_id="ACC69572.1"
FT                   /translation="MPIYAYRCESCGFAKDVLQKMSDAPLTQCPECGADAFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGNSAGAPSNTPAAAGSKPTEGNPDSASSSDSATSASAPAAAPAP
FT                   APAPASSSGT"
FT   gene            430707..431363
FT                   /locus_tag="Bphy_0380"
FT   CDS_pept        430707..431363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0380"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   bxe:Bxe_A4044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69573"
FT                   /db_xref="GOA:B2JCV4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV4"
FT                   /protein_id="ACC69573.1"
FT                   /translation="MTTKKTTLKSVFLTGLLVLVPLAITLWVLGLIIGTMDQTLLLLPR
FT                   SWQPERLLGFRLPGLGAVLTLAFIFVVGLLTQNFVGQKLVGWWELVVARIPVVGPIYTS
FT                   VKQVSDTLLSSSGNAFRKALLIEYPRKGSYTIGFLTGIPGGDVVNHLQEDHVSVYVPTT
FT                   PNPTSGFFLIVPKAEVIELDMTVDAALKYIVSMGVVAPPANQPLPERRTPVEPPL"
FT   sig_peptide     430707..430778
FT                   /locus_tag="Bphy_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.476 at
FT                   residue 24"
FT   gene            431436..433235
FT                   /locus_tag="Bphy_0381"
FT   CDS_pept        431436..433235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0381"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); GAD domain protein; tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bam:Bamb_2776
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69574"
FT                   /db_xref="GOA:B2JCV5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCV5"
FT                   /protein_id="ACC69574.1"
FT                   /translation="MSMRSEYCGLVTEHLLGQTVSLCGWVSRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFKTAEGVRNEFCVQVKGVVRNRPEGTTNAGLKSGKIEVLCHELNVL
FT                   NASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAMEVRKYLDSRGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQLLMVANFDRYYQITKCFRDE
FT                   DLRADRQPEFTQIDCETSFLSEQEIRDLFEDMTRHVFKETIGVELDAKFAVMPYSEAMS
FT                   RFGSDKPDLRVKLEFTELTDAMKDVDFKVFSTPANTKDGRVAALRVPKGGELSRGDIDS
FT                   YTEFVRIYGAKGLAWIKINEVAKGRDGLQSPIVKNLHDAAIAAIIERTGAQDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVEAGWKPLWVVDFPMFEYDEEENRYVAAHH
FT                   PFTSPKDEHLEYLETDPGRCLAKAYDIVLNGWEIGGGSVRIFQEDVQSKVFRALKIGAE
FT                   EARLKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQA
FT                   PSEVDERQLRELHIRLRQPEQKA"
FT   gene            433406..433882
FT                   /locus_tag="Bphy_0382"
FT   CDS_pept        433406..433882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0382"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bxe:Bxe_A4042 putative
FT                   dATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69575"
FT                   /db_xref="GOA:B2JCV6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV6"
FT                   /protein_id="ACC69575.1"
FT                   /translation="MPKPPKIPESVLVVIHTPELDVLLIERADRKAFWQSVTGSKEHID
FT                   EPLAETAIREVAEETGIVIGGALVPREALVDWHHQIEFEIFPTWRHRYEDGVTHNIEHW
FT                   FSLQVPRRLEVTLAPLEHTAHLWLPWQEAAERCFSWSNRDAILQLPQRVKERCR"
FT   gene            433879..435159
FT                   /locus_tag="Bphy_0383"
FT   CDS_pept        433879..435159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0383"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   bxe:Bxe_A4041 putative phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69576"
FT                   /db_xref="GOA:B2JCV7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV7"
FT                   /protein_id="ACC69576.1"
FT                   /translation="MTGGGRRRFDRLTQHLPGRRYWSRYRFCSGNTVRLFTAGEPYFAA
FT                   LTQRIDAAQREVALETYIFCDDPAGRPVSDALIRAASRGVHVRVITDGVGTQRLPMFND
FT                   WQAAGIEHRIYNPHIFGRFGFSRTHRKLAVVDGEFAYCGGINVVDDYDQNGARLPYARW
FT                   DFAVELQGPVVADVLEAIDVQWERIRIGHRPALAPPAVGGSTPQAATARFVRARSSAGT
FT                   AASGRSSDMRAIAEPCIAFVARDNFVNRRAIERAYLTAIGQARSEVLLANPYFMPGRKL
FT                   RRALMLAAQRGVDVRLVIGRKEFAVLDYAVPFLYRQLLKSGVKIAEYEKTMLHGKVAVV
FT                   DSNWGTVGSSNLDALSLMLNNEANVVLVLHPEIDQLRDAILAAFDESRRIDEKHYESRP
FT                   AGERLLNWVAYNTYRLAMKLLTVGGYD"
FT   gene            435400..436005
FT                   /locus_tag="Bphy_0384"
FT   CDS_pept        435400..436005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0384"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_A4039
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69577"
FT                   /db_xref="GOA:B2JCV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV8"
FT                   /protein_id="ACC69577.1"
FT                   /translation="MRKGEQTRAAILDAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSREDLQVEVVREYHRRFEDEVFFPSLREPRGLPRLRAMISRWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRAESAVREQLVASVTMWRAALTRAISQAMEEGHLRADTDPQLMLFELYSF
FT                   TLGLHHDARFLHLPDAVRLTWAALEKLIVSYQSESTSC"
FT   gene            436100..437887
FT                   /locus_tag="Bphy_0385"
FT   CDS_pept        436100..437887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0385"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   bur:Bcep18194_A6048 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69578"
FT                   /db_xref="GOA:B2JCV9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCV9"
FT                   /protein_id="ACC69578.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAEIKQMPRHADLDADTINQVLEE
FT                   AGKFCAEVLFPLNQSGDREGCTYEGDGVVTTPKGFKEAYKQYVEAGWPALGCDPDFGGQ
FT                   GLPTFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGTPELKQAYLPKLVSGEWTGT
FT                   MCLTEPHCGTDLGILRTKAEPKGDGSYAISGTKIFISSGEHDLADNIVHLVLARLPDAP
FT                   HGTKGISLFVVPKFVPDANGNPGERNGVKCGSIEHKMGIHGNATCVINLDNAKGWLVGE
FT                   PNKGLNAMFVMMNAARLGVGMQGLGLTEVAYQNSLIYAKERLQMRSLTGPKAPEKPADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFTYWSALHIDKELSHADEAVRKDAADLVALLTPIIK
FT                   AFLTDNAFEGTNMAMQIYGGHGFIAEWGMEQYVRDARINMIYEGTNSIQSLDLLGRKVL
FT                   GDMGAKLKKFGKLVTDFVEEEGIKPEMQEFVNPLADIGDKVQKLTMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDNEASGDPFYKSKLATARFYFAKLLPETAST
FT                   IRAARAGAKTLMDIDEALF"
FT   gene            438011..440455
FT                   /locus_tag="Bphy_0386"
FT   CDS_pept        438011..440455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0386"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_A4037 putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69579"
FT                   /db_xref="GOA:B2JCW0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW0"
FT                   /protein_id="ACC69579.1"
FT                   /translation="MSNLIIRKVAVLGAGVMGAQIAAHLINAKVPVLLFDLPAKEGPKN
FT                   GIALKAIENLKKLSPAPFGAKDDAQYIQPANYDDDIEKLAECDVVIEAIAERMDWKHDL
FT                   YKKVSPHIGANAIFATNTSGLSITELSKGFSDELKARFCGVHFFNPPRYMHLVELIPTA
FT                   TTRPEILDQLETFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVIKEAEKFGLRFDEVD
FT                   DLTGSRLGRAKSATFRTADVVGLDTMAHVIKTMQDNLADDPFFAVYETPAVLTGLVQQG
FT                   ALGQKTGAGFYKKEGKAIKVLDAKSGSYVDGGAKADELVGRILKRPPAERLKLLRESQH
FT                   PQAQFLWAIFRDVFHYIGVHLESIADNARDVDFAIRWGFGWSEGPFEGWQTAGWKQIAG
FT                   WVQEDIAAGKALSNAPLPAWVLEGAVAEKGGVHTDEGSWSPAEKRFVPRSSLSVYDRQV
FT                   FRAPLAGESNGGGADPKRYGKTVFETDAVRAWVDDRAGENDVLIVSFKSKMNTIGPSVI
FT                   DGIEKAIDAAEKDYKAVVIWQPASLKLGAPGGPFSAGANLEEAMPAFMMGGAKGIEPFV
FT                   KKFQQGMLRVKYSNVPVVAAVSGIALGGGCELLLHSAKRVAHIESYIGLVEVGVGLVPA
FT                   GGGLKEAALRAAETATQVGATSDLLKFLQKSFENAAMAKVSTSALDARAMGYLKPSDTI
FT                   VFNVFELLDTAKKEARALAAAGYRAPLRVTQVPVAGRSAMSTIKASLVNMRDGRFISDH
FT                   DYLIASRIAEAVCGGDVEAGSLVDEEWLLALERRAFVELLGTQKTQERIMGMLQTGKPV
FT                   RN"
FT   sig_peptide     438011..438097
FT                   /locus_tag="Bphy_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.361 at
FT                   residue 29"
FT   gene            440467..441666
FT                   /locus_tag="Bphy_0387"
FT   CDS_pept        440467..441666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0387"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: bxe:Bxe_A4036 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69580"
FT                   /db_xref="GOA:B2JCW1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW1"
FT                   /protein_id="ACC69580.1"
FT                   /translation="MTKQLQDAYIVAASRTPIGKAPRGMFRNTRPDELLVHAIRSAVAQ
FT                   VPDLDTSLIEDAIIGCAIPEAEQGLNVARMGALLAGLPSTVGGVTVNRFCASGVTALAM
FT                   AADRIRVGESDVMIAGGCESMSMVPMMGNKPSLSPHIFDRNEDVGIAYGMGLTAEKVAE
FT                   RWKVSREQQDHFSVESHRKAVAAQQAGEFADEIAPYAITERFPDLATGEVRVTMREVAL
FT                   DEGPRADTSMEGLAKLRTVFANRGTVTAGNSSQTSDGAGALIVVSEKILKQFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKQDDIDWIELNEAFAAQSLAVINDLGLD
FT                   VSKVNPLGGAIALGHPLGATGAIRAATVVHGLRRRKLKYGMVTMCVGTGMGAAGIIERV
FT                   "
FT   gene            441843..442607
FT                   /locus_tag="Bphy_0388"
FT   CDS_pept        441843..442607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0388"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_A4035 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69581"
FT                   /db_xref="GOA:B2JCW2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW2"
FT                   /protein_id="ACC69581.1"
FT                   /translation="MEIELTRTLDVLTITFNRAEKKNAITAAMYQTMADALVEAQTDTA
FT                   IRAVLLRGRAGIFSAGNDLEDFMKQPPVGEDAPVFQFLRAISSVEKPLVASVAGAAVGI
FT                   GTTLLLHCDLVYAADSATFSLPFAQLGLCPEAASSLLLQRVAGYQVAAEKLMLGEPFDA
FT                   KEAYRMGFVNRLLPADEVDAFALQQAQKLAALPASSLRVTKQMMKRAAQHEIQTQMTDE
FT                   AVHFAKMLLAPEAKEAFKAFFEKRKPDFRQFS"
FT   gene            complement(442626..443447)
FT                   /locus_tag="Bphy_0389"
FT   CDS_pept        complement(442626..443447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0389"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: bxe:Bxe_A4034 formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69582"
FT                   /db_xref="GOA:B2JCW3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW3"
FT                   /protein_id="ACC69582.1"
FT                   /translation="MNELDTGEQPGIVEQAVRRHRAGAVESVADHVGQEWPVALVFNGI
FT                   SHAVMMCTPRDLEEFAVGFAISEGIVERGAHIQDIEVEFRDGKLPHAEVQLTVVQQAFA
FT                   ALKEKRRALSGRTGCGVCGIESIDLLDLTPERVPDTGFLQRLAPDAIARAAKGLPAHQA
FT                   LTKMTGGLHAAAWCDATGAIRYAFEDVGRHNALDKLIGRLSLDRVDTRDGFVFLSSRAS
FT                   YELVRKAARVDIPMVATISAPSSLAITIAREAGVRLVSFCRESSYVDYDTV"
FT   gene            443564..444040
FT                   /locus_tag="Bphy_0390"
FT   CDS_pept        443564..444040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bxe:Bxe_A4033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69583"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW4"
FT                   /protein_id="ACC69583.1"
FT                   /translation="MGLNEAPLMFNFEVESSENLKFIPMVVRFNLDRFGLRISLEQWQM
FT                   LPHEDRALLARFPVDDDTAIEPNFDHALFEMLRTHANVEPEWFTPEDNPAWRNTAVVPE
FT                   TVLNQAELADLAAPSAAQWAQLEPFQRYVLAKLSRKAASNHDFLPAMKEFGLAG"
FT   gene            444224..447346
FT                   /locus_tag="Bphy_0391"
FT   CDS_pept        444224..447346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0391"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: bxe:Bxe_A4032 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69584"
FT                   /db_xref="GOA:B2JCW5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW5"
FT                   /protein_id="ACC69584.1"
FT                   /translation="MISFLSKRLLINLAVVAAAVGANAFVAYTQICGQRDADARTARST
FT                   AIRQNLEAYRSTLEDGLDVLGRYEASAQPAPANTVGSMSASLAQIDRSLHKQLADQPGV
FT                   GGALDALTVSGNRLQQDIAAALAKTTAPEQDGSRAWAAQTYTRLGMEVDRLEAHMEQLR
FT                   AQEDRALKAALDASMRDSRYAMLFLVVTMLAGSGLLIYTFGARENVAREKLRVARTLHR
FT                   SDERFRGLFEQHPVPMYIFDRDTLRFLAVNAAAVQQYGYSESEFLAMTVRAIRPHSEVA
FT                   RLETHLQRSDVTPGGPRTMAGVWHHRRKDGSQISADISYHAMTFMGRPALFVLADDVTE
FT                   QINAEAEAQRSNQMLETVIDNIPQRIFWKDKELRYLGCNMAFARDAGLAYPEQVIGKRD
FT                   EDMPWRAFAEALGRQDTDVMLSGVPKMNYETDLVIDGVHRTTVTSKLPFTDSDGRVIGV
FT                   LGSYTDITERKRADLALRLQSRALDASVNAILITEPSKEGNLIEYVNPAFKRITGYDPQ
FT                   EVIGQDCRLLQRDDRDQEGIAAIRQALAANREVSAVLRNYRKDGALFWNQLYIAPVPDA
FT                   DGQTTHHIAVINDVTALIRYQEQLEYQANYDSLTRLPNRNLLRDRLQHALIVAQRHHKG
FT                   VAVVFIDLDGFKNVNDSLGHSVGDRLLSVVADRLARCARASDTVARHGGDEFVIVMTDT
FT                   VDEQSLIAWMERVRASISEPVWLDGTELYVGCSMGASLFPQDGDDAETLMKKADLAMYR
FT                   AKDMGRNTFQFYQPEMNVSAGARLNLERRLRRALRDNEFLLHYQPQVDIETGQVVGMEA
FT                   LVRWHDPEVGLIPPSQFIPVAEESGLIGPLSEWVLREACRQNKAWQDEGLPPARVSVNL
FT                   SARQFQQRDIAKLVMQVLEETGLDPQYLELELTESTIMRNAEEAVSMLNELHALGIGLA
FT                   IDDFGTGYSSLSYLKRFPVDRLKIDRSFVSDIGESSDDETITSAIIALAHSLNLQVIAE
FT                   GVETSTQLDFLKERACDEMQGYFFAKPLPHHAIPGMLQRGSQSPAMETADV"
FT   sig_peptide     444224..444298
FT                   /locus_tag="Bphy_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.791 at
FT                   residue 25"
FT   gene            complement(447404..447811)
FT                   /locus_tag="Bphy_0392"
FT   CDS_pept        complement(447404..447811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0392"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bxe:Bxe_A4028 putative thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69585"
FT                   /db_xref="GOA:B2JCW6"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW6"
FT                   /protein_id="ACC69585.1"
FT                   /translation="MDAPMTQTLQLPQKPCALRVVPQPSDANVHGDVFGGWIMAQVDIA
FT                   GSIPASRRANGRVATIAVNSFVFKQPVFVGDLLSFYADIVKTGNTSVTVSVEVYAQRMS
FT                   LAEETVKVTEATLTYVATDTDRRPRALPPLE"
FT   gene            448102..449997
FT                   /locus_tag="Bphy_0393"
FT   CDS_pept        448102..449997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0393"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: bxe:Bxe_A4027
FT                   ABC transporter, fused ATPase and inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69586"
FT                   /db_xref="GOA:B2JCW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW7"
FT                   /protein_id="ACC69586.1"
FT                   /translation="MRRYSASSEPSPISNLPRNDWQTIVSLLPYLSTYKWRVVFALSCL
FT                   IGAKVANLGVPIVMKHIVDSLASVQHLTALGRATNAPGIVLLGGVGLLVIAYAVVRLST
FT                   SLFTELREILFSKVTESAVRQLALKVFRHLHSLSLRFHLERQTGGMSRDIERGTRGITQ
FT                   LISYSLYSILPTLVEFGLVLGFFIVKYEAYYAIVTAIALVAYITYTVKVTEWRTHFRRT
FT                   MNELDSKANSRAIDSLLNYETVKYFNNEEWEAQRYDENLKRYRAAAIKSQNSLSALNFG
FT                   QQAIIGTGLVFILWRATQGVMAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLT
FT                   DMDRMFTLLGAAREVPDAPDAAPLAVQGAQVSFDHVSFAYEPSRPILHDVSFTIAAGTT
FT                   TAVVGHSGSGKSTLARLLFRFYDLDRATGGAIRIDGQDIRDVTQDSLRASIGIVPQDTV
FT                   LFNDTIYYNIAYGRPSATRDQVIAAARAAHIHEFIESLPKGYDTPVGERGLKLSGGEKQ
FT                   RVAIARTLLKNPPVLLFDEATSALDSRSERAIQHELDQIARDRTTLIIAHRLSTVVHAE
FT                   QIIVMDKGRIVERGNFAALVQAGGLFAQMWALQQERAAAAHAEDAGVEARGEGVG"
FT   gene            complement(450074..450772)
FT                   /locus_tag="Bphy_0394"
FT   CDS_pept        complement(450074..450772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0394"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG:
FT                   bur:Bcep18194_A6040 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69587"
FT                   /db_xref="GOA:B2JCW8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW8"
FT                   /protein_id="ACC69587.1"
FT                   /translation="MNKAMIFAAGRGDRMRPLTDTCPKPLLKVGGKALIEWQIERLARA
FT                   GFTSIVINHAWLGEQLEAALGDGGRYGVSLLYSAEHDALETAGGIAQALTLLEDAGKPE
FT                   VFVAVAGDVYADFDYSALRGKIARLAAMDEPGMHLVMVPNPSFHPDGDFVLAADGCLAL
FT                   EGAPRHTFGSIGVYDTRMFRDIAPGTRQALTPYYREAIAMGRATGELYEGLWENVGTPA
FT                   QLHALDEILK"
FT   gene            complement(450784..451830)
FT                   /locus_tag="Bphy_0395"
FT   CDS_pept        complement(450784..451830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0395"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bxe:Bxe_A4025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69588"
FT                   /db_xref="GOA:B2JCW9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCW9"
FT                   /protein_id="ACC69588.1"
FT                   /translation="MTDTRLGLLNGWLRTHAERYRLDLATLEPASADASFRRYFRVAGG
FT                   GAGFGATTDAGASTVIAVDAPPPEKCREFVQVAGLLADAGVHVPRVLEVDLDAGFMLVT
FT                   DLGTQSYLSALRDSSPAEARQLMRAALDALIRWQLASREDVLPPFDEAFLRREMELMPE
FT                   WFIGRHLGREVDETTRGVLDRTFALLVASAMAQPQVFMLRDFMPRNLMIASPNPGVLDF
FT                   QDAVYGPITYDVASLLRDAFIGWDEAFELDCFAYYWEHAKKAGLPVDADFGEFYRQLEW
FT                   MGLQRHIKVLGLFCRINYRDSKPHYMADLPRFIGYARRVCERYRPLAPFAKLLDDLEGR
FT                   AAEVGYTF"
FT   gene            452101..454467
FT                   /locus_tag="Bphy_0396"
FT   CDS_pept        452101..454467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0396"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; KEGG:
FT                   bxe:Bxe_A4024 putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69589"
FT                   /db_xref="GOA:B2JCX0"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX0"
FT                   /protein_id="ACC69589.1"
FT                   /translation="MPPRQLFPITPSSDGLPRRRRLAAALIAVPGLLPALSHAQLAGEA
FT                   AQAQPIDAPWGLRLAPQLEEHSTPEGQSPATFVLGDSTTGTADQDIAAKGSAEVRRGNS
FT                   ALKADALHYDQDTDMADAYGNVHLSGNGARFTGPEAHMKLESSEGFMTTPKYHFNVTGG
FT                   SGSAERVDLLDNERSVFTRGTYTACECAEDPAWYIKGSEFDFDTGADNGVAHNGVLFFQ
FT                   GVPVFASPWLSFPLSGARRSGLLPPTASLSSTNGFELSLPYYFNIAPNRDLTFTPRILS
FT                   KRGVQLQSTFRYLSPTYSGSITGEFLPDDKITHTNRYALYIQHNQNFGSGFGGYIYYNK
FT                   VSDNTYPEDLASTTNQFLNGTQLLYQQEAGLTYNNGPWSVLAREQHWQTLAPSTAPYGR
FT                   EPQLNVKYTKYNVGGFDFGAEADYTRFRITTADSTEGDRVVFNPYLSYSVVGPGYFVTP
FT                   KVQWHFASYDLSNIGTGAPANQPKNFTESVPTFSFDTGLIFDRSVRVFGEDYIQTLEPR
FT                   LYYVYTPYRNQSFAPLFDTAESDFGLAEIFTPNTFVGNDRIADANRLTAALTTRFLNPA
FT                   TGDERARFVIAQQYYFRDQRVTLNQTQTTEQATHSDLILGASLKLGAGFASETAFQYNA
FT                   DNNQLVKTSVGFGYSPASGKVINVGYRYTRANTTLDNQPINQLLISGQWPLMHRVFGVG
FT                   RINYDLKGHRAVDALLGLQYDADCWTLGLGFQRYANGVNSTGSQTAGTRVLAQLTFKGL
FT                   SSVDNGLMSAFRASVAGYQPLPPPPPPESQFNNYE"
FT   sig_peptide     452101..452220
FT                   /locus_tag="Bphy_0396"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.863 at
FT                   residue 40"
FT   gene            454623..456014
FT                   /locus_tag="Bphy_0397"
FT   CDS_pept        454623..456014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0397"
FT                   /product="SurA domain protein"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: bxe:Bxe_A4023 putative peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69590"
FT                   /db_xref="GOA:B2JCX1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX1"
FT                   /protein_id="ACC69590.1"
FT                   /translation="MAIMKKLRLATFATGFAAAASILLAGPAHAQALNGSGSAQTVDTI
FT                   AAVVNNGVITQRELDMRVGLITKRLNQQHAPIPPADQLRQQVLNQMVLERIQLQKARED
FT                   GITVDDATVQRTLERLAQANNLQLDMYRARIEAQGVPWTTFMGDAKTELILSRLREKEV
FT                   DSKVTVSDAEVANYIASQRGPTAGLASDLHLEHIFLKAPLNASQTDIEAAQAKANALLQ
FT                   EALKGDNFGKLAKSNSQAPDASKGGDLGFQAPSRLPAEFVTAAATLRPGQVNPSVIRTN
FT                   DGFEIVRLVERRSGQGSASADSTKLVQTHVRHILLRVGDGMSEPQARQKLLEIRQEIEA
FT                   GQGDFDKFARTYSQDGSASQGGDLGWISPGETVPEFERAMNSLQDNQISQPVRSEYGYH
FT                   LIQVLGRREAEGSVSQQMDLARQAIGQRKAEQAYADWLRELRDTAYVDYKVGPVTGTSA
FT                   DNTAQ"
FT   sig_peptide     454623..454715
FT                   /locus_tag="Bphy_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            456029..457030
FT                   /locus_tag="Bphy_0398"
FT   CDS_pept        456029..457030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0398"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: bxe:Bxe_A4022 pyridoxal phosphate biosynthetic
FT                   protein PdxA; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69591"
FT                   /db_xref="GOA:B2JCX2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX2"
FT                   /protein_id="ACC69591.1"
FT                   /translation="MIAAQPSNDPLHIAITTGEPAGVGPELTAQALAAAGAHWPDARFS
FT                   VLGDSALMDERAKAVGVDWAAQQGRRIAMQHHALAVPALAGKLDAQNGPYVLGLLDAAI
FT                   DGALAGTFDAIVTAPLQKSTINDAGVPFTGHTEYLAERTGTPHVVMMLAGTGARPLRVA
FT                   LATTHLPLKDVSAALTVDGIADTLRIIDHDLRRHFGLPAPRILVTGLNPHAGENGYLGR
FT                   EEIDVISPALRLANGQGIDARGPYPADTLFQPRYLNEADCVLAMFHDQGLPVLKYATFG
FT                   EGINVTLGLPIIRTSVDHGTALDLAGTGRADAGSLIAAIDTAVFMARNRRAA"
FT   gene            457051..457881
FT                   /locus_tag="Bphy_0399"
FT   CDS_pept        457051..457881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0399"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   bxe:Bxe_A4021 rRNA 16S rRNA dimethylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69592"
FT                   /db_xref="GOA:B2JCX3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JCX3"
FT                   /protein_id="ACC69592.1"
FT                   /translation="MSNSSSRQHQGHFARKRFGQNFLVDLGIIDSIVDVIRPQRGERMV
FT                   EIGPGLGALTEPLVERLATPEAPLHAVELDRDLIGRLKKKFGNLLELHEGDALAFDFGS
FT                   LAGEGDKPTLRIVGNLPYNISSPLLFHLATFAERVIDQHFMLQNEVVERMVAEPGSKAF
FT                   SRLSVMLQYRYVIDKLLDVPPESFQPPPKVDSAIVRMIPYAPHELPAVDEIKLGEVVTA
FT                   AFSQRRKMLRNTLSTYRDSVDFEALGFDLQRRAEDVPVAEYVAVAQAVSAAAGT"
FT   gene            458105..459232
FT                   /locus_tag="Bphy_0400"
FT   CDS_pept        458105..459232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0400"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_A4019
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69593"
FT                   /db_xref="GOA:B2JCX4"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX4"
FT                   /protein_id="ACC69593.1"
FT                   /translation="MTKVSKRVTICAWAAMSPALTCGAAYAQSSVTLYGIVDESVRYMT
FT                   HVNKNGDSSVGLGNGGMSESRWGLRGVENLGGGWSTFFKLENRIYINSGQSDPTLPFFN
FT                   EAQIGVQSSTYGKLIFGRMPNVLIEGITIGGYGSNPWIPYDFSFQPEVTMSGGIWTSNQ
FT                   VQYQARAHDVMLSVAYAFGGVAGHTSYGSQFGAAAAYAPNGGPVNLGGAYEETRDSVNG
FT                   STAKAWTFGASYTWNQTRFALGYIVNQNDAGFSNFANGPFTAPVLAALKYTDFSRRRMI
FT                   LGGITQQVGAAWHFAANVWRTLQDGKTSAQDGSAWQYQLVADYSLSKRTDVYLEGDYAL
FT                   YRGDLIGAQLQGVNGVGLAQKGSQIGLMTGLRHLF"
FT   sig_peptide     458105..458188
FT                   /locus_tag="Bphy_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 28"
FT   gene            459311..459697
FT                   /locus_tag="Bphy_0401"
FT   CDS_pept        459311..459697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0401"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: bxe:Bxe_A4018 glyoxalase I; TIGRFAM:
FT                   lactoylglutathione lyase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69594"
FT                   /db_xref="GOA:B2JCX5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX5"
FT                   /protein_id="ACC69594.1"
FT                   /translation="MRLLHTMLRVGNLDRSIKFYTELLGMKVLRRNDYPEGKFTLAFVG
FT                   YEDEKDGTVIELTHNWDTESYDMGNAFGHLAVEVDDAYAACEKIKQQGGNVVREAGPMK
FT                   HGTTVIAFVTDPDGYKIEFIQKKS"
FT   gene            complement(459747..460604)
FT                   /locus_tag="Bphy_0402"
FT   CDS_pept        complement(459747..460604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0402"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   bxe:Bxe_A4016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69595"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX6"
FT                   /protein_id="ACC69595.1"
FT                   /translation="MQKSSKPQPAAALDSRQLDLPLFDEPGKTAAPPQPKPAAPLAPDG
FT                   SKLRSVTLGARMLHYALKRSSRRSIGFAIDSTGLTITAPRWVTLSDIETAIAEKQRWIF
FT                   TKLAEWQTRTEQRVMPRVDWKDGAEVPYLGHTVRVTLAASNALLAYDGERNVLALPLPA
FT                   QADPQQIKDRVQGWLQGEAKRIFGERLVVYAEKLGVTYRAYALSSAATRWGSCSSDGKI
FT                   RLNWRLIHFPLSVIDYVVAHELAHLREMNHSPRFWQTVESIFPEFREARQTLKHHPPEL
FT                   LPTL"
FT   gene            complement(460664..461422)
FT                   /locus_tag="Bphy_0403"
FT   CDS_pept        complement(460664..461422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0403"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   bxe:Bxe_A4015 putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69596"
FT                   /db_xref="GOA:B2JCX7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JCX7"
FT                   /protein_id="ACC69596.1"
FT                   /translation="MRFIRSLLLLIFFAVFTIPYATACFIAFPFMRADNRYWMAVGWCR
FT                   ATLAVVRKLNGIRYELRGMDNLPNGPAVLLSKHQSAWETLAFPALMPRPLCYVFKRELL
FT                   YVPFFGWALGLLKMIHIDRKEGKNAFASVTRQGARRMSEGAWVIMFPEGTRTPTGKQGK
FT                   YKTGGARFAVATGAVVVPIAHNAGRVWPRNSFTKYPGIVTVSIGKPIDTTGLTPDEVNT
FT                   RVETWIEAEMRRIDPAAYGDEQSTPAAARI"
FT   sig_peptide     complement(461351..461422)
FT                   /locus_tag="Bphy_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.965 at
FT                   residue 24"
FT   gene            complement(461460..462017)
FT                   /locus_tag="Bphy_0404"
FT   CDS_pept        complement(461460..462017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0404"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   bte:BTH_I0583 HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69597"
FT                   /db_xref="GOA:B2JD80"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD80"
FT                   /protein_id="ACC69597.1"
FT                   /translation="MPTAKKLVVLDRDGVINVDSDAFIKSPDEWVALPGSLEAIARLNQ
FT                   AGYRVAIATNQSGIGRGLFDMDALNAMHLKMHRAAAAVGGRIDAVFFCPHTADDHCECR
FT                   KPKPGMLKMIAERFEVDPEETPCVGDSLRDLQAGAALGFIPHLVLTGKGKKTLEAGGLP
FT                   EGTRVHDDLRAFALDFLAEVQE"
FT   gene            complement(462028..464127)
FT                   /locus_tag="Bphy_0405"
FT   CDS_pept        complement(462028..464127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0405"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: bxe:Bxe_A4013 glycyl-tRNA synthetase, beta
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69598"
FT                   /db_xref="GOA:B2JD81"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD81"
FT                   /protein_id="ACC69598.1"
FT                   /translation="MTQSHQATLLVELLTEELPPKALARLGDAFAESIAQRLAARDLIE
FT                   GELQFERYATPRRLAVTLKNVRNVAPEKHVREKVLPVSVALDANGQPTPPLAKKLAALG
FT                   FPDFSVNDLERANDGKAEAFFLRYAAPGATLAEGLQAALDETLAKLPIPKVMTYQRPDG
FT                   SNVQFVRPVHRLTVLHDKEIVPVTAFGIDADDTTLGHRFLSEGFVQIQHADHYAETLVH
FT                   KGKVVPNFADRKEAIRTHLLAQANGDQVVMPESLLDEVTSLVEWPVVYACEFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDANGKLRSRFLIVSNIETKTPGEIVEGNERVVRPRLADAK
FT                   FFFEQDKKRPLADRVPQLANVVYHNKLGSALQRVERVEALAGAIAAMIGADVALAKRGA
FT                   HLSKADLLTDMVGEFPELQGTMGTYYARHDGEPEEVALACSEHYQPRFSGDALPSTATG
FT                   TVVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGVLRILVEKQLPIDLVELLRAAN
FT                   AQFTNVPNVTDSTQAIYEFCIDRLRGQLRERGYSAGEVDAVLALNPTRFDDIVARLEAV
FT                   REFAALAEAASLAAANKRISNILKKSEAASANGVQITLLIEAAEKALHAQLEQVAPRVQ
FT                   SQLAEGEYTGALSALAALREPVDTFFNDVMVNAEDPALRANRLALLGALHQQMNCVADI
FT                   SRLAA"
FT   gene            complement(464143..465150)
FT                   /locus_tag="Bphy_0406"
FT   CDS_pept        complement(464143..465150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0406"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: bxe:Bxe_A4012 glycyl-tRNA synthetase, alpha
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69599"
FT                   /db_xref="GOA:B2JD82"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD82"
FT                   /protein_id="ACC69599.1"
FT                   /translation="MLTFQQIILTLQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAVG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLIWTEWEEQGPNGPEMRRLTYGDVYHQNEVEQSTYNFEHANTDLL
FT                   FTFFNSYESEAKRMIEVPLALPAYELVLKAAHTFNLLDARGAISVTERAAYIGRIRALS
FT                   RLVAQAYYDSREKLGFPMLGNPVHGVPGLTTDEQDAAMPAWAPPLKVERKIDQD"
FT   gene            complement(465377..467071)
FT                   /locus_tag="Bphy_0407"
FT   CDS_pept        complement(465377..467071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0407"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bxe:Bxe_A0625 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69600"
FT                   /db_xref="GOA:B2JD83"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD83"
FT                   /protein_id="ACC69600.1"
FT                   /translation="MADPITTRLRRGVTPDAADANIGRARTLPWWHYLAAAAVGALNTL
FT                   SFAPTPHGGWLELAIFVFFFAWITRTTGWKSAALTGFAFGFGNYVTGVWWLYVSMHFYG
FT                   GMPAPLAGAALVLFSLYLAVYPALAAGAWSFCAGHARNGKLVDDAPFSPTWHGAFAFAS
FT                   AWAVGEWLRGTVFTGFPWLASGYAQVDGPFAGFAPVAGVYGVGWVMALAAALIAQAVFR
FT                   ARAPKNSAADAAPRCAGIAMPAVAAIALIAAGLLLPLVSWTTPANASLTVRLLQGNVKQ
FT                   DMKFEASGVKEAIDEYQRMITEKPADLIVTPETAIPVLAQAIPEPFALAVRKFADSTHS
FT                   SILFGAIGGKITPEGRVVDYTNSLFGVTPEQMGVYRYDKHHLVPFGEFVPWGFRWFVNL
FT                   MDIPLGDFARGAPVQKPFFVHNQPIAVDICYEDIFGEEIARTVRESDSPAGVLVNSTNL
FT                   AWFGNTIALDQHLQIARMRSLETGRPMLRATNTGATAAIDAHGNVIARMPAFTAGSIEA
FT                   TIQGTTGNTPYVTSGNNTVLAIALLFLAFGFAFGPGRARKNKNNGNA"
FT   gene            complement(467108..468004)
FT                   /locus_tag="Bphy_0408"
FT   CDS_pept        complement(467108..468004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0408"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: bxe:Bxe_A0626 putative
FT                   Mg2+ and Co2+ transporter, CorC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69601"
FT                   /db_xref="GOA:B2JD84"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD84"
FT                   /protein_id="ACC69601.1"
FT                   /translation="MNDSYPSRRHTSDKPQEKRSLLERLTDFISPEPDSRGELLEILQD
FT                   AHERNLIDADSLSMIEGVFQVSELCARDIMIPRAQMDAINIADSPDEFIPYMLEKAHSR
FT                   YPVYEGNRDNVIGVLLAKDLLRYYAEDEADVRGMLRPAVFIPESKRLNVLLHDFRVNRN
FT                   HLAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDEESGNIIASPDGRYRVRALTEIE
FT                   QFNEEFGTHYSDEEVDTIGGLVTHHFGRVPHRGEKVRLDDLIFEVLRADARQIHMLLVR
FT                   RDPLAGQRERDAQHVQT"
FT   gene            complement(468147..468806)
FT                   /locus_tag="Bphy_0409"
FT   CDS_pept        complement(468147..468806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0409"
FT                   /product="ChaC family protein"
FT                   /note="PFAM: ChaC family protein; KEGG: bxe:Bxe_A0627
FT                   putative ChaC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69602"
FT                   /db_xref="GOA:B2JD85"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD85"
FT                   /protein_id="ACC69602.1"
FT                   /translation="MSQPVSTPPSPLSPCPGYPPSLGESRLLTDDELRASLDGSLQDWD
FT                   RKRDLWLFGYGSLIWNPGLPTVEALRSRVHGYHRGLYLWSRVNRGTPEQPGLVLALDRG
FT                   GSCSGIAFRLAAEGAMPHLEALWRREMAMGSYRPAWLPCVLADGRRVDALAFVMRRDVA
FT                   SYTGKLSDDVVKAVLGCASGRYGTTLDYVSRTVAALRESGMPDRALEALLSRCGCG"
FT   gene            complement(468892..469353)
FT                   /locus_tag="Bphy_0410"
FT   CDS_pept        complement(468892..469353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0410"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   bxe:Bxe_A0628 protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69603"
FT                   /db_xref="GOA:B2JD86"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JD86"
FT                   /protein_id="ACC69603.1"
FT                   /translation="MSRAPKLSLNLQFPAGKAWPEHKSLLPKATVAAWIKAALFADAEL
FT                   TVRFVDADEGRTLNRTYRGKDYATNVLTFAYAESEDDPVTGDLILCCPVVEKEANEQGK
FT                   PLGAHYAHLLVHGTLHAQGYDHEDEDEAEEMEAIETEVLGKLGFPDPYE"
FT   gene            complement(469384..470472)
FT                   /locus_tag="Bphy_0411"
FT   CDS_pept        complement(469384..470472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0411"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: bxe:Bxe_A0629
FT                   putative PhoH-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69604"
FT                   /db_xref="GOA:B2JD87"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD87"
FT                   /protein_id="ACC69604.1"
FT                   /translation="MKTTQQHLEFTAPREDNARLANLCGPLDENLRQIEQALDVTLQRR
FT                   GHRISIRGRGAKVALTALENFYNSARDPLSVDDIQLALVEARHPANHGRPNGGNGDTEE
FT                   LDPLFRGDPDHPFDEPAHEGADDVEELGPKLYTRRADLRGRTPAQREYLKQIVSHDVTF
FT                   GIGPAGTGKTYLAVACAVDALERDQVKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRP
FT                   LYDALYDLLGFDKTAKMFERQMIEIAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLT
FT                   RIGFGSKAVVTGDTTQIDLPRGNKSGLIEAQHVLANVRGIALTRFTSADVVRHPLVARI
FT                   VEAYDAHSKKEAEPSESSATAK"
FT   gene            complement(470505..471875)
FT                   /locus_tag="Bphy_0412"
FT   CDS_pept        complement(470505..471875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0412"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bxe:Bxe_A0630 tRNA-i(6)A37 modification enzyme
FT                   MiaB; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69605"
FT                   /db_xref="GOA:B2JD88"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JD88"
FT                   /protein_id="ACC69605.1"
FT                   /translation="MTKKVYVKTFGCQMNEYDSDKMVDVLGAAEGLVKTDTPEDADVIL
FT                   FNTCSVREKAQEKVFSDLGRVRELKEANPNLLIGVGGCVASQEGASIVARAPYVDLVFG
FT                   PQTLHRLPQMIDQRRASGRPQVDITFPEIEKFDHLPPARIDGPSAFVSIMEGCSKYCSY
FT                   CVVPYTRGEEVSRPLDDVLTEIAGLADQGVREVTLLGQNVNAYRGAMTLGATEIADFAT
FT                   LIEYVADIPGIERIRYTTSHPKEFTQRLIDTYAKVPKLVSHLHLPVQHGSDRILMAMKR
FT                   GYTVLEYKSVIRKLRAIRPDLSLSTDMIVGFPGETEEDFDKMMQLVHDMSYDTSFSFIY
FT                   SPRPGTPAANLQDDTPREVKLRRLQHLQATIEENVQRISQAMVGKVERILVERPARKDP
FT                   NELAGRTENNRVVNFPAPVETHARLIGQMIDVKIVHAYPHSLRGELVMVHDTAPATH"
FT   gene            complement(472090..473115)
FT                   /locus_tag="Bphy_0413"
FT   CDS_pept        complement(472090..473115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0413"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A0631 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69606"
FT                   /db_xref="GOA:B2JD89"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD89"
FT                   /protein_id="ACC69606.1"
FT                   /translation="MTDNLGDIRLFVEAAQLGSLSAAGRKLGLTPAAASARLAKLEGGL
FT                   KARLFERTTRQLRLTDEGRVYLSCCQQALRALDDAEAALQEGQNAVRGKVRISATSDFG
FT                   RNLLMHWLDEFNALYPDVTFALTLSDSLQNLVQEDIDLAIRFGVPQDSSLVARWLAPNP
FT                   RVLCASPEYIARHGEPKDPLDLARFDCIVLGTASGPVNEWRFTRGDETVTYTIALESAR
FT                   ETNDGAVAREWALRGYGIVIKSMWDVEADLKSDGLRVLLPDWRYPDAPLHALYHRNRFM
FT                   APRVRVLLDFLAERFARVTGELERQLGLPQLPGGAGGSPQGAQKPSVRARKRHAYREPD
FT                   A"
FT   gene            473226..473621
FT                   /locus_tag="Bphy_0414"
FT   CDS_pept        473226..473621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69607"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD90"
FT                   /protein_id="ACC69607.1"
FT                   /translation="MHLDHATIVTPDLDATRRFFVDVAGLTEGARPPFGVGGYWLYADG
FT                   RPVIHLVDSTLPSQTGRTSPRIDHIAFRIDDAQAWHALLARLETAGVVYQSADVPLSGE
FT                   VQLFVALASSVVVEFVTAARNAARASF"
FT   gene            473642..474820
FT                   /locus_tag="Bphy_0415"
FT   CDS_pept        473642..474820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0415"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A0633 major facilitator family (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69608"
FT                   /db_xref="GOA:B2JD91"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD91"
FT                   /protein_id="ACC69608.1"
FT                   /translation="MPIPLLALAISAFAIGTTEFVIMGLLPEVAKDLAVSLPSAGLLVS
FT                   GYALGVAVGAPLLAVVTSRMPRKLALQLLMGVFIVGNLLCAIASDYSVLMIARVVTSFA
FT                   HGSFFGIGAVVAASLVPQEKRASAIALMFTGLTLANVLGVPFGTFIGQQFGWRVAFWIV
FT                   AAFGVMSLAGVTALVPNRHDTGPAGLGHEVRVLKEPQVWLALTMTVLGFGGVFVVFTYI
FT                   APILEQVGGFTPHGVTLILVLFGVGLTVGNTVGGKLADRSLMPSLMGILIALAVVMAVF
FT                   AHTSHSQVAAAVTVFIWGIAAFATVPPLQMRVVEKAKAAPNLASTLNIGAFNVGNAGGA
FT                   WLGGLAISHGYGLDALPYVAAVVALAALGLTWIAARLDAPAAIATRKMRERV"
FT   gene            475072..475761
FT                   /locus_tag="Bphy_0416"
FT   CDS_pept        475072..475761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0416"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: bxe:Bxe_A0634
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69609"
FT                   /db_xref="GOA:B2JD92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD92"
FT                   /protein_id="ACC69609.1"
FT                   /translation="MQSPLALVRDRAPEGHDAAHAPDEPRTSEFDALEHRVGVNLARLR
FT                   AERQLSLDALARASGVSRAMLAQIESARSVPSIKVLCKVAAALKVSVAAFLRRHAVNGF
FT                   EHLPADRSARVVTSNGRYWTRALHPDGEPSTAEFHELRIAPLHTEPGTQRAPGTTVNLV
FT                   VSVGTIEVSVHDRRQLLATGDSIVFDADQPHSLRNPGDTEARAFRVTVNAETPPRWDVP
FT                   HDAHTEG"
FT   misc_binding    475837..476009
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 104.33"
FT   gene            476228..476962
FT                   /locus_tag="Bphy_0417"
FT   CDS_pept        476228..476962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0417"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: bxe:Bxe_A0635 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69610"
FT                   /db_xref="GOA:B2JD93"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD93"
FT                   /protein_id="ACC69610.1"
FT                   /translation="MSVVSHSAAFAWPAPSVVAEDAVADLPLLATEPVPPRVAAALHAL
FT                   RAGRAVVLQDDHDRENEADLIMSAERMSVEMMALFIRECSGIVCLCLTDEKVRALELPP
FT                   MTAHNESRNTTAFTVSIEAREGVSTGVSAADRLTTIRAAIADDAKPADIVRPGHVYPLR
FT                   AMPGGVLARRGHTEGTVDLVTLAGLKPAGVLCELMNADGTMMRGADVEAFAARHDMPML
FT                   TIAELVEFRRSLALAREACVEV"
FT   sig_peptide     476228..476287
FT                   /locus_tag="Bphy_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.750 at
FT                   residue 20"
FT   gene            complement(477083..477769)
FT                   /locus_tag="Bphy_0418"
FT   CDS_pept        complement(477083..477769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0418"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_A0636 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69611"
FT                   /db_xref="GOA:B2JD94"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD94"
FT                   /protein_id="ACC69611.1"
FT                   /translation="MIDHLICDCDGVLVDSEVIADRVMHDTLAATFPTLDFHEICKTAF
FT                   GQQTSRFLKSVETAFDIELPANFLQTVEANVEAELASSLSAISGVRDALQRVPLPAAVV
FT                   SNSRMTRVSASVRRAGLAEIFGPRVFSAEQVARPKPYPDVYLFAAQQLGVEPSRCVVVE
FT                   DSVSGLNAARAAGMMTIAFVGASHIPDGYADVLRSMGTTRIMKHMDELPAFVEAGMRGE
FT                   FRDVQS"
FT   gene            complement(477898..479397)
FT                   /locus_tag="Bphy_0419"
FT   CDS_pept        complement(477898..479397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0419"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bxe:Bxe_A0638 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69612"
FT                   /db_xref="GOA:B2JD95"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JD95"
FT                   /protein_id="ACC69612.1"
FT                   /translation="MQDQYILALDQGTTSSRAMLFDRNGNVVSVAQKEFRQIYPHPGWV
FT                   EHDPLEIWATQAGVAAEAVTHAGLNGTSIAAIGITNQRETTIVWDRQTGHPIYNAIVWQ
FT                   DRRTADFCDQLKAQGLEDEVRAKTGLPVDSYFSATKIRWILDNVEGAREKAKQGKLAFG
FT                   TVDSWLVWNFTKHELHITDVTNASRTMLFNIHTLQWDDALLDALDIPRSMLPEVRPSSE
FT                   VYGPTKTTVFASKIPLAGIAGDQHAALFGQMCTRSGMVKNTYGTGCFLVMNTGTKPIES
FT                   KNNLVTTIAWQIGDQINYALEGSIFIAGAVVQWLRDGLGIIRSASEVETLARGVEHCDG
FT                   VYLVPAFAGLGAPHWNARARGTLFGVTRGTTSAHIARAALDSIAYQSMDVLKAMEADSG
FT                   IHINELRVDGGACANNLLMQFQADILGVDAVRPQVSETTALGAAYLAGLATGYWKDIEE
FT                   LQNQWKLEHRFSPSLPADQAKACLDGWQRAIRAAKAWADAP"
FT   gene            complement(479566..481101)
FT                   /locus_tag="Bphy_0420"
FT   CDS_pept        complement(479566..481101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0420"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_A0639 putative glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69613"
FT                   /db_xref="GOA:B2JD96"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD96"
FT                   /protein_id="ACC69613.1"
FT                   /translation="MTQDSIYDLLVVGGGINGAGIARDAAGRSLSVLLCEQDDLAAHTS
FT                   SASTKLIHGGLRYLEYREFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPDLRPAWLI
FT                   RAGLFLYDHLARRELLPGSHGIDMRKHPAGQPLVDSIKRGFVYSDGWVDDARLVVLNAL
FT                   DAHEHGATILTRTKLVGAARANGEWHAQLLRADGSVTTVRARSIANAAGPWVGELLRGP
FT                   LSRGQETNYSVRLVKGSHIVVRRLFEHDHAYIFQNPDKRIIFAIPYERDFTLIGTTDLE
FT                   YKGDPSQVAIDASETQYLCDSINRYFRQHIAPRDVYWTYSGVRPLLEDENADNPSAVTR
FT                   DYRLELDAPAGEAPLLSVFGGKITTFRKLAEEAVDDLARALRHDKRAWTAGVPLPGGDI
FT                   ARADFERFAAQFAQHHTWLPATLARRYARAYGTRAERVIGDARSLADLGQQFAPGLYEA
FT                   ELRYLRETEWATTARDVLWRRSKLGLHVEPGALDSVTREIDAWLARETSKQHA"
FT   gene            481314..481703
FT                   /locus_tag="Bphy_0421"
FT   CDS_pept        481314..481703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69614"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD97"
FT                   /protein_id="ACC69614.1"
FT                   /translation="MRRLRMAGAAAFAVATTLTGCVSTPSLNGTMGAPSFPDLQAMCGS
FT                   QPADYGSDAQSVYVTLFDAYVASKRGGLSKADYCAFQTALAQRYAAQGTSTDPELRRQW
FT                   VEFFNAQRVKAMSWRAAVDPTLRAG"
FT   sig_peptide     481314..481400
FT                   /locus_tag="Bphy_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.637 at
FT                   residue 29"
FT   gene            complement(481900..482097)
FT                   /locus_tag="Bphy_0422"
FT   CDS_pept        complement(481900..482097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69615"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD98"
FT                   /protein_id="ACC69615.1"
FT                   /translation="MLSPHEFATLLLVKDAPNQVDMEREELDALLERQLVELEKLASGL
FT                   QQWRITESGDTALRAIKRFS"
FT   gene            complement(482491..483270)
FT                   /locus_tag="Bphy_0423"
FT   CDS_pept        complement(482491..483270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0423"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bxe:Bxe_A0643 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69616"
FT                   /db_xref="GOA:B2JD99"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JD99"
FT                   /protein_id="ACC69616.1"
FT                   /translation="MTRDPRLTLNARQQELLEWVQRDGFVTVDDLAAHFDVTPQTIRRD
FT                   VNWLADMNLLRRYHGGASLPTSSENVSYSARQRMFHDEKRRIAALVATHIPDQASLFIN
FT                   LGTTTEEVARALNRHRGLRVITNNLNVASMMSGYPDCEVLVTGGIVRPWDKGIVGELAI
FT                   DFIRQFKVDFAIIGTSSIETDGTLRDFDTREVRVAEAIIEHSRTVFLAADHSKFGRPAL
FT                   VRQGHLSQIDSLFTDAPPPPDMAETLATSGTQVYIAG"
FT   gene            483689..484516
FT                   /locus_tag="Bphy_0424"
FT   CDS_pept        483689..484516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69617"
FT                   /db_xref="GOA:B2JDA0"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA0"
FT                   /protein_id="ACC69617.1"
FT                   /translation="MHNEAGHVMPWRIEDIDLNRVDRQRAAANEDLLLLLCASSFIESG
FT                   TDLYTSNLSKFFNGDPEVSAWLNNEWEPEEMQHGRALKAYIAHVWPEFDWDTAFRNFFE
FT                   EYSKTCSVEDFEKTRALEMVARCVVETGTATLYRAIGVCSDEPVLKEITDNIRTDEVRH
FT                   YKHFFKYFKKYNKIEGNGRLAVLGALMRRVMEIKNEDSEIALRHVFAVRYPERVNDPAY
FT                   NRDKAARVNRLVRHNLSADMCVKMLLKPLELPAKIQPGVHYPLAKITQHVFFR"
FT   gene            484555..485079
FT                   /locus_tag="Bphy_0425"
FT   CDS_pept        484555..485079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69618"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA1"
FT                   /protein_id="ACC69618.1"
FT                   /translation="MTASTDHNRALDQQVFDEWPVELRALFDGSALESKVGFTASLLTV
FT                   DERSAHVRTSLLGIGELYAPDSRTLSAALWPQSRAARAITQSGRAALTFVFDGTFYQVQ
FT                   LALVPLNADAGGLACFSGTIDSGEAQRVRYARLTAGITFDLTEGRDAVLERWAQQIEHL
FT                   KRAAGTAANGT"
FT   gene            complement(485125..486693)
FT                   /locus_tag="Bphy_0426"
FT   CDS_pept        complement(485125..486693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0426"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   bxe:Bxe_A0648 putative ATP-dependent RNA helicase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69619"
FT                   /db_xref="GOA:B2JDA2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA2"
FT                   /protein_id="ACC69619.1"
FT                   /translation="MSFDSLGLSEPLVRAVNELGYTSPTPIQQQAIPAVLNGGDLLAGA
FT                   QTGTGKTAGFTLPILQRLLTMPPAPGGKRVVRALILTPTRELAAQVEESVRAYGKYLKL
FT                   KSTVMFGGVGINPQIDALRRGVDIVVATPGRLLDHMQQKTIDLSHLEILVLDEADRMLD
FT                   MGFIHDIKRVLAKLPPKRQNLLFSATFSDEIKALADSLLDAPALIEVARRNTTAETVAQ
FT                   KIHPVDRDRKRELLTHLIKQHNWFQVLVFTRTKHGANRLAEQLTKDGISALAIHGNKSQ
FT                   SARTRALAEFKNNTLQVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGRTGRAG
FT                   ATGEAVSLVCVDELQLLKDIEKLIKRAVPQEVIAGYEPDPNARPEPIQRRGQGGGGRQP
FT                   RQGQGQGQGQGQRQPQGQRQAQGQQKREGSAGANNGASRGGHRTSGDKPNDKPKQHAKP
FT                   QGQKPAHARNDAPRHQDKPRASAHEGSAHTPHAAHAPRKPRNANPGALLGGKPRSDAPR
FT                   GQRGN"
FT   gene            complement(486890..487510)
FT                   /locus_tag="Bphy_0427"
FT   CDS_pept        complement(486890..487510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0427"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein; KEGG: bxe:Bxe_A0649 putative
FT                   hemolysin HylII"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69620"
FT                   /db_xref="GOA:B2JDA3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA3"
FT                   /protein_id="ACC69620.1"
FT                   /translation="MHVGERLNSITHLVGAVLSVAGLATLVTMGALDGDAYKVVSFSVY
FT                   GAMLCALYGISTLYHSVRRPGLKAILQKCDHSAIYLLIAGSYTPFTLVTLRGPWGWSLF
FT                   GVSWGLAALGIMQELTLGRRTRSVSMVLYVLMGWLALVAIRPLVTALPTAGTAWLLAGG
FT                   IIYSAGIYFFINDERIRHGHGIWHLFVLAGSLCQFVSVARYVA"
FT   gene            complement(487684..488982)
FT                   /locus_tag="Bphy_0428"
FT   CDS_pept        complement(487684..488982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0428"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_A0650
FT                   putative periplasmic cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69621"
FT                   /db_xref="GOA:B2JDA4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA4"
FT                   /protein_id="ACC69621.1"
FT                   /translation="MKRKSLFALSAVVVVAAAALVPVLWSGSDYLHNGTAVAATPADQA
FT                   ALIKKGEYLARAGDCIACHTVRGGKEFSGGLPMATPFGTLFTPNITPDDQYGIGKWSQD
FT                   DFYRAMHTGRSKDGSLLYPAFPFTSYTKVSRADSDAIYAYLRSVPPVAVPSRPHELKFP
FT                   FNNRNLLIGWRTLFFREGEYKPDPTKSVEWNRGAYLIEGLGHCGMCHTSINAMGGPVNS
FT                   AAFAGGLIPLQNWYAPSLTSNKEAGLGDWDIKDISDLLKNGVSQRGAVFGPMAEVVHNS
FT                   LQYMTDEDVRAMSTYLKTIPQKSEAPEHLQLETSEQFGGELLKQGQKIYADNCAKCHAD
FT                   NGLGMPPSFPPLANNQSIQMPSAVNPIRMVLNGGYPPSTGGNPKPYGMPPFAQALSNQE
FT                   VAAVVTYIRQSWGNHGTAVSPQQVSDLRSAPLD"
FT   sig_peptide     complement(488926..488982)
FT                   /locus_tag="Bphy_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.342 at
FT                   residue 19"
FT   gene            complement(489003..489722)
FT                   /locus_tag="Bphy_0429"
FT   CDS_pept        complement(489003..489722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0429"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_A0651
FT                   putative periplasmic cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69622"
FT                   /db_xref="GOA:B2JDA5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA5"
FT                   /protein_id="ACC69622.1"
FT                   /translation="MSSRRIFRPLLALLLIGCTGVSSAVQAQTQPKAPDTMEARVQGCT
FT                   ACHGSKGQGTDNDYFPRLAGKPAEYLFNQLQNFREGRRKYPPMNYLVTYLSDDYLHDIA
FT                   TYFSQQRPPYPTPTKPTVSDSTLAKGKEIVLNGDASRQIPACAACHGKGLTGMEPAIPG
FT                   LVGLHMDYISAQLGAWRSGSRHAIEPDCMHTIATRLTDADVNAVAAWLSTQQAPQNPVP
FT                   APAKSLKTPLACGSEPQ"
FT   sig_peptide     complement(489639..489722)
FT                   /locus_tag="Bphy_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            490109..490591
FT                   /locus_tag="Bphy_0430"
FT   CDS_pept        490109..490591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0430"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bma:BMA1963 copper resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69623"
FT                   /db_xref="GOA:B2JDA6"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA6"
FT                   /protein_id="ACC69623.1"
FT                   /translation="MATASWPMKVVELTELRDIEAYYPVHPCVFHPGQPMTLSLSLNMP
FT                   LRWLAACGVSLAIASNAFAHATPTSRDPAPNAEVAAPSAVTLHFSEPLEPAFSKIVLVD
FT                   ASGRPAASAASQVDAQDKKTMSLTLQSLAPGRYTVQWAAVAEDGHRTKGSYGFSVK"
FT   gene            490588..491517
FT                   /locus_tag="Bphy_0431"
FT   CDS_pept        490588..491517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0431"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bxe:Bxe_A0653 putative copper-resistance transporter, CopD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69624"
FT                   /db_xref="GOA:B2JDA7"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA7"
FT                   /protein_id="ACC69624.1"
FT                   /translation="MKVDGLWIGQVAMAVLMNVAFAFAVGSALLGAWLANDAQARIAPA
FT                   RPAWLRAQRSMQASAIVLVLADLGWLLYQAAEMAGVRLPEAFGVVPTMLSQTHVGFGWS
FT                   VAFAGALVLVLVSFARQTNVLRNALLWLAVIAIAGGKAALGHAADAGVASAAIGMHTVH
FT                   VLTTSVWGGLVLAAGLSVLPALGTSIARGVLIRTATQLSNVSLVAVVFVLLSGVFNAAR
FT                   GAGNSFLAIETSTWGHVLLLKLALVALALVLGGLNRFQALPRLRRTASTMDAHTFSNLL
FT                   YLEALAMLGVFAAAAVLSHSVPGFAALG"
FT   sig_peptide     490588..490656
FT                   /locus_tag="Bphy_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.368 at
FT                   residue 23"
FT   gene            complement(491555..491857)
FT                   /locus_tag="Bphy_0432"
FT   CDS_pept        complement(491555..491857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69625"
FT                   /db_xref="GOA:B2JDA8"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA8"
FT                   /protein_id="ACC69625.1"
FT                   /translation="MGEFLPDYLIREQAAVDALIVFGVLRAIGAVLAYRRGWHMATIER
FT                   CFIGAALLYCLPQLFDLLTHMTSTHAAAAELEGKLGGCAIVLVLAPVVRHKLGYE"
FT   gene            complement(492157..493305)
FT                   /locus_tag="Bphy_0433"
FT   CDS_pept        complement(492157..493305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0433"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_A0656 putative galactonate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69626"
FT                   /db_xref="GOA:B2JDA9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDA9"
FT                   /protein_id="ACC69626.1"
FT                   /translation="MKITKIETFIVPPRWCFVKIETDEGIVGWGEPVVEGRAHTVAAAV
FT                   DELSDYLLGKDPRNIEDHWQVMYRAGFYRGGPISMSAIAGVDQALWDIKGKFHGVPVHT
FT                   LLGGQVRDRIKVYSWIGGDRPGDVANNARAVVERGFKAVKMNGSEELQIIDTFDKVQGV
FT                   INNVSAVREAVGPNVGIGVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENAEALRD
FT                   IVNQTSTPIALGERLYSRWDFKHILAGGYVDIIQPDASHAGGITECRKIASMAEAYDVA
FT                   LALHCPLGPIALATCLQIDAVSYNAFIQEQSLGIHYNQGNDLLDYIKNPEVFKYEDGFV
FT                   SIPQGPGLGIEVNEEKVREMAKVGHRWRNPVWRHADGSVAEW"
FT   gene            493390..494253
FT                   /locus_tag="Bphy_0434"
FT   CDS_pept        493390..494253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0434"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_A0657 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69627"
FT                   /db_xref="GOA:B2JDB0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB0"
FT                   /protein_id="ACC69627.1"
FT                   /translation="MRPSRNDILHQNRRKILLIVLFGAWISRRRWVSRPQSPIIAGDPR
FT                   RRSGGIGQISNSFGRTDIQRDLHGRVAWLLGTAILRGDYAPESVLPREAELMETFGVSR
FT                   TVLREALRTLTSKGLIESRPRVGTRVRPKHAWNLLDADMLDWYSRVAPALDFALKLQEM
FT                   REMIEPYAAALAAASHSDATFGALDAAHSAMVAARNVDEWVRADLQFHLSVLAACSNEL
FT                   LVPLGTLIERTLEAQLRLNAKRAEVFNASLAEHTAVFEAIRDRDAPRARHAMASLLGVT
FT                   RGRIEG"
FT   gene            complement(494266..494960)
FT                   /pseudo
FT                   /locus_tag="Bphy_0435"
FT   gene            495065..495376
FT                   /locus_tag="Bphy_0436"
FT   CDS_pept        495065..495376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0436"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_A0659
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69628"
FT                   /db_xref="GOA:B2JDB1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB1"
FT                   /protein_id="ACC69628.1"
FT                   /translation="MSFYGDINQARLADLLEVAPISAGRRLDRMEEGGWIERIGNPRDR
FT                   REKQIRMTDKAEKTLDKAKRVGDQVAAEGLSGLTEDEAKQIISLLRKVRGNLTRIVDR"
FT   gene            complement(495500..495576)
FT                   /locus_tag="Bphy_R0025"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(495500..495576)
FT                   /locus_tag="Bphy_R0025"
FT                   /product="tRNA-Met"
FT   gene            complement(495664..497322)
FT                   /locus_tag="Bphy_0437"
FT   CDS_pept        complement(495664..497322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0437"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_A0668 major
FT                   facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69629"
FT                   /db_xref="GOA:B2JDB2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB2"
FT                   /protein_id="ACC69629.1"
FT                   /translation="MATVSGQISHAPMTKEEKRVIFASSLGTVFEWYDFYLAGSLAAFI
FT                   SKSFFSGVNPTAAFIFTLLGFAAGFAVRPFGALVFGRLGDMVGRKYTFLITIVIMGLST
FT                   CVVGFLPGYAAIGMASPVIFIAMRLLQGLALGGEYGGAATYVAEHAPANRRGFYTAWIQ
FT                   TTATLGLFLSLLVILGVRTAMGEDAFGTWGWRIPFIASLVLLGISVWIRLQLHESPAFE
FT                   RIKAEGKTSKAPLSEAFGQWKNLKIVILALIGVTAGQAVVWYTGQFYALFFLTQTLKVD
FT                   GASANILIAIALLIGTPFFLFFGSLSDRIGRKPIILAGCLIAALTYFPLFKALTHYANP
FT                   ALEAATAKAPIVVIANPTECSFQFNPVGTSKFTTSCDIAKSALSKAGLNYDNVAAPAGT
FT                   LAQIKVGDTTIDTFDGKAADAKEAGKTFDKNLSTALKSAGYPPKADPSQINWPMTVVIL
FT                   TILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPATAFAIVAAKGN
FT                   IYSGLWYPIIIALGTFVIGLLFVRETKDSNIYAQD"
FT   gene            complement(497550..499097)
FT                   /locus_tag="Bphy_0438"
FT   CDS_pept        complement(497550..499097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0438"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: bxe:Bxe_A0669 signal transduction histidine
FT                   kinases (STHK)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69630"
FT                   /db_xref="GOA:B2JDB3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB3"
FT                   /protein_id="ACC69630.1"
FT                   /translation="MSVSAPRATAHAADLDEVRDARYANPFAPPDETEAQAETRPRSLF
FT                   GEILDWMLAPLLLLWPMSLAVTYLVAKSIANGPFDRALETDAYVLARQIQPVNGVAELT
FT                   LPESTRDFLRADNIDSVFYQVLGARGELVAGDRDMPLPREDDRPQPGIVEFRDDMLRGN
FT                   DIRVAYTTVEFPQTPGAQPVLVQVAETLDKRSALANDIIKGVILPQFVILPLAILLVWF
FT                   GLSRGLAPLHALQAHIRARRPDDLSPLEARRAPPEIEPLVTSFNDLLTRLEQNMELQKR
FT                   FIADAAHQMKTPLAGLRTQAELALRQDASAEVHRSLEQIATSSEHAARLVTQLLALARA
FT                   ENRMTGQIFTPVEMGEVARSAVRDWVQAALAKQMDLGYEGPETSQESVEVEGNAVMLRE
FT                   MLSNLIDNAIRYTPVGGRITVRVRRDVAARLVHVEVEDTGMGIPAAERERVVERFYRIL
FT                   GREGDGSGLGLAIVREIATMHGGTLTIEDNVYQASPRLAGTLVRVSLRTIDRARDLP"
FT   gene            complement(499106..499867)
FT                   /locus_tag="Bphy_0439"
FT   CDS_pept        complement(499106..499867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0439"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_A0670 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69631"
FT                   /db_xref="GOA:B2JDB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB4"
FT                   /protein_id="ACC69631.1"
FT                   /translation="MRILIAEDDSILADGLVRSLRQSAYAVDHVKTGAEADTALSMQTF
FT                   DLLILDLGLPKMSGLEVLRRLRARNSNLPVLILTAADSVDERVKGLDLGADDYMAKPFA
FT                   LNELEARVRALTRRGAGGGPTVVKHGSLSFDQVGRIAYANDQVIDLSARELGLLEVLLQ
FT                   RIGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEPSGVRIITVRGLGYCLEKAA
FT                   PAQNAAQAAPQTTGAEPSDPSAAMPASHHFK"
FT   gene            500114..501190
FT                   /locus_tag="Bphy_0440"
FT   CDS_pept        500114..501190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0440"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: bxe:Bxe_A0671 RecA DNA recombination protein;
FT                   TIGRFAM: recA protein; PFAM: RecA domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69632"
FT                   /db_xref="GOA:B2JDB5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB5"
FT                   /protein_id="ACC69632.1"
FT                   /translation="MEESKKGSAGLTAEKSKALAAALAQIEKQFGKGSVMRLGQGEAVE
FT                   DIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTAAFID
FT                   AEHALDIQYAQKLGVNVSDLLVSQPDTGEQALEIADALVRSGSIDMIVIDSVAALVPKA
FT                   EIEGEMGDSLPGLQARLMSQALRKLTGTIKRTNCLVIFINQIRMKIGVMFGNPETTTGG
FT                   NALKFYASVRLDIRRIGSIKKNDEVIGNETRVKVVKNKVSPPFREAIFDILYGEGISRQ
FT                   GEIIDLGVQAKIVDKAGAWYSYNGERIGQGKDNAREFLRENADIAREIENRIRESLGVN
FT                   AMPANAVVDADEEVGEAE"
FT   gene            501198..501986
FT                   /locus_tag="Bphy_0441"
FT   CDS_pept        501198..501986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0441"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: bxe:Bxe_A0672
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69633"
FT                   /db_xref="GOA:B2JDB6"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB6"
FT                   /protein_id="ACC69633.1"
FT                   /translation="MIRKGRSASPNAGAGRKTGGPRDDDAIESSSRSSSISASPASPSF
FT                   GSLTEDFDPFETFDAHDRAAGVGPSSRGRSSNDDRVDNGEATYTRSRRADGETRSDDTA
FT                   DKKRASQRPARSLKGRALGYLSRREYSRAELSRKLAPYAEEGDSIDALLDSLENEGWLS
FT                   NSRFAESLLHRRASRMGAGRIVNELKRHAVGQELVEEVSAQLRETELARAQAVWRKKFG
FT                   SLPETPNERAKQARFLATRGFSQGIIGKILKGIDEDFASE"
FT   gene            502157..502894
FT                   /locus_tag="Bphy_0442"
FT   CDS_pept        502157..502894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69634"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB7"
FT                   /protein_id="ACC69634.1"
FT                   /translation="MPLSPPVSRQLRHRRAIQADAYEREDGLWDIEACLTDEKPRDVKL
FT                   ASGVRPNGLPIHELWLRITIDRKLNVVDAEASSDWVPYPGLCEASNPAYRVLIGLNLFQ
FT                   NFRRDAARLLAGTAGCTHLTELCAILPTAAIQAFAGDVWNTDKGRPGSGEPNGSANAAG
FT                   EGTQGSNGQDAKDNASCAQAGEQASEQSNDKPPFQLGRCHALRFDGEAVRQFYPRWYGH
FT                   APRSADRADAAADGQTVKTARPE"
FT   gene            502950..504119
FT                   /locus_tag="Bphy_0443"
FT   CDS_pept        502950..504119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0443"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: bxe:Bxe_A0674 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69635"
FT                   /db_xref="GOA:B2JDB8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB8"
FT                   /protein_id="ACC69635.1"
FT                   /translation="MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADI
FT                   KKELYVGLVIDRVSQKVVVMASSEGGMDIEEVAAKTPEAIHKVAVDPSKGLLDAEADDL
FT                   AKKIGVPDASIPQARTILQGLYKATWETDASLAEINPLILTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPNLTAILVNIFGGIMRCDVIAEGVIAASKAVD
FT                   LQVPLVVRMKGTNEDLGKKMLADSGLPIISADSMEEAAQKVVAAAAGKA"
FT   gene            504234..505115
FT                   /locus_tag="Bphy_0444"
FT   CDS_pept        504234..505115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0444"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: bte:BTH_I0647 succinyl-CoA
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69636"
FT                   /db_xref="GOA:B2JDB9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDB9"
FT                   /protein_id="ACC69636.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPK
FT                   KAGEDFEGIPIYASVKEAKAETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIP
FT                   VRDMIEVKDRMRREGRKTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLT
FT                   YEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPDTDAVIMIGEIGGPDEAN
FT                   AAYWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTADAKLEIMDACGIKVTKN
FT                   PSEMARLLKSVL"
FT   gene            505276..505989
FT                   /locus_tag="Bphy_0445"
FT   CDS_pept        505276..505989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0445"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bxe:Bxe_A0676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69637"
FT                   /db_xref="GOA:B2JDC0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC0"
FT                   /protein_id="ACC69637.1"
FT                   /translation="MLEFLTTLHWGAVFQIIVIDILLGGDNAVVIALACRNLPPAQRTK
FT                   GVLWGTLGAIALRVALIAFAVALLDVPLLKFAGGLLLIWIGVRLLAPAPDAHANVKPAD
FT                   KLVTAIKTIIVADAVMSLDNVIAIAGAAESAEPHHRIALVVFGLIVSIPLIVWGSQLVL
FT                   KLLDRFPAIVTFGGALLGWIAGGLIINDPAGDRWPILDTPVAEYGMSIVCALFVVIVGY
FT                   ALKRRNAARVAGDSH"
FT   gene            506140..506757
FT                   /locus_tag="Bphy_0446"
FT   CDS_pept        506140..506757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0446"
FT                   /product="putative type IV fimbrial pilin protein"
FT                   /note="KEGG: bxe:Bxe_A0677 putative type IV fimbrial pilin
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69638"
FT                   /db_xref="GOA:B2JDC1"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC1"
FT                   /protein_id="ACC69638.1"
FT                   /translation="MIATVAVASLSTLYAHRPGIRAPRVWPAALARIRRLWGFTLIELM
FT                   IVLAIVGVIAAYAIPAYQDYLARSRVGEGMSLAAAAQLTVGENAGSGNAFGSGYASPPA
FT                   TRNVQSIHIDDDTGQITVAFTARVADEGSNTIVFVPSAPDNADTPTARVALAKGSVQKG
FT                   TITWECFAGGKAASSLPAPGSGPLPVDAPTLAGNLAPPECRS"
FT   gene            507997..509703
FT                   /locus_tag="Bphy_0447"
FT   CDS_pept        507997..509703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0447"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="KEGG: rme:Rmet_0253 RNA-directed DNA polymerase
FT                   (reverse transcriptase); PFAM: RNA-directed DNA polymerase
FT                   (Reverse transcriptase); HNH endonuclease; Group II intron
FT                   maturase-specific domain protein; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69639"
FT                   /db_xref="GOA:B2JDC2"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC2"
FT                   /protein_id="ACC69639.1"
FT                   /translation="MKVSGRKTGSALSHAPDNWYAVDWRRVERNVRGMQIRIAKATREG
FT                   DWRRVKALQRMLTRTLSAKLYAVRRVTQNQGARTAGVDRELWDSPESRWEAVGRLKRHG
FT                   YKALPLRRVFIPKANGKERPLGIPTMRDRAMQALYLLALEPVAESTSDPNSYGFRLNRS
FT                   TADAMSQIFVVMARRRSARWVLEADIKGCFDHINHKWLESNVPMDRVILRKWLKAGLIY
FT                   KGQLQATMAGTPQGGIISPTLANVTLNGLERELIAQLTAKFGIGKAKKLKVNVVRYADD
FT                   FVITGDSKEMLEREVRPWVEAFLEVRGLQLSEEKTRIVHIDEGFDFLGWNFRKYSGTLL
FT                   IKPSKKNVQTFYRKVADTISGHKAVKQEELIRLLNPILRGWAQYHCPVVAKQAYSRMES
FT                   LVFQRLWRWSKRRHPNKNADWVRRKYFHSVGNRHWVFAAPVIREDGSKGLLELYQISGT
FT                   EIRRHKKVKGEFNPFDLVWEQYGEHLRQERMWDSMRYRKQWASLYMLQSGQCAHCGCAL
FT                   TDETGWHDHHLEYRMYGGSDALSNRVLLHPDCHRQVHVGKLVVAKPAPLQH"
FT   gene            509828..511618
FT                   /locus_tag="Bphy_0448"
FT   CDS_pept        509828..511618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0448"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bxe:Bxe_A0678
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69640"
FT                   /db_xref="GOA:B2JDC3"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC3"
FT                   /protein_id="ACC69640.1"
FT                   /translation="MPTPFARYLSLFILACALILPYAVVNHTYPIPTFYAEFTALALYL
FT                   LLGAGVALLVSTARPRVAFASPVVALVPLGFGLVLIAQSIVLPVAQPSMNWLGAGFLLA
FT                   AFMATHAGFGFSRADLTETVFTAAAFALVVGGLFAVFCQTIQLFHLEVKVTPLVVAYSV
FT                   LTERRPFGNMAQANHLATYIAFATAGAMYLVQTRRINVFIWLLVSAIFSGGLALTVSRG
FT                   PWLQMGVIVVAGFWMAFAELRRHPSRRGSNRQWLIPLVLAVLFFAVNAAIRWANLHYHL
FT                   DLAQSAAERMKDASQIAPRLALWKYGWTMFRTHPLLGVGWGEFPRYQFDLVKSLGGVEI
FT                   ANNSHDIFIDLLAKTGLIGLGLVLLGLGAWFVRVVRAPHTAARVFGLALIGVLVMHALV
FT                   EYPQQYMFFLLPAMFVIGLLDTKPLRLIPGGLSFGAFLVIVLGGLAALYPVYRDYGRSE
FT                   VLYYGSRPFDQYRADPSFLFGAWGEYGMATLLPMNAQDLPHKMAMHRQAMALLPGETVL
FT                   RRYAVLQALSGDMNGAFDTVDRLKIFAEELHDWPSQLSYLYDLCDQQKTLGAFKAELMK
FT                   KYGTPPKDINKSDEDDDDED"
FT   sig_peptide     509828..509908
FT                   /locus_tag="Bphy_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.325 at
FT                   residue 27"
FT   gene            complement(511705..512181)
FT                   /locus_tag="Bphy_0449"
FT   CDS_pept        complement(511705..512181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0449"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: bxe:Bxe_A0679 molybdopterin cofactor biosynthesis
FT                   protein MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69641"
FT                   /db_xref="GOA:B2JDC4"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDC4"
FT                   /protein_id="ACC69641.1"
FT                   /translation="MPELTHFDAAGQAHMVDVGGKAETKRIAVARGTIRMLPATFELIR
FT                   KGEAKKGDVIGIARIAAIQGAKRTADLIPLCHPLALTRVAVDFELDETVPAVHCRVQVE
FT                   THGRTGVEMEALTAVQVGLLTVYDMCKAVDRGMTITDVKVMEKHGGKSGDWVAE"
FT   gene            512380..514068
FT                   /locus_tag="Bphy_0450"
FT   CDS_pept        512380..514068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0450"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bxe:Bxe_A0680
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69642"
FT                   /db_xref="GOA:B2JDC5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC5"
FT                   /protein_id="ACC69642.1"
FT                   /translation="MRLKRFFAVLVSVTLAVPPATIAQPSNLSELPLVTGPLDTYGGAS
FT                   APSDIAQGVFGLYGGAQTRFSGNPGGNASLHAPMSTQQLPDLGDGSGGTLTPQAERKLG
FT                   ERVMREVRSDPDYIDDWLVRDYLNSIAGRLAAAATAQYIGGYRPDFDLFAMRDPQINAF
FT                   SLPGGFIGVDTGLIVATQTESELASVVGHEMGHVLQRHIARMITAGEHSGYAALAGMLL
FT                   GVLAGVLAHSGDLGSAIAVGGQAYAVDNQLRFSRAAEHEADRVGFQMLAAAGYDPYGMV
FT                   AFFERLDRASMSDAGAPAYARTHPLTGERIADMADRARRSPYRQPHQSSEYAFVRARAR
FT                   VLQDRSRSEYADDISRMRSEIEDRTALNVASNWYGIAYAQMLIDRYDEAAASLANARAA
FT                   FDANERAGGDSVRSSPSLDVLSVDLARRSGHNDEAVRLAELAQKRWPQSHAVIDMRLQT
FT                   LLTARRFGEAQAQALRETRDDPRQPVWWRYLAQASVGTGDALTQHRALAEKFALEGAWP
FT                   SAIRQLKEARDIKSVGYYDLATIDARLHEFEARYKEEREDEKNSS"
FT   sig_peptide     512380..512451
FT                   /locus_tag="Bphy_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            complement(514065..514661)
FT                   /locus_tag="Bphy_0451"
FT   CDS_pept        complement(514065..514661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69643"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC6"
FT                   /protein_id="ACC69643.1"
FT                   /translation="MDDIVKQALAKWPNVPHCTGWLLLDRRGNWRMRDEAAQAAGTPGE
FT                   PIRHTALLGFINRNYEADDAGQWFFQNGPQRVYVELGYTPFVVRLATDHANGTLALTDQ
FT                   ASLGFEPAAVYLDDEGGILFTDRSTPARVAVLHDHDLDLFSEHADLASDGQSGEFRWRD
FT                   GVALKLESVRKSEVERRFGFVASPAARAAGASADH"
FT   gene            complement(514654..515667)
FT                   /locus_tag="Bphy_0452"
FT   CDS_pept        complement(514654..515667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0452"
FT                   /product="putative hydrolase of the alpha/beta-hydrolase
FT                   fold"
FT                   /note="KEGG: bxe:Bxe_A0682 putative hydrolase of the
FT                   alpha/beta-hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69644"
FT                   /db_xref="GOA:B2JDC7"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC7"
FT                   /protein_id="ACC69644.1"
FT                   /translation="MGSTPVEAAIDMIYRAPLWLPNCHIQTIVPALFGRRPIVTYRRER
FT                   WNTPDGDFIDLDWLAPDPLTGYRAAPGAPLFVLFHGLEGSSDSHYARTLMAAAYTRGWH
FT                   GVVPHFRSCSGPMNLLPRFYHLADSNEVDWVLRRLRGLHTGPIVAAGVSLGGNVLLRWL
FT                   GERREDASIIAAAAAISAPLDVHAGGRALSQGLGMIYTRSFLKTLKLKAQQKLTQYPGL
FT                   FDLDDVLASRTMHEFDDLVTAPLHGFRNADDYWTRATTRPLLPAITVPTLVLNARNDPF
FT                   LPGAVLPSRSEVSSMVELDQPAHGGHVGFMTGPFPGRIDWLSRRVFGYLDPFTQHG"
FT   gene            complement(515818..516264)
FT                   /locus_tag="Bphy_0453"
FT   CDS_pept        complement(515818..516264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69645"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC8"
FT                   /protein_id="ACC69645.1"
FT                   /translation="MPRFAHIFEAAADTLNAYYQAVAEVNIDSLMGLWIDEEFVSCICA
FT                   DGSHLHGLDAIRSGLTIQLEAQPVSIEPLDIRVYDSLGTVVYAIAEAHRPADPAAVPSM
FT                   VFTTYVMVHERGEWKIAHIHASAMPNETASQFAAKMRHGQGALH"
FT   gene            complement(516441..517466)
FT                   /locus_tag="Bphy_0454"
FT   CDS_pept        complement(516441..517466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0454"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: bxe:Bxe_A0684
FT                   putative ADP-heptose--LPS heptosyltransferaseII"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69646"
FT                   /db_xref="GOA:B2JDC9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDC9"
FT                   /protein_id="ACC69646.1"
FT                   /translation="MRRALVIAPNWIGDALMAQPLFARLVKLHPRIAIDAVAPAWVAPV
FT                   LERMPEVRDVYATDLAHGKLQMLRRWQLASDLRDVGYDAAYVLPNSLKSALIPWMAGIP
FT                   LRIGYTGESRYGLLNVRHTNPRKDERPPMVGHYAALAYAPGAKVPDDLAPPRLDADLNE
FT                   AARVSTRFNLDTRVPLLVFCPGAEYGPAKRWPPEHFAALAQMVGQSFPYTKIIALGSPK
FT                   DAPLAQAIADRAPNVRNLCGQTALGEACALISRASAVVTNDSGLMHVAAALRRPLVAVY
FT                   GSTDPRHTPPLSDLAKVQWLHLECSPCFQRECPLGHLNCLRQLSAEQVFDDLRGMLLAQ
FT                   R"
FT   gene            complement(517654..517848)
FT                   /locus_tag="Bphy_0455"
FT   CDS_pept        complement(517654..517848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69647"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD0"
FT                   /protein_id="ACC69647.1"
FT                   /translation="MSEIKEMPLVELSAKDLPAYCPNPSMPRWSNHPRVFIDVTHGEAR
FT                   CPYCSTRYKLRDGEVIKGH"
FT   gene            complement(517920..518843)
FT                   /locus_tag="Bphy_0456"
FT   CDS_pept        complement(517920..518843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0456"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: bxe:Bxe_A0686
FT                   branched-chain amino acid aminotransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69648"
FT                   /db_xref="GOA:B2JDD1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD1"
FT                   /protein_id="ACC69648.1"
FT                   /translation="MSMADRDGKIWMDGKLIDWRDARIHVLTHTLHYGMGVFEGVRAYK
FT                   TADGGTSIFRLKEHTKRLLNSAKIFQMDVPFDHETLAAAQREVVRENKLESCYLRPIIW
FT                   VGSEKLGVSAKGNTIHVAIAAWPWGAYLGEDGIKKGIRVKTSSFTRHHVNVSMVRAKAS
FT                   GWYVNSILANQEATADGYDEALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGIT
FT                   RDTVITLAKDAGIEVIEKRITRDEVYTADEAFFTGTAAEVTPIRELDNRTIGSGTRGPI
FT                   TEKLQSGFFDIVNGKSAKYAHWLTKI"
FT   gene            519159..519914
FT                   /locus_tag="Bphy_0457"
FT   CDS_pept        519159..519914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0457"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: bxe:Bxe_A0687
FT                   branched chain amino acid efflux pump, LivE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69649"
FT                   /db_xref="GOA:B2JDD2"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD2"
FT                   /protein_id="ACC69649.1"
FT                   /translation="MLARLSELDRRAFRDGARAYSPTLMAIFSWGLVTGIAMSKSVMTV
FT                   PQSLAMSLLVYAGSSQLAVLPLMLAKLPIWTILLTAAMVNTRFVIFSVGLAPHFSYLPL
FT                   HRRLLVGYFNGDVIYLLFQKKSFQHGYVPGKEAYFWGMAVSSWLSWQVSSIMGILLASL
FT                   FPDNWGLSLAGTLALLPVMVSAISSRSTLAAVSVAGIVALIAFDLPYRLALPLAVVTAI
FT                   AAGTAADALVERADLRRIRNSTRSPGDTQ"
FT   gene            519911..520234
FT                   /locus_tag="Bphy_0458"
FT   CDS_pept        519911..520234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0458"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   bxe:Bxe_A0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69650"
FT                   /db_xref="GOA:B2JDD3"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD3"
FT                   /protein_id="ACC69650.1"
FT                   /translation="MSTLQIWLAIIGMTFVTALTRALFLIGGERTVLPERVQRMLRYAP
FT                   AAALAAVVVPDVMVTDSGVSLALSNHELYGTLAGLAWFLWRRTMLGTIVVGMLVFTALR
FT                   LLF"
FT   gene            520452..521645
FT                   /locus_tag="Bphy_0459"
FT   CDS_pept        520452..521645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0459"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: bxe:Bxe_A0689
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69651"
FT                   /db_xref="GOA:B2JDD4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD4"
FT                   /protein_id="ACC69651.1"
FT                   /translation="MNNVLRLSDLIAEGKLSGKRVFIRADLNVPQDDAGNITEDTRIRA
FT                   SVPAIKSALDAGAAVMVTSHLGRPTEGDFKPEDSLAPVAKRLAELLGRDVPLVQNWVEN
FT                   GVNVAPGQVVLLENCRVNKGEKKDSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAK
FT                   YASVACAGPLLAAELEALGKALGAPKRPLVAIVAGSKVSTKLTILKSLADKVDQLIVGG
FT                   GIANTFMLAAGLKIGKSLVEADLVDEAKAIIEAAKARGASVPIPSDVVTAKEFSATAQA
FT                   TVKQVADIEDDDMILDIGPETAKALAGQLEKAGTVVWNGPVGVFEFDQFGNGTKTLAEA
FT                   IARSSAYSIAGGGDTLAAIAKYGIHDKVSYISTGGGAFLEFLEGKKLPAVAVLESRA"
FT   gene            522131..523567
FT                   /locus_tag="Bphy_0460"
FT   CDS_pept        522131..523567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0460"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: bxe:Bxe_A0690 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69652"
FT                   /db_xref="GOA:B2JDD5"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD5"
FT                   /protein_id="ACC69652.1"
FT                   /translation="MHRATKIVATIGPASSTQDILLQMIQAGADVVRLNFSHGTADDHR
FT                   QRAEFVREAARQAGREVGIMADLQGPKIRVGKFENGKTTLIAGNTFILDADCELGNDDR
FT                   VGLDYKDLPRDLRAGDTLLLNDGLIVLTVSRVIGNEIHTVVKIGGDLSNNKGINRQGGG
FT                   LTAPALTAKDMEDIRTAMSLGADYVAVSFPKNATDMEMARQLANIAGAPYGIKPKMIAK
FT                   IERAEAIPALQGILEASDGIMVARGDLAVEVGNAAVPALQKRMIKMARDMNKFVITATQ
FT                   MMESMIHAPVPTRAEVSDVANAVLDGTDAVMLSAESAAGKYPVQTIETMAAICVEAEKS
FT                   EHVELDKDFLDRTFTRIDQSIAMGALFTAYHLGAKAIVALTESGSTALWMSRHWTHVPI
FT                   FALTPRTGSERAMAIYRNVTPLHLDTSSDRDIALAQALEVVVGKGYAARGDMVVLTVGE
FT                   PMGQAGGTNTLKIVRVGEPV"
FT   gene            523822..524886
FT                   /locus_tag="Bphy_0461"
FT   CDS_pept        523822..524886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0461"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: bur:Bcep18194_A5957 fructose-bisphosphate
FT                   aldolase, class II, calvin cycle subtype; TIGRFAM:
FT                   ketose-bisphosphate aldolase; fructose-bisphosphate
FT                   aldolase, class II, Calvin cycle subtype; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69653"
FT                   /db_xref="GOA:B2JDD6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD6"
FT                   /protein_id="ACC69653.1"
FT                   /translation="MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAIMAAADQVNAPV
FT                   IMQASAGARKYAGEPFLRHLIEAAIESYPHIPVVMHQDHGQSPAVCMAAIRSGFTSVMM
FT                   DGSLEADGKTVASYEYNVDVSRKVVEAAHSIGVTVEAELGVLGSLETMKGDKEDGHGAE
FT                   GTMTREQLLTDVEQAADFVKLTQCDALAIAIGTSHGAYKFSKKPTGDILSIQRIREIHE
FT                   RIPNTHLVMHGSSSVPQELLAEIREFGGDMKETYGVPVEEIQIGIKHGVRKINIDTDLR
FT                   LAITGAIRRYLAENPSKFDPRDYLKPAREAAKKVCVDRYLAFGCEGQASKIKPVSLDKI
FT                   AEKYKAGELAQVVR"
FT   gene            525017..525907
FT                   /locus_tag="Bphy_0462"
FT   CDS_pept        525017..525907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0462"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: bxe:Bxe_A0692 SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69654"
FT                   /db_xref="GOA:B2JDD7"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD7"
FT                   /protein_id="ACC69654.1"
FT                   /translation="MSTLYESTLRSLPLLGRGKVRDNYAVGNDQLLIVTTDRLSAFDVI
FT                   MGEPIPDKGRVLNQMANFWFDKLKHVVPNHLTGVAPETVVAPDEAEQVKGRAVVVKRLE
FT                   PILVEAVVRGYLAGSGWKDYQATGAVCGVQLPEGLQNAQKLPEPIFTPAAKAEMGHHDE
FT                   NITYEEMERRIGTELSATIRDISIRLYKEAADYAATRGIIIADTKFEFGLDQNGKLYLM
FT                   DEALTADSSRFWPADQYQVGTNPPSFDKQFVRDWLETQPWKKEPPAPKLPDEVVTKTAE
FT                   KYQEALERLTGQKLD"
FT   gene            525932..526441
FT                   /locus_tag="Bphy_0463"
FT   CDS_pept        525932..526441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0463"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bxe:Bxe_A0693
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate(AIR)
FT                   carboxylase; TIGRFAM: phosphoribosylaminoimidazole
FT                   carboxylase, catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69655"
FT                   /db_xref="GOA:B2JDD8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD8"
FT                   /protein_id="ACC69655.1"
FT                   /translation="MSEAHAHSAPVVGVLMGSSSDWEVMKNAVAILQEFGVPYEAKVVS
FT                   AHRMPDEMFAYAESARERGIRAIIAGAGGAAHLPGMLAAKTTVPVLGVPVASKYLKGVD
FT                   SLHSIVQMPKGVPVATFAIGEAGAANAALFAVSLLSGTSAEYAEKLAAFRVRQNQAAHA
FT                   MTLPPL"
FT   gene            526516..527724
FT                   /locus_tag="Bphy_0464"
FT   CDS_pept        526516..527724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0464"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: bxe:Bxe_A0694 phosphoribosylaminoimidazole
FT                   carboxylase, ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69656"
FT                   /db_xref="GOA:B2JDD9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDD9"
FT                   /protein_id="ACC69656.1"
FT                   /translation="MNPDNTPVSPIMPGAWLGMVGGGQLGRMFCFAAQAMGYRVAVLDP
FT                   DETSPAGAVADRHLRAAYDDEAALTELARLCAAVSTEFENVPSASLDFLARTTFVSPAG
FT                   RCVAVAQDRIAEKRFIASSGVPVAPHVVIESSSALAALDDVSLEAVLPGILKTARMGYD
FT                   GKGQVRVGNAAEARAAYASLGGVPCVLEKRLPLKFEVSALIARGATGCSAVYPLAQNTH
FT                   RHGVLSHTIVPAPDANATLVEQAQQAALQIADKLGYVGVLCVEFFILEDGTLVANEMAP
FT                   RPHNSGHYTVDACATSQFEQQVRAMTGMPLGDTRQHSPAVMLNILGDVWFPANAKGDKP
FT                   TAAVTPPWHEVAAMPEARLHLYGKEEARPGRKMGHVNFTAATLEHARSAARDCARLLHI
FT                   PTN"
FT   gene            527737..528780
FT                   /locus_tag="Bphy_0465"
FT   CDS_pept        527737..528780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0465"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   bxe:Bxe_A0695 SUA5/YciO/YrdC/YwlC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69657"
FT                   /db_xref="GOA:B2JDE0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE0"
FT                   /protein_id="ACC69657.1"
FT                   /translation="MPDQTKPGDVASSVGADEIAHAAAMLDAGQLVAFPTETVYGLGGD
FT                   AESPDAIARIYAAKGRPSNHPVIVHLAPNGDPNYWVAQLPSDAQRLIDAFWPGPLTLIL
FT                   KRAAHIPAAVSGGQDSVGLRCPSHPVAQSLLTAFSALRNGHGGVAAPSANRFGHVSPTT
FT                   AQHVREEFGDAIHVLDGGPSDVGIESTIVDLSRGFPALLRPGHVTPQDIADVLGEMPRL
FT                   PDGSDASAPRASGTLKAHYAPRTPLALLPFDVLEPLLAARAPGERVALVARASRAGRWA
FT                   EAQGVHFVAAPEDPHLYARDLYGLLRALDRANVSRILIEKLPDTIEWIAVNDRLGRAAA
FT                   AFEANEA"
FT   gene            complement(528871..530082)
FT                   /locus_tag="Bphy_0466"
FT   CDS_pept        complement(528871..530082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0466"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bxe:Bxe_A0696 putative lipase / esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69658"
FT                   /db_xref="GOA:B2JDE1"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE1"
FT                   /protein_id="ACC69658.1"
FT                   /translation="MKQASNSTGVVHVVRAARIAVACAAFATLVACGGGSSNNSSTSAS
FT                   TSPAGGVKLQVVSFGDSLSDVGTYSPVITASFGGGRFTTNPGEVWTQKIAEYYGDTLTP
FT                   AYVGGFGKALAANGGMGYAQGGSDVSRTDGNGYAPNNMAATTWPVTRQVQQYLTDHGSF
FT                   NSNQLVLINGGANDILQNLSAMLTSIQTQVAQLTDPTQAPLVVQSVALSTVGPMAQTLA
FT                   AQIGTILASGATHVVVMDVPDIGKTPLATSLATQLKSTQIPALISGIVATYNGVLQKAL
FT                   ATGGLTSKVIYVSTSDWLTPLLANPAAQGFSNTTGTACNITQMATNATAYATANPSVLT
FT                   GGMTAAQYGQQFASSLFCSPNTLTVAGADQSYVFADTIHPTTHAHAAFATLVEGKIAAT
FT                   GLGK"
FT   sig_peptide     complement(529948..530082)
FT                   /locus_tag="Bphy_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.304 at
FT                   residue 45"
FT   gene            complement(530287..530670)
FT                   /locus_tag="Bphy_0467"
FT   CDS_pept        complement(530287..530670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69659"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE2"
FT                   /protein_id="ACC69659.1"
FT                   /translation="MQFDTELLLRGMAPIFLACIGWEAWHAGRTHPKAHGYSWRDTACN
FT                   TALALMHQGADKLAWLFVIPVYANCSTHYRLFDWRAGWLSFVVLFVAQDLLYDMFHRCR
FT                   PRVRWLWGRACRASLAGAHELLA"
FT   gene            complement(530868..532421)
FT                   /locus_tag="Bphy_0468"
FT   CDS_pept        complement(530868..532421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0468"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: bxe:Bxe_A0698 peptidase S13, D-Ala-D-Ala
FT                   carboxypeptidase C; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69660"
FT                   /db_xref="GOA:B2JDE3"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE3"
FT                   /protein_id="ACC69660.1"
FT                   /translation="MSRAAAVLFACAALAVAAPAEARKKAQRPAVNVSTVLPPAVMAGL
FT                   QHAHVPLSSISVVVEKVGDRTPVLALNAGKPMMPASTMKLVTTFSGLSMLGPDYRWKTT
FT                   AYAQGNIDGSGVLHGNLYIQGTGDPKLVPEELIDLVQKIHKAGITGIDGALVLDKRFFD
FT                   PSTRDLPAFDDDANAPYNVGPDPLLYAFKSLSFRMSPSDDGKVQIDVLPALAQLQIDNE
FT                   LHATRGPCRGELVTPAVTPAANGVVNASFIGDYPLHCGERTVNVAVLDHTAFFAGGFLA
FT                   LWQQTGGTFNGTTREGPVPIDAKLVATHQGPMLSDIVHDINKFSNNTMARNLFLTIGAV
FT                   INRPPATPAKSADAIESFLHRSALPMEYLSLDNGSGLSRDEHITALALADLLQSANASP
FT                   VAQVFVDSLPVVGVDGTMRNRLTSQPVNGNAHIKTGTLRDVRAIAGYVASADGQSYVVV
FT                   SLINDPHAEAARAAHDELLEWVYQGPSVMLASTANAQAADAAQEPGRKIRKNPQRRGAH
FT                   "
FT   sig_peptide     complement(532353..532421)
FT                   /locus_tag="Bphy_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.606 at
FT                   residue 23"
FT   gene            532855..533517
FT                   /locus_tag="Bphy_0469"
FT   CDS_pept        532855..533517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0469"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_A0699 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69661"
FT                   /db_xref="GOA:B2JDE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE4"
FT                   /protein_id="ACC69661.1"
FT                   /translation="MRILLVEDDRMIAEGVRKALRGEGFAVDWVQDGESALNAADGQPY
FT                   DLVLLDLGLPKRDGLDVLRTLRTRGHQLPVLIVTARDAVADRVKGLDAGADDYLVKPFD
FT                   LDELGARMRALIRRQSGRSESTIRHGNLTLDPASHQVTLDGAPVALSAREFALLAALLA
FT                   RPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGAELIRNVRGLGYMIAKEA"
FT   gene            533522..534823
FT                   /locus_tag="Bphy_0470"
FT   CDS_pept        533522..534823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0470"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bxe:Bxe_A0700 signal
FT                   transduction histidine kinases (STHK)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69662"
FT                   /db_xref="GOA:B2JDE5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE5"
FT                   /protein_id="ACC69662.1"
FT                   /translation="MRSIRRQLLFWLLAIVLLGVGIAGWLIYRQALAEANELFDYQLQE
FT                   IAAALPAEPFSQVLSSRDTGDEGIVLQIWNRNGVLMYYSHPRAPLAPRAELGFSTERTE
FT                   RGDWRVYGAIVGDNVVQLAQPLSVRNRLAANVALRTLWPLIVLLPLLGVAVWGVVGRGL
FT                   EPLRRVTGALDTRHPEALDPLPDSRLPLEVQPLVRALNGLLERLSVALDTQKAFVADAA
FT                   HELRTPLAAVQIQSQLVARAQDEAERSEALRDLQAGVTRATRLAEQLLALARSEPDGHA
FT                   ATGTVDLDALVHDCVTAHLPLAQKRGVDLGIEASEPATVAGDMEALRVMLNNLIDNATK
FT                   YTPEGGRVDVCLRVDNGRPVVEIGDSGPGIPPDERSRVFDRFYRVGAGANRARTDVSGS
FT                   GLGLAIVRRIALQHHASVALDDSASGGLLVSVRF"
FT   sig_peptide     533522..533623
FT                   /locus_tag="Bphy_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.898 at
FT                   residue 34"
FT   gene            534937..536439
FT                   /locus_tag="Bphy_0471"
FT   CDS_pept        534937..536439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0471"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bxe:Bxe_A0701 serine protease, subfamily S1C;
FT                   TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69663"
FT                   /db_xref="GOA:B2JDE6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE6"
FT                   /protein_id="ACC69663.1"
FT                   /translation="MKANMLTRSAVAAAVVIALSAGYVAGHRNVPAPAVITPAVAAMMP
FT                   AEAAAKTGIPDFSGLVETYGPAVVNISAKHVVKQTAMRGGNNSGQLPIDPSDPFYQFYR
FT                   HFFGQMPGGPNGGGDDGGDRPSASLGSGFIISSDGYVLTNAHVVDGANVVTVKLTDKRE
FT                   YRAKVVGADKQSDVAVLKIDAKDLPTVKIGDPRQSKVGQWVVAIGSPYGFDNTVTSGII
FT                   SAKSRSLPDENYTPFIQTDVPVNPGNSGGPLFNLQGEVIGINSMIYSQTGGFQGLSFAI
FT                   PINEAIKVKDDLVKTGHVSRGRLGVAVQSVNQTLADSFGMKKPQGALVSSVDPGGPAAK
FT                   AGLQPGDVILSVDGVDVVDSAALPSQIAGIRPGKQVDVQVWRDKSTKDMKVTIGSLSDV
FT                   KAAANDDGGPAQMQGRLGVAVRPLTPQEKSGASVSHGLLVQDASGAAASAGIQPGDVIL
FT                   AVNGRAVSSVDQLKQAVSGAGNSIALLIQRDNSQIFVPVDLG"
FT   sig_peptide     534937..535017
FT                   /locus_tag="Bphy_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.731 at
FT                   residue 27"
FT   gene            536681..537178
FT                   /locus_tag="Bphy_0472"
FT   CDS_pept        536681..537178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69664"
FT                   /db_xref="GOA:B2JDE7"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE7"
FT                   /protein_id="ACC69664.1"
FT                   /translation="MIHRRTVARAVSVAAATVLTLGLAGGALAQQASEVTGGTTTDSTS
FT                   AGNANGGGLPQVQQQGDVSYTSGGVGLDESKALLAAQSQWPLSLRFTGPGSDYLADVKV
FT                   KIVDAHGGSVLDTTSRGPYMLVRLRPGRYTVHAAYKDNEQSKPVTIPAKGTAKAAFYWG
FT                   TQ"
FT   sig_peptide     536681..536770
FT                   /locus_tag="Bphy_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 30"
FT   gene            537575..538018
FT                   /locus_tag="Bphy_0473"
FT   CDS_pept        537575..538018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0473"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   bxe:Bxe_A0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69665"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE8"
FT                   /protein_id="ACC69665.1"
FT                   /translation="MNDAPSGASADNSDSSHARHGGGAPAHSGSEDASHTITIAANQHR
FT                   VRVIHQGVTFADTHTALTLSETGCADVVYFPRADVNMARLIRSAHTSHCPFKGEASYFH
FT                   LHTEDETIENVVWSYENPLERVKQIAGYVAFSASRVDRIDQTS"
FT   gene            538052..538798
FT                   /locus_tag="Bphy_0474"
FT   CDS_pept        538052..538798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0474"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   bxe:Bxe_A0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69666"
FT                   /db_xref="GOA:B2JDE9"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDE9"
FT                   /protein_id="ACC69666.1"
FT                   /translation="MELNDALRVPLAPSEVWDALQDLALLRASLDNCESLRRLQGGEYL
FT                   LTMTVPLGPLRAHYHIRAHVASEDGALSAKPHRTLNFKARAEGVGSLRGQIDVSLRTDD
FT                   HLHLPGRGPSTRIDYSVWATSTGPLAQLPARQIENALHELADDFFTEFCAVVQAKHGKG
FT                   PNRATGMQGRRQHVFLRPISLSGVARRARLHEQQYGGTLTGRAAHSLLHGLHHEHDPHV
FT                   LPNWAWAVMIFFVALLLYVARYFTQG"
FT   gene            complement(538886..539938)
FT                   /locus_tag="Bphy_0475"
FT   CDS_pept        complement(538886..539938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0475"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_A0705
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69667"
FT                   /db_xref="GOA:B2JDF0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF0"
FT                   /protein_id="ACC69667.1"
FT                   /translation="MARAAATSALNPSQSPESDARARHDAGSRAAPKQAHVVAAIAFDG
FT                   ISPFHLSVPCVVFGEDRSDGGVLGFEFRVCSIEAGPLSTTAGFSIAAPHGLDALADADT
FT                   IIVPTWRDPDEAPPAGLLDALRTAHARGAQLVGLCLGAYVLAAAGLLDGRPATTHWAWA
FT                   ADFARRFPKVKVDPQVLYVDDGDILTSAGTAAGLDCCLHVVRKLCGAQSANYIARRLVI
FT                   PPHRQGGQAQYVQQPMPPQTRGNRLSALLDWVNGTLDAPHTLDSLAARAAMSRRTFTRH
FT                   FKAATGTTVSAWLLTQRLARAQQLLEGTDEPIESIAGMAGFGSTASLRQHFAGAFRTSP
FT                   SAWRREFRGM"
FT   gene            540086..540715
FT                   /locus_tag="Bphy_0476"
FT   CDS_pept        540086..540715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0476"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bxe:Bxe_A0706
FT                   putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69668"
FT                   /db_xref="GOA:B2JDF1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF1"
FT                   /protein_id="ACC69668.1"
FT                   /translation="MPTPRRALIVIDVQNEYVTGDLLIEYPDVQTSLSNIGRAIDTARA
FT                   ARIPVVVVQNFAPAGSPVFARGSEGAQLHAVVASRQHDHYVEKDLPSAFTNTDLAGWLA
FT                   AHEIGTLTVVGYMTHNCDASTIVHALHMGLAVEFLHDATGSVPYENSAGFASAEEIHRV
FT                   YSVVLQSRFAAVASTQQWVEAVESGGQLERGSIYASNRKARAKSAA"
FT   gene            complement(540808..541443)
FT                   /locus_tag="Bphy_0477"
FT   CDS_pept        complement(540808..541443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0477"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   bxe:Bxe_A0707 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69669"
FT                   /db_xref="GOA:B2JDF2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF2"
FT                   /protein_id="ACC69669.1"
FT                   /translation="MVRRTKEEAQETRTRILDAAEQVFSEKGVSRTSLADIAQTAGVTR
FT                   GAIYWHFANKGELFTEMFDRVLLPLDELKAASVDPNEADPLGRLIEICTVCLRDTANDP
FT                   HRRRVFDILFHKCEFVEEMGPVMARYQNTMREGLTNIQTCMRNAISKGQLPADMNVPVA
FT                   ASMVHAFISGSLKDMLFVPEVLDFGRHARQMVESMIDALRSPALRMGA"
FT   gene            541870..543120
FT                   /locus_tag="Bphy_0478"
FT   CDS_pept        541870..543120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0478"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_A0708 membrane fusion protein, RND efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69670"
FT                   /db_xref="GOA:B2JDF3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF3"
FT                   /protein_id="ACC69670.1"
FT                   /translation="MRVERVPFRLLTAATAAVMLAACGQKQSAPPPQTPEVGVVTVQPQ
FT                   AVPVVTELPGRTSAFLVAQVRARVDGIVLRREFTEGTQVKAGQRLYKIDPAPYIATLNS
FT                   AKASLAKAQANLASTTAQANRYKVLVAANAVSKQDYDNAVAAEGQAAADVAAGKAAVDT
FT                   AQINLGYTDVVSPVSGQVGISQVTPGAYVQASQATLMSTVQQLDPVYVDVTQSSLSGLK
FT                   LRRAIQAGRLKTNGPNAAKVELVLEDGRVYSEKGKLQFTDVTVDQTTGSVTIRAIFANK
FT                   DHVLLPGMFVRARIEEGVNENALLVPQIGVTHDQKGQPTALVLNKDGKVELRTLQATST
FT                   YGQYWVVEGGLNVGDRVIVNGVDKVKPGAQAKGVPAQLPPPAAASDASAAAAPGAPAAS
FT                   GAQAASGAAAASAASGA"
FT   sig_peptide     541870..541944
FT                   /locus_tag="Bphy_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.802 at
FT                   residue 25"
FT   gene            543138..546332
FT                   /locus_tag="Bphy_0479"
FT   CDS_pept        543138..546332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0479"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A0709 RND family hydrophobe/amphiphile efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69671"
FT                   /db_xref="GOA:B2JDF4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF4"
FT                   /protein_id="ACC69671.1"
FT                   /translation="MAKFFIDRPIFAWVIAIILMLAGLASIFTLPVAQYPTIAPPAVQI
FT                   SATYPGASAKTVENTVTQVIEQQMSGLDHLLYLSSTSDDSGTATITLTFAAGTNPDIAQ
FT                   VQVQNKLQLATPLLPQVVQQLGTKVTKSSSSFLLVMAFVSTDGSMTKYDLANYVASNVQ
FT                   DPVSRIDGVGTVTLFGSQYAMRIWLDAHKLTNFGLTPVDVETALQAQNVQVAGGSLGGT
FT                   PSIPGQLLQATISEATLLTTPEQFGNVLLKVNQDGSQVRIKDVARIELGGENYNFDTKY
FT                   NGQPTAGFGIQLATGANALATAKAVRDKIDQLSKYFPHGLVVKYPYDTTPFVRLSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATLIPTIAVPVVLLGTFAIMSAVGFSINVLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPKDATRKAMDQITGALIGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVAAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNK
FT                   TFDRSRDKYHSGVHHVIKRSGRWLIIYLVVIVAVGLLFVRLPKSFLPDEDQGTMFVLVQ
FT                   TPSGSTQETTARALKDISDWLLNDEKSIVESTFTVNGFSFAGRGQNSGLVFVRMKDYAE
FT                   RQHANQKVQALVGRMYMHFAGYKNAVVFPVNPPSIPELGTASGFDFELQDRAGLGHEKL
FT                   MAARNQLLGMAAKDPTLAQVRPNGLNDTPQFKVSIDHEKAAAQGVSLSTIDQTFSIAWA
FT                   SAYVNNFLDTDSRIKKVYLQADAPFRMTPENLSDWYVRNTAGSMVPFSAFASGQWTYGS
FT                   PKLERYNGISAVEIQGQAAPGKSTGQAMTAMEAIAAKLPAGIGYEWTGLSFQERQSGSQ
FT                   APILYGISILVVFLCLAALYESWSIPFSVIMVVPLGVLGALLAATLRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQQGEGMGPVEAALEAARLRLRPILMTSLAFILGVLPLA
FT                   ISNGAGSASQHAIGTGVIGGMLTATFLAIFMIPMFFVVIRAKFTGEKEDPDEAMKHYNE
FT                   HHPHEPPGGSGPGNAS"
FT   sig_peptide     543138..543242
FT                   /locus_tag="Bphy_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.362 at
FT                   residue 35"
FT   gene            546343..547860
FT                   /locus_tag="Bphy_0480"
FT   CDS_pept        546343..547860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0480"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_A0710 RND efflux system, outer
FT                   membrane lipoprotein, NodT subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69672"
FT                   /db_xref="GOA:B2JDF5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF5"
FT                   /protein_id="ACC69672.1"
FT                   /translation="MHKYSLMAVAVALFATGCTMEPTYHQPAAPVSGTFPSDGVYATQP
FT                   VPGAGARSANGQPAVEIGWRDFFVDQRLQRLIEIALKNNRDLRVSVLNIEASRAQYQIA
FT                   RAALFPALDASASQTKQRTPKNLSVFGNTISNEYSVGLNASWEIDFFGRIRSLKDQALA
FT                   QYLATAQARKAAEIALVASVADQYMTVLAYDDLLKVTENTLKSAQESYRITKLQYDTGT
FT                   GSELDLRQAQTVVEQATANLQSQARLRAQAENALVLLVGEPLPSDMPSGLILDDQNLLT
FT                   DIPAGLPSDLLTRRPDIMEAEQNLLAANANIGAARAAFFPKVSLTGSFGTLSPTLGGLF
FT                   KPGSAAWSFAPTITLPIFEGGQNIANLDLANVEKNIQIAQYEKAIQTAFREVADGLAAR
FT                   GTYDEQIKALERDTFAEQRRLDLSDLRYRNGVDSYLAVLTAQTSLYSAQQLLITARMER
FT                   LTNLVDLYKALGGGWIEHAGDQPRPADAPVDYGAASAPVAASAATAG"
FT   sig_peptide     546343..546396
FT                   /locus_tag="Bphy_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.427 at
FT                   residue 18"
FT   gene            complement(548106..549521)
FT                   /locus_tag="Bphy_0481"
FT   CDS_pept        complement(548106..549521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0481"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bxe:Bxe_A0711 xanthine/uracil - cation symporter, NCS2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69673"
FT                   /db_xref="GOA:B2JDF6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF6"
FT                   /protein_id="ACC69673.1"
FT                   /translation="MHSNTVHPCDERLPFGQLLTLGIQHVLVMYAGAVAVPLIIGSALN
FT                   LPKEQIAFLISADLFSCGIATLIQTLGLWIFGIRLPVIMGCTFAAVGPMVAIGTNPNLG
FT                   ILDIFGSTIAAGVIGIVVAPMIGKLLRFFPPVVVGVVISVIGLSLMEVGINWAAGGVGN
FT                   PDYGNPVYLGLSLVVLTLILLINKFGKGFIANISVLLGIVAGFVIAALLGRVNMEGVTN
FT                   APWVGFVMPFHFGLPHFDPLSIATMVTVMFVTFIESTGMFLAVGDMVERPVDQKTLVRG
FT                   LRVDGLGTLIGGIFNSFPHTSFSQNVGLIGVTGVKSRFVCAMGGVILVLLGLFPKMAQV
FT                   VASVPAFVLGGAGIVMFGMVAANGIKVLSKVDFVKNHHNLFIVAVSIGLGLVPVVSPHF
FT                   FSRLPPALSPLLHSGILLASVSSVVLNLIFNGVKGERTAKREIRRAGHDFDGRGSNDNA
FT                   IAGDDMLRAADMH"
FT   gene            549945..551369
FT                   /locus_tag="Bphy_0482"
FT   CDS_pept        549945..551369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0482"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bxe:Bxe_A0712
FT                   putative sugar kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69674"
FT                   /db_xref="GOA:B2JDF7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF7"
FT                   /protein_id="ACC69674.1"
FT                   /translation="MSFLGIDLGTGSLKLAIIDDEGREQCSTSIAYAIDTPHPGWAEID
FT                   PLIWWRALCEAAARFPDAQRSAVRAIGFSGQMHGVVLSDAHGNAVRPAMLWPDTRALSL
FT                   LDAWPAPQPNPVAPGMAGPLLRWVALHEPQSILAARWAMQPKDWVRLKLGGAIASDPSD
FT                   ACATALAEPSGAWDRALLDRLGLPGEWFAPLAPSYAAGGTLSDEAAQALGLPAGVLLAT
FT                   GAGDTPCAALGSGLTGDGDALLTTGTGGQILVLATDEPDAVPGLHRYRAATDHWYRMAA
FT                   MQNVGVALEAVRGWLSYEWQHAYRDAFESDVSPGLTFLPYLTGERTPWLNPAARGGWLG
FT                   LALGTSRGAMMRAAFEGVAFSLRAGLDSIRQSGARVSALRLAGGGSVDPRWRQLLANAL
FT                   QVELHAVDCPNAAARGAALLGGIAAGHWHAGDLAALAPAATRVAGPQGDAQLAARYARF
FT                   IDLYGRVEPWFAQLSR"
FT   gene            551563..552669
FT                   /locus_tag="Bphy_0483"
FT   CDS_pept        551563..552669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0483"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: bxe:Bxe_A0713
FT                   glutathione-dependent formaldehyde dehydrogenase(FlhA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69675"
FT                   /db_xref="GOA:B2JDF8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF8"
FT                   /protein_id="ACC69675.1"
FT                   /translation="MKTKAAIAWKAGAPLTIEEVDLEGPRAGEVLIEVKATGICHTDYY
FT                   TLSGADPEGLFPAILGHEGAGVIVDTGPGVGTLKKGDHVIPLYTPECRQCKFCLSRKTN
FT                   LCQAIRATQGKGLMPDATSRFSLDGKPLFHYMGTSTFSNYIVVPEIAVAKIREDAPFDK
FT                   VCYIGCGVTTGVGAVVYSAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDINPG
FT                   RVELAKKFGMTHFINPNEVENVVDHIVQLTDGGADYSFECVGNTTLMRQALECTHKGWG
FT                   QSFIIGVAAAGQEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKINIDDLI
FT                   THHLKLDQINEGFDLMKKGESIRSVVIY"
FT   gene            552681..553526
FT                   /locus_tag="Bphy_0484"
FT   CDS_pept        552681..553526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0484"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: bxe:Bxe_A0714 S-formylglutathione hydrolase
FT                   (FghA); TIGRFAM: S-formylglutathione hydrolase; PFAM:
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69676"
FT                   /db_xref="GOA:B2JDF9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDF9"
FT                   /protein_id="ACC69676.1"
FT                   /translation="MLELIESHASFGGTQRIYSHESKAIGLPMRFSVFMPKEASQKKVP
FT                   ALFYLAGLTCTEETFPIKAGAQRFAAQHGIALIAPDTSPRGAGVPGETDSWDFGVGAGF
FT                   YVDATQEPWSKHYRMYSYVRDELRETVVNELPVDGARLGIFGHSMGGHGALMLALRNPD
FT                   IYRSVSAFAPIAAPTRCPWGEKAFSGYLGADREAWKHYDASELVGKASRKFAEGILVDQ
FT                   GLADNFLAQQLNPDVFEAACKAADQPLTLRRHEGYDHGYFFISTFIEDHLAHHAKVLLG
FT                   "
FT   gene            complement(553594..554385)
FT                   /locus_tag="Bphy_0485"
FT   CDS_pept        complement(553594..554385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0485"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: bxe:Bxe_A0715 ABC
FT                   Mn2+/Zn2+ transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69677"
FT                   /db_xref="GOA:B2JDG0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG0"
FT                   /protein_id="ACC69677.1"
FT                   /translation="MFEYDFMVNAFAASGIVAVLSGIVGYFLVMRGQTFAGHALSHVGF
FT                   TGATGAVLIGISPIWGMIGFTLAAGVGMGALGEKLAGRDVAIGVILSLALGFGLLFLHF
FT                   FTAYATQVTALLFGNVLGVSSSTLAVLAALGVVSLIALAAIMRPLLFASLQPELAEAKG
FT                   VSLRLVSVLFLAIAALAVAACTQIVGVLLVFTLMVGPAAAAQNLSTRLSVGLVLAALLA
FT                   LAQAWIGVTLAFYTDWPTSFWITLLAALVYGASLLVQHARR"
FT   gene            complement(554378..555307)
FT                   /locus_tag="Bphy_0486"
FT   CDS_pept        complement(554378..555307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0486"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A0716 ABC Mn2+/Zn2+ transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69678"
FT                   /db_xref="GOA:B2JDG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG1"
FT                   /protein_id="ACC69678.1"
FT                   /translation="MNTPRRQASSGTTPVLELDRVTLELGDRTILRDTSFTINQGEFIG
FT                   VLGPNGAGKTTLMRSVLGLVPAAGGTVRVLGQPVVRGNPSIGYMPQTRSALAGRRVRGR
FT                   DFVAMAADGHRWGLPHADAKARADVDRVLDLVDGSALAARPLSELSGGERQRLLLAQCL
FT                   LGNPRLLLLDEPLISLDPHHQKTVVELVKRVQQELGIAVLFSAHELNPLLHALDRVLYL
FT                   GNGVAALGTVDEVITKPVLSRLYGSTIDVMRVNGRIFVMSGDFDVEKHDHEHEDDDHQH
FT                   GEPHGHGHSHGPKEAHHHASRDGHTHDV"
FT   gene            complement(555304..556233)
FT                   /locus_tag="Bphy_0487"
FT   CDS_pept        complement(555304..556233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0487"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bxe:Bxe_A0717 ABC Mn2+/Zn2+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69679"
FT                   /db_xref="GOA:B2JDG2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG2"
FT                   /protein_id="ACC69679.1"
FT                   /translation="MKKNNSMWKLLTRAVASTLFAVAFGQAAHAQDAKITVVAAENFYG
FT                   DVAQQLGGDRVEVTSILSNPDQDPHLFEASPKTARALQHANLVVYNGADYDPWMVKLLS
FT                   ASKNDRRKTIVAAELVGKKSGDNPHLWYDPSTMRAVARAVSAALASADPSHKAAYDANL
FT                   AKFLGSLKPIDDKVAALRSQYAHVSVTATEPVFGYMSDAIGVDMRNQRFQLAAMNGTEA
FT                   SASDIAAFERDLREQRVRVLIYNSQATEALTRHMLKLAQQSHVPTVSVTETQPAGQSYQ
FT                   QWMLAQLDALGNALAASNLSSTNKGKTP"
FT   sig_peptide     complement(556141..556233)
FT                   /locus_tag="Bphy_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(556291..556782)
FT                   /locus_tag="Bphy_0488"
FT   CDS_pept        complement(556291..556782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0488"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   bur:Bcep18194_A5930 ferric uptake regulator, FUR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69680"
FT                   /db_xref="GOA:B2JDG3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG3"
FT                   /protein_id="ACC69680.1"
FT                   /translation="MTRSSRLHSAVAGDQAARLAHKLARADALAAERGLALTTLRRQVY
FT                   TLIAESERPVGAYDLLAALEPQRGRVPPTTVYRAIEFLVEHGFVHRIESKNAFFACCQM
FT                   GEPHQSQFLMCDACGETVEIPGDRLAAQLSRSAPAQGFEVHHQVVELSGLCAACKHGHA
FT                   "
FT   gene            557071..557853
FT                   /locus_tag="Bphy_0489"
FT   CDS_pept        557071..557853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0489"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A0719 putative
FT                   oxidoreductase, short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69681"
FT                   /db_xref="GOA:B2JDG4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG4"
FT                   /protein_id="ACC69681.1"
FT                   /translation="MTARLQGKVAILTGAASGIGEAVARRYLEEGAHCVLVDVKPASDF
FT                   AHALRESDGDRVLTLSADVTKRDDIGRIVEQTVQRFGQIDILFNNAALFDMRPLLDESW
FT                   DIFDKLFAVNVKGMFFLMQAVAQRMVEQGHGGKIVNMSSQAGRRGEALVSHYCATKAAV
FT                   LSYTQSAALALAPHQINVNGIAPGVVDTPMWDQVDALFARYENRPLGEKKRLVGEAVPL
FT                   GRMGLPADLTGAALFLASSDADYITAQTLNVDGGNWMS"
FT   gene            557943..559265
FT                   /locus_tag="Bphy_0490"
FT   CDS_pept        557943..559265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0490"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_A0720 ABC sugar transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69682"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG5"
FT                   /protein_id="ACC69682.1"
FT                   /translation="MKPTCKPALNAFGAAALACAAFGANAATVTIATLNNPDMIELKKL
FT                   SPAFEKANPDIKLNWVILEENVLRQRATTDITTGSGQFDVMTIGAYETPQWGKRGWLTP
FT                   LTDLPADYDLNDVVKTARDGLSYNGSLYALPFYVESSMTYYRKDLFAAKGLKMPDNPTY
FT                   DQIAQFADKLTDKSAGTYGICLRGKAGWGENMAYVTTLVNTFGGRWFDEKWHAQLTTPE
FT                   WKKAVSFYVDLLKKDGPPGASSNGFNENLTLMSSGKCAMWIDATVAAGMLYNKQQSQIA
FT                   DKVGFAAAPTQATPNGSHWLWAWALAIPKSSKQTDAAKKFITWATSKQYIELAAKDEGW
FT                   ASVPPGTRQSTYARPEYKQAAPFADFVLKAIETADPTHPTAKPVPYTGVQFVGIPEFQS
FT                   FGTVVGQSISGAVAGQMSVDQALAAGNATADRAVKQAGYQK"
FT   sig_peptide     557943..558023
FT                   /locus_tag="Bphy_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            559490..560428
FT                   /locus_tag="Bphy_0491"
FT   CDS_pept        559490..560428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0491"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A0721 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69683"
FT                   /db_xref="GOA:B2JDG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG6"
FT                   /protein_id="ACC69683.1"
FT                   /translation="MRQHLRLPLMHAEPQTEHEREERKAAHARWLVSPSVGVLVLWMAI
FT                   PLAMTIWFSFSRYNLLNPDEKGFTGLDNYKYLASDPAFGPSIAHTLELIVAVLVITVVG
FT                   GVLLAVLFDRKFYGQGIARLLAIAPFFVMPTVSALIWKNMILHPVYGLVADGMRAVGLA
FT                   PVDWFADYPLTSVIIIVAWQWLPFAFLILFTAIQSLDQEQKEAAKIDGAGPFAMFFFIT
FT                   LPHLKRAIAVVVMMETIFLLSIFAEIYTTTGGGPGNATTNLSYLIYALGLQQFDVGLAS
FT                   AGGILAVVLANIVSFFLVRMLAKNLKGEYEK"
FT   gene            560425..561291
FT                   /locus_tag="Bphy_0492"
FT   CDS_pept        560425..561291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0492"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A0722 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69684"
FT                   /db_xref="GOA:B2JDG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG7"
FT                   /protein_id="ACC69684.1"
FT                   /translation="MSQLAATPVTTKPTKANSPLAVVGRSIPGILAWFIALLLFFPIFW
FT                   MTITAFKTEQQAYASSLFFTPTLESFREVFARSNYFGFAWNSILISVGVTLLCLILAVP
FT                   CAYAMAFFPTRRTQKVLLWMLSTKMMPSVGVLVPIYLLWKNSGLLDTVSGLVIVYTLIN
FT                   LPIAVWMSFTYFAEIPRDILEAGRIDGAATWQEIVYLLMPMSLPGLASTALLLVILSWN
FT                   EAFWSINLSSSNAAPLTVFIASYSSPEGLFWAKLSAASLLAVAPILIVGWVSQKQLVRG
FT                   LTFGAVK"
FT   gene            561288..561980
FT                   /locus_tag="Bphy_0493"
FT   CDS_pept        561288..561980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0493"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_A0723 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69685"
FT                   /db_xref="GOA:B2JDG8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG8"
FT                   /protein_id="ACC69685.1"
FT                   /translation="MTDIRTDANLALICDCDGVLIDSEAVAATVIVQQLEARWPGLDIA
FT                   PVVMPLLGLRTERVLQGAASALGMALTADDIDAIRVSVGASAVKAPMVEGIDAALAQIP
FT                   LTKACASNSDRGYVEAVLERTGLVKHFGSRLFCADTVEAPKPAPDVYLAAARAIGVDPQ
FT                   ACLVIEDSVAGVTAATAAGMTVYGFIGGGHASDEQVGTLRRLGAQHIFDDMKLLPELVE
FT                   RWLHRVTA"
FT   gene            562070..563179
FT                   /locus_tag="Bphy_0494"
FT   CDS_pept        562070..563179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0494"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A0724 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69686"
FT                   /db_xref="GOA:B2JDG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDG9"
FT                   /protein_id="ACC69686.1"
FT                   /translation="MASVTLRNIRKAYDDNEVMRNINLDIQDGEFVVFVGPSGCGKSTL
FT                   MRMIAGLEDISGGDLHIDGTRMNDVPPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAG
FT                   TKKPEIDAAVRNAAKILHIDHLLERKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSN
FT                   LDAALRVKMRLEFARLHDELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPNTLY
FT                   HAPANRFVAGFIGSPKMNFLEGVVQSVSASGVLVKYETGETQLVLVEPGRAKEGDKVTV
FT                   GIRPEHLHIDVQDYGVSARIMAVESLGDAAYLYAESSVAPDGLIARIPPLERHEKGATL
FT                   RLGATADHCHLFDSDGSAFQRKIVEVLAA"
FT   gene            563428..565206
FT                   /locus_tag="Bphy_0495"
FT   CDS_pept        563428..565206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0495"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bxe:Bxe_A0190 TPR
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69687"
FT                   /db_xref="GOA:B2JDH0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH0"
FT                   /protein_id="ACC69687.1"
FT                   /translation="MHNASLLIYDNTSPASVEHALALHRAGDLDRAGQAYRAILDLQPD
FT                   DANTRYMLGVLHLQRQEVERAIECFDASLALQPDHADCLNDRGIAALSRGDHEDAAHFF
FT                   RRATECAPHDALAHCNLGKALRRLSKPEEALASFQRALALDDGDVEAALGSADMLETLA
FT                   RPHEAVTAYEYAARFAPDDMRVLLGLGLTLNAVCRHADAAACFERALRQEPENVHALFG
FT                   IAFAIDGQLKFEEAVLRYQRALEVLPHSPTLLNNIAFTLTCLSRYDEADEHLRRAIEIA
FT                   PDLSNAHKLLGMSELRRGNFRKGWTSYEHRKTTQSGLHDYPPLDFPEWEGEPLDGKRFL
FT                   LAREQGAGDQLQFIRYAGVLHDLGATVDVWTSDELTPLFARMRGVQRVLTQAPTSGYDY
FT                   YCRMMSVPTWLDDEAIPHAVPYLSAAEAEVDAWRARIGQAAGSNRRVGLVWAGNPQHYL
FT                   DVYRSAPLAALEPLASVRGFAWFALQKGAPESQLDGVAHRWPICALGEWLDSFHATAAL
FT                   IESLDLVITVDTSVAHLAGALGKPVWVLLPKQADWRWMMSGDTSPWYPTARLFRQQVLG
FT                   DWTPVVESVRGALEAL"
FT   gene            complement(565235..566203)
FT                   /locus_tag="Bphy_0496"
FT   CDS_pept        complement(565235..566203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0496"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   bxe:Bxe_A0728 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69688"
FT                   /db_xref="GOA:B2JDH1"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH1"
FT                   /protein_id="ACC69688.1"
FT                   /translation="MPKSTEKLDLATRAAWLYYVAGNTQNEIAEKLQVSRPVAQRLVAF
FT                   AVEKNLIRVRVDHRLADCLSLADQLSKRYGLSMCEVVPVDNDKPEEIDRKLAVAGAQVM
FT                   ERYLNEERPMVVAVSSGRTLKAVVDQVGQLERPQHRLVSMVGAIAQDGSSNRYDVALHI
FT                   SEKTGGKHFLLPAPLIADSEAERAQWCNHRLYRIVESLSGEADVAFVGIGNIGLHCPLH
FT                   EDGFITSDEVEELVSLGAVAELLGLPIDADGARVESPTGRRVTSLRLDSPPKRPVIGFA
FT                   GGERKRNAVIAALKGGWLSGLVTDELCARAALNHENGAATR"
FT   gene            complement(566315..567799)
FT                   /locus_tag="Bphy_0497"
FT   CDS_pept        complement(566315..567799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0497"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: bxe:Bxe_A0729 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69689"
FT                   /db_xref="GOA:B2JDH2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH2"
FT                   /protein_id="ACC69689.1"
FT                   /translation="MYLGIDLGTSEVKVLLLASDGRVVGTAGSPFTVSRPHQRWSEQNP
FT                   SDWWQGTRTALFALRERFAEQFAQIRGIGLSGQMHGAVLLDHEDRVLRPAILWNDMRAV
FT                   EECDELYRRAPDLHRIAGNLAMPGFTAPKLLWVARHEPEIFRQTACVLLPKDYLRLQLT
FT                   GDKVSDPSDAAGTLWLDVAQRDWSDTLLAACHLNRSHMPRLAEGSAPSGMLRAELAREL
FT                   GLREPVVVAAGGGDNATSAIGIGATQPGDGFVSLGTSGVLCVIGDSFRPNPESAVHAFC
FT                   HAIPDRWHQMSVVLSAASCLRWVCKLTSTDEPTLLAEVDKLPDETLVTAPLFLPYLSGE
FT                   RTPHNDPYAQGVFFGMTHATDRALLGYAVLEGVTLALTDGLDALRAAGTEVNALSLLGG
FT                   GARSNYWAQLLADSLNTTTRKHGGGETGAALGAARLGWLAAGGDPAKVLTKPPIEAEFT
FT                   PNPQRHAVLRERLASYRALYRHVKPMFAPAREANTA"
FT   gene            complement(567970..569379)
FT                   /locus_tag="Bphy_0498"
FT   CDS_pept        complement(567970..569379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0498"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: bxe:Bxe_A0730 putative
FT                   D-arabinitol 4-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69690"
FT                   /db_xref="GOA:B2JDH3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH3"
FT                   /protein_id="ACC69690.1"
FT                   /translation="MNSGPSSGASKQVILHIGAGSFHRAHQAWYLHRLNEARQPTDPHW
FT                   SLTVGNIRSDMNAVADALAAQNGVYTLETVTPQGKRAYETIRSIERVVPWSPNLDALVE
FT                   AGADPACKIIAFTVTEGGYYLDEHDRLDTVNPDLAADLNGARTTIYGALAAILEARMQR
FT                   NAGPVTLQTCDNLRSNGERFRAGMTQFLDGRGASVLRQWFDTNTACPNSMVDRITPRPT
FT                   PDVRERVKAATGVDDACPVMGESFIQWVIEDHFIAGRPAWEQVGAELVESVLPYEEAKI
FT                   RILNATHSCIAWAGTLVGLSFIHEGTLDPEIRQFAHDYVTQDVIPCLTPSPLDLAKYRD
FT                   VVLERFGNPYIQDTNQRVAADGFSKIPGFIAPTLSECFARKVEPNATAMLPALFLRFLD
FT                   RWQRGQLPYTYQDGVMDESVARGFFKAGDSVQAFCADRLLWGSMAGSAALESVVRSALG
FT                   RVDAWLDKRRK"
FT   gene            569948..570967
FT                   /locus_tag="Bphy_0499"
FT   CDS_pept        569948..570967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0499"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bte:BTH_I2436 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69691"
FT                   /db_xref="GOA:B2JDH4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH4"
FT                   /protein_id="ACC69691.1"
FT                   /translation="MQPDLELVTVRRDESFKAWYHGFPYRTVRWHFHPEFEIHLIVATT
FT                   GKMFVGDYIGPFAPGNLVLMGPNLPHNWVSEVPEGVTIEQRNLVVQFPQDFVAHCTQSF
FT                   PEWRTLEALLADSRRGVSFGAQTSAKIQPLFMELLDARGLRRIVLFLSMMEILLNASDR
FT                   ELLASPAYQIDPTSYASTRINHVLSYIGKNLSSELRESELAQLAGQSVSAFSRYFRRHT
FT                   GLTFVQYVNRMRINLACQLLMDDELSVTDICYKVGFNNLSNFNRQFLTAKGMAPSKFRR
FT                   FQQLNDASRVASEAAAAQGKGIANAPSIVPAAQTQVHAHGQPRAAPAHPPRGSPLPTN"
FT   gene            571056..572021
FT                   /locus_tag="Bphy_0500"
FT   CDS_pept        571056..572021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0500"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bam:Bamb_4201 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69692"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDH5"
FT                   /protein_id="ACC69692.1"
FT                   /translation="MTHSNASNGTSQQPRTLRLRATLAFAAVMLGTPLLAPAAADAAPL
FT                   KIGMTFQELNNPYFVTMQKALNDAAASIGATVVVTDAHHDVSKQVSDVEDMLQKKIDIL
FT                   LVNPTDSTGIQSAVTSAKKAGAVVVAVDANANGPVDSFVGSKNFDAGQMSCEYLAKAIG
FT                   GSGEVAILDGIPVVPILERVRGCKAALAKFPNVKVVDTQNGKQERATALSVTENMIQAH
FT                   PNLKGIFSVNDGGSMGALSAIESSGKDIKLTSVDGAPEAITAIQKPNSKFIETSAQFPR
FT                   DQIRLAIGVALAKKWGANVPKTIPVDVKLVDKDNAKGFSW"
FT   sig_peptide     571056..571184
FT                   /locus_tag="Bphy_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.758 at
FT                   residue 43"
FT   gene            572085..573620
FT                   /locus_tag="Bphy_0501"
FT   CDS_pept        572085..573620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0501"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bch:Bcen2424_4819 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69693"
FT                   /db_xref="GOA:B2JDR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDR7"
FT                   /protein_id="ACC69693.1"
FT                   /translation="MDTILKLDNITKSFPGVKALQGIHLEIARGEIHALLGENGAGKST
FT                   LMKILCGIYQPDDGTIVIDGEARHFMSYHDAVAAGVGIVFQEFSLIPYLNAVENMFLGR
FT                   ELHNLFGMLERTKMRRAAAQIFARLGVAIDLSVPIRELSVAQQQFVEIGKALSLNARIL
FT                   ILDEPTATLTPAEAEHLFTIMRDLKQQGVAMIFISHHLEEIFEVCDRITVLRDGQYVGM
FT                   TDVAQTDVSRLVEMMVGRKIENSFPPKPTLPPDAKHVLEVNALQLHKDGPVNRFSLREG
FT                   EILGFAGLVGSGRTETALAVIGADAAHVKDIRVNGAAVNLTDPADALKSGIGILPESRK
FT                   TEGLITSFSIKQNISINNLGKYRTARFFIDHGSEAKATADIMKRVGVKAPTMHTEVATL
FT                   SGGNQQKVVIARWLNHHTNILIFDEPTRGIDVGAKAEIYVLMRELTARGYSIIMISSEL
FT                   PEIVGMCDRVAVFRQGRIEAILEGEQIESNAVMTYATAGATAGTRGAMQHEHA"
FT   gene            573607..574608
FT                   /locus_tag="Bphy_0502"
FT   CDS_pept        573607..574608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0502"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bur:Bcep18194_B0886 ABC sugar transporter, inner-membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69694"
FT                   /db_xref="GOA:B2JDR8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDR8"
FT                   /protein_id="ACC69694.1"
FT                   /translation="MNTPNSSPKTSTVASDTPGAPLRLNWASIKRSTLFYPFIGLLVVC
FT                   IVMVFASDSFLSGANLENVLRQVSINAIIAVGMTAVILTGGIDLSVGSVMALSGTLAAG
FT                   LMVAGLNGVAAIVIGVAVGLGFGVANGFFVAFAGMPPIIVTLATMGIARGLALIYTGGY
FT                   PIDGLPEWVSFFGSGKVFGIQAPVLIMLVVYAIAWLLLERMPFGRYVYAIGGNEQATRL
FT                   SGVRVARVKLIVYTIAGLTSSLAAIVLTSRLMSGQPNAGVGFELDAIAAVVMGGTSISG
FT                   GRGSIIGTLIGALLLGVLNNGLNMVGVNPYVQNVIKGGIILLAIYISRERKK"
FT   gene            574653..575741
FT                   /locus_tag="Bphy_0503"
FT   CDS_pept        574653..575741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0503"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bam:Bamb_4198 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69695"
FT                   /db_xref="GOA:B2JDR9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDR9"
FT                   /protein_id="ACC69695.1"
FT                   /translation="MTTQDNSKSMTAIVCHAPKDYRVERVTKPQARAHELVIRIAACGI
FT                   CASDCKCHSGAKMFWGGPSPWVKAPVIPGHEFFGYVEELGEGAAEHFDVKKGDRVIAEQ
FT                   IVPCGKCRYCRSGQYWMCEVHNIFGFQREVADGGMAEYMRIPPTAIVHKIPDGISLEDA
FT                   AIIEPLACAIHTVNRGDIQLDDVVVIAGAGPLGLMMTQVAHLKTPKKLVVIDLVDERLE
FT                   LAREYGADVTINPKNDDALAIVKSLTDNYGCDVYIETTGVPAGVNQGMDLIRKLGRFVE
FT                   FSVFGAETTMDWSIIGDRKELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFSLEE
FT                   WDEAIKVANSLDSIKVLLKPAR"
FT   gene            575810..577354
FT                   /locus_tag="Bphy_0504"
FT   CDS_pept        575810..577354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0504"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bam:Bamb_4197
FT                   xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69696"
FT                   /db_xref="GOA:B2JDS0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS0"
FT                   /protein_id="ACC69696.1"
FT                   /translation="MNYVIGVDIGTQSTKAVLVDQNGTIAAQHSSSYHPDTPKPLWAEQ
FT                   WPTVWTKAVVECIARCVAKAREAGVASNAIKAVCVSSLYGGSGIPVDSDMKPLYPCLIW
FT                   MDRRATAQVEWVRENVDLDRLYAITGNSVDSYYGYTKMLWLRDNEPNVWANTRFFLPPN
FT                   AYVIYLLTGEVAVDHSSAGNIGGVYDIAKRDWSDEALDMLGIPATMMPEHLVESSDVVG
FT                   GLLSQWTEQLGLEAGTPIVAGGVDAAMATYAAGVTRAGQHVAMIGTSMCWGYINQSVDA
FT                   RHGLVSMPHVFNGLRDIYVFGGAITAGASVTWYREQFCHAEIEAAKAIPDGDAHQLLEE
FT                   DAAQIPAGADGVMFLPYLMGERSPVWDAKASGAFVGLNLYHTRAHLYRAVLEGVAFALQ
FT                   HNIVAGRKGAKSLDDKLIVVGGAAHSDLWMSIIADITGFPVYTIEQEVEAAMGAALLAA
FT                   YGTRLISQETARGGWVKLIERVKPDAARQAMYAERFGIYTELYPALKPVMHRLQAK"
FT   gene            577351..578091
FT                   /locus_tag="Bphy_0505"
FT   CDS_pept        577351..578091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0505"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bte:BTH_I2430 oxidoreductase, short
FT                   chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69697"
FT                   /db_xref="GOA:B2JDS1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS1"
FT                   /protein_id="ACC69697.1"
FT                   /translation="MNMTFDFSGRSILVTGASSGIGRTTVELLCASGAQVVAAARNVGE
FT                   LARLAEEAGCEPLVLDVGNEHAIDEALGSLDVVFDGLVNCAGTTVLERAIDTTAASFDN
FT                   VMNVNARGAALVARHVARGMIGARRAGSIVNVSSQAALVGLEDHLSYCASKAAMDAITR
FT                   VLCVELGGHGIRVNSVNPTVTLTPMAVKAWSEPFKRDPALQAIPLKRFAEPREVAEPIL
FT                   FLLSDAASMISGVALPIDGGYTAR"
FT   gene            complement(578240..579175)
FT                   /locus_tag="Bphy_0506"
FT   CDS_pept        complement(578240..579175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0506"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /note="TIGRFAM: tryptophan 2,3-dioxygenase; PFAM:
FT                   tryptophan 23-dioxygenase; KEGG: bxe:Bxe_A0733 putative
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69698"
FT                   /db_xref="GOA:B2JDS2"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS2"
FT                   /protein_id="ACC69698.1"
FT                   /translation="MTDHMKMMEATPAQGCPFGHGGTPTLRTDHASHMAVDEGEGWHDA
FT                   QLDFSKSMSYGDYLSLGSILRAQHPLSPDHNEMLFIIQHQTSELWMKLALYELRAALAC
FT                   VHRDELPPAFKMLARVSRILEQLVQAWNVLSTMTPSEYTSMRPFLGSSSGFQSYQYREL
FT                   EFMLGNKNEQMLKPHAHHPDVLAEVKAALEAPSFYDEVIRLLSRRGFAIDSSRLERDWT
FT                   QPTVYDASVEAAWLEVYRNPSQHWELYEMAEELVDLEDAFRQWRFRHVTTVERIIGFKQ
FT                   GTGGTSGAPYLRKMLDVVLFPELWQVRTML"
FT   gene            complement(579186..580436)
FT                   /locus_tag="Bphy_0507"
FT   CDS_pept        complement(579186..580436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0507"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase; PFAM: aminotransferase class
FT                   V; KEGG: bxe:Bxe_A0734 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69699"
FT                   /db_xref="GOA:B2JDS3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS3"
FT                   /protein_id="ACC69699.1"
FT                   /translation="MNQREEALAFDAADPLAPLRDQFALAPNVIYLDGNSLGVPPAAAA
FT                   QRAQTVIGAEWGEGLIRSWNTAGWFSLPRRLGNKLATLIGAAHNEVVVTDTISVNLFKL
FT                   LSAALRMQDKRDPKRRVIVSERSNFPSDLYIAQGLIKLLDRGYALRLIDDPSELPAALT
FT                   DDVAVAMITHVNYRTGYMHDMAAVTKLIHDRGALALWDLAHSAGAVPVDLNGVGADCAV
FT                   GCTYKYLNGGPGSPAFAWVPHRHQGDFEQPLSGWWGHRAPFAMDPTYAADDGIGRFLCG
FT                   TQPMVSMALVECGLDVFLQTDMQAIRKKSLALTDLFIELVETRCKEFPLELVTPRAHAQ
FT                   RGSHASFEHPHGYEVMQALIARGVIGDYREPHVLRFGLTPLYTRYVDVWDAVEHLRHVL
FT                   AHETWRAPEFAARGAVT"
FT   gene            complement(580483..581112)
FT                   /locus_tag="Bphy_0508"
FT   CDS_pept        complement(580483..581112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0508"
FT                   /product="arylformamidase"
FT                   /note="TIGRFAM: arylformamidase; PFAM: cyclase family
FT                   protein; KEGG: bxe:Bxe_A0735 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69700"
FT                   /db_xref="GOA:B2JDS4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR017484"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDS4"
FT                   /protein_id="ACC69700.1"
FT                   /translation="MDTLWDITPAVDTATPVWPGDTPVGIERVWRMEAGSPVNVARLTM
FT                   SPHTGAHTDAPLHYDAGGVAIGAVPLDSYLGRCRVIHCIGVKPLVMPDDLAGSLDGVPP
FT                   RVLLRTYREAPTTFWDSGFCAVAPETIDLLAARGVKLIGIDTPSLDPQESKTMDAHHRI
FT                   RAHRMAILEGIVLDAVAPGDYELIALPLKLSTLDASPVRAVLRSLT"
FT   gene            581244..581747
FT                   /locus_tag="Bphy_0509"
FT   CDS_pept        581244..581747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0509"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   bxe:Bxe_A0736 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69701"
FT                   /db_xref="GOA:B2JDS5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS5"
FT                   /protein_id="ACC69701.1"
FT                   /translation="MNAISLDATDCRILTVLQHEGRISNLDLAERISLSPSACLRRLRL
FT                   LEEQGVIERYRACLNREVLGFELEAFVQVSMRNDHENWHERFAEALRDWPEVIGAFVVT
FT                   GETHYLLRVLAHNLKHYSDFVLGRLYKAPGVMDIRSNIVLQTLKEDSGVPVSLVTSPKV
FT                   QQPG"
FT   gene            complement(581797..582321)
FT                   /locus_tag="Bphy_0510"
FT   CDS_pept        complement(581797..582321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0510"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: bxe:Bxe_A0737 putative flavin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69702"
FT                   /db_xref="GOA:B2JDS6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS6"
FT                   /protein_id="ACC69702.1"
FT                   /translation="MPQPMKRANPPNFDDAAFRRALSQFATGVTVITTRAPSGALIGIT
FT                   ASSFNSVSLTPPLVLWSLATRSASMPVFRSNSHYVVNVLASSQLDLCKRFATVKGDRFE
FT                   GVSHAAGDTGMPVLDGALAWFECHNRSRYDEGDHVIFVGEVERCGVHEQAAEIAPLVFQ
FT                   NGGFHGLTLLD"
FT   gene            582616..583167
FT                   /locus_tag="Bphy_0511"
FT   CDS_pept        582616..583167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0511"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: bxe:Bxe_A0738
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69703"
FT                   /db_xref="GOA:B2JDS7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS7"
FT                   /protein_id="ACC69703.1"
FT                   /translation="MSQSVETATLGGGCFWCLEAVFLGVDGVTSVESGYAGGQTDNPSY
FT                   EQVCDGNTGHAEVVKVEFDPARISYREVLDIFFAIHDPTQLNRQGNDVGTQYRSVIFTH
FT                   SDAQRETALQAIREIGAEGVYDGQIVTQVLSLDGNYWAAEAYHQNYFAQHPDQGYCAFV
FT                   VAPKVAKFRQKFAHRIKAGA"
FT   gene            complement(583234..584373)
FT                   /locus_tag="Bphy_0512"
FT   CDS_pept        complement(583234..584373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0512"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   bxe:Bxe_A0739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69704"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS8"
FT                   /protein_id="ACC69704.1"
FT                   /translation="MQQDTPAGTAQPDMFGNPVEEATASSATDAAPFASASQTAQPPPG
FT                   KRRARDVLAASPSDDLLQLASQLPPQVHLGTSTWSFPGWKGIVYGDDYSNSKLSRDGLA
FT                   AYGAHPLLRTVSIDRSFYQALTLTDYLRYAQQVPDHFRFIVKAPALVTDATVRAERGEP
FT                   VSGNPCFLNAQLAIDEFVRPCIDGLRAKAGALVFQFSPLPNAMLAQPALFVERLTAFLA
FT                   ALPKLEGDTCYAVEIRDACLLTPRLIRALKATGVRYCVGIHARMPEPSRQAAALAMLDD
FT                   EPSGPLIVRWSLHGGFKYEQAKAKYEPFDKLVDEDPDTRTALAELAARYAIAGQPVLIA
FT                   ANNKAEGSAPLTCVKLAEHIAAACERLRGAQKENAAEAA"
FT   gene            complement(584456..585670)
FT                   /locus_tag="Bphy_0513"
FT   CDS_pept        complement(584456..585670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0513"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   bxe:Bxe_A0740 cyclopropane-fatty-acyl-phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69705"
FT                   /db_xref="GOA:B2JDS9"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDS9"
FT                   /protein_id="ACC69705.1"
FT                   /translation="MFWEKKLAQWVEEVKAKANIPARLVLWDGQQHDFGTFAAPQVTLK
FT                   VNSASALPLLLEPSLDNLGEAYVKGKIDIEGKLSDIINISYSLARSTVTSASKLARVRR
FT                   YFNHTKTSDKKAIQYHYDVSNEFYRLWLDENMVYSCAYFENGNEDLATAQIKKIDHILT
FT                   KIQVQPGHRLLDIGCGWGALVLRAAQKFGARCVGVTLSQNQFDLATQRVKDAGLEGQIE
FT                   IRLQDYRDVEGQFDRITSVGMFEHVGRKNLPGYFQKIHDLLVDDGIAMNHGITSTDYDS
FT                   GETALGGGEFIDRYVFPDGELPHISLALESMQRGGLEAFDVESLRRHYARTLDIWTENF
FT                   EANAAKARTLVEDEKFRIWRVYLAGCAYAFENDDVSIYQVVCRKAGRSAQTLPWSRRFM
FT                   YEKAL"
FT   gene            complement(585846..586484)
FT                   /locus_tag="Bphy_0514"
FT   CDS_pept        complement(585846..586484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0514"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: bxe:Bxe_A0741 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69706"
FT                   /db_xref="GOA:B2JDT0"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDT0"
FT                   /protein_id="ACC69706.1"
FT                   /translation="MSTLADLRKNYSLGSLDISDVDPNPFGQFDRWFKQAIDAQLPEPN
FT                   TMTLATADARGRPSARIVLIKGVDERGFVFFTNYESRKGQELAQNPHASLLFYWIELER
FT                   QVRIEGTVVKTSPEESDAYFASRPVGSRIGAWASEQSKVIESRAALEAREREFSAQYGE
FT                   NPPRPPHWGGYRLIPDAIEFWQGRPSRLHDRLLYTHSGGAGWTITRLSP"
FT   gene            586736..587596
FT                   /locus_tag="Bphy_0515"
FT   CDS_pept        586736..587596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0515"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   bxe:Bxe_A0742 ThiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69707"
FT                   /db_xref="GOA:B2JDT1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT1"
FT                   /protein_id="ACC69707.1"
FT                   /translation="MSTPLVTGQSDLTTDQNEHAAADRARRFGGVARLYGADALTAFER
FT                   AHVAVIGIGGVGSWAAEALARTAIGKITLIDLDNVAESNTNRQVHALDGNYGKPKVDAM
FT                   AERIKLIDPQCDVRLIEDFIEPDNFDKVLGAGFDFVVDAIDSVRTKTALIAWCVEHRQP
FT                   LITVGGAGGQLDPTRIRIDDLAQTIQDPLLSKVRAQLRKQHGFPRGPKAKFKVSAVYSD
FT                   EPLIYPEAAVCDIDELAEHVTTSPGHHGPVGLNCAGFGSSVCVTASFGFAAVSHVLRAL
FT                   AKQAA"
FT   gene            complement(587687..588535)
FT                   /locus_tag="Bphy_0516"
FT   CDS_pept        complement(587687..588535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0516"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: bxe:Bxe_A0743 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69708"
FT                   /db_xref="GOA:B2JDT2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT2"
FT                   /protein_id="ACC69708.1"
FT                   /translation="MDTTLATFEKDVISASMLAPVLVDFWAPWCGPCKTLGPMLEKLEA
FT                   EYEGKWRLVKVNVDENQELAAHFQVRSIPHVVAFADGRPVDQFIGVLPEGQLRQFLDRL
FT                   VPDGAEAARAEASIAIAEGRREDAYNALKAALAYDPGFDEARLDLMELLLEDNRIDEAQ
FT                   NENDLLSPKTTQGIDARYNAIKTRLDAVDAAADLPPTGALEARVAENPDDLEARFDLAS
FT                   ALIARRKYDPALEHLLAIVQRDRTFREDIGRKTMLSVFDLAAHQPELVGKWRRRLSALL
FT                   N"
FT   gene            complement(588649..589530)
FT                   /locus_tag="Bphy_0517"
FT   CDS_pept        complement(588649..589530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0517"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: bxe:Bxe_A0744
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69709"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT3"
FT                   /protein_id="ACC69709.1"
FT                   /translation="MSTSIKAVLKPHVRDIGNLAVRRVLPAMAARLVGPFIFFDHMGPA
FT                   TLPAGTGLDVRPHPHIGLATVTYLFEGAIMHRDSLGSEQKIVPGDVNWMTAGRGIVHSE
FT                   RTPEPERMNGSTVHGIQTWVALPLADEDAEPSFEHHPGATLPEVERNGVVLRIIAGQSF
FT                   GKTAPTRTFSGTLYAAAHFSPGSALALEPEHEERGVYLVDGDLSLDGVPLDIATMAVLI
FT                   PGETITLASTKGATVMLLGGEKLEGERFIEWNFVASSREKIEQAKLAWTNQEMGKVPGE
FT                   TEWIPLPERKPR"
FT   gene            589700..590581
FT                   /locus_tag="Bphy_0518"
FT   CDS_pept        589700..590581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0518"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_A0745 drug/metabolite efflux
FT                   pump, DME (10TM) family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69710"
FT                   /db_xref="GOA:B2JDT4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT4"
FT                   /protein_id="ACC69710.1"
FT                   /translation="MSPKDLLLALVVVVAWGVNFVVIKVGLHGVPPMLLGALRFMLAAF
FT                   PAVFFIKRPQMPWRWLLAYGATISLGQFAFLFSAMYVGMPAGLASLVLQAQAFFTLGFA
FT                   ALFLHERLRAQNVLGLVIAAAGLGVIGIQGGHSMTLAGFILTLCAAVMWALGNIVTKKV
FT                   GKVDLVGLVVWGSLIPPVPFFVLSYLFEGPRRIEAALTGIGESSLFAIVYLAFVATLLG
FT                   YGLWSRLLSRYAAGQVAPFSLLVPIVGLASASVFLDESLSAAQIGGAVLVMAGLAVNVF
FT                   GGRVVERFSLAR"
FT   gene            complement(590711..592258)
FT                   /locus_tag="Bphy_0519"
FT   CDS_pept        complement(590711..592258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0519"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   bxe:Bxe_A0746 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69711"
FT                   /db_xref="GOA:B2JDT5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT5"
FT                   /protein_id="ACC69711.1"
FT                   /translation="MSRKMLIKPFRSIESAATATHNWRRRQILHAGASTLVLGLAAPRL
FT                   ALASSVLGVRVWPARDYTRVTIESDQPLQNTQQLLQGPDRLVVDLNGLDLDQALKDLVS
FT                   KIAPNDPQIQSVRVGQYQPHVVRMVFDLKGSVKPQVFTLPPVGAYKYRLVFDLYPAVAP
FT                   DPLMDLLAQTERKEQQLKDNAAPPAATLNGPTTPPGDNSDAFFEKYAQNNAPSPAAPVP
FT                   HPPLHGAPAPTPHMPPKPAPTPAPPVIARNNDSDADNAGDNNDDEYKFTAPKKGSNTVR
FT                   LLTVAIDPGHGGEDPGAIGGSGTYEKHVALDIAKKLRAKIDAQPNMRAMMTRDADFFVP
FT                   LNVRVQKARRVGADLFVSIHADAFTTPEASGSSVFALSEHGASSAAARWMANKENSSDQ
FT                   IGGINIKSADASVNRALFDMSTTAQIRDSMRYGTFVLKEIGGINRLHKGSVEQAGFAVL
FT                   KAPDIPSILVETAFISNPDEERRLNDDAYRDKMANAIMSGIKRYFAANPPLAKSRMT"
FT   sig_peptide     complement(592112..592258)
FT                   /locus_tag="Bphy_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 49"
FT   gene            complement(592240..592794)
FT                   /locus_tag="Bphy_0520"
FT   CDS_pept        complement(592240..592794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0520"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   bxe:Bxe_A0747 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69712"
FT                   /db_xref="GOA:B2JDT6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT6"
FT                   /protein_id="ACC69712.1"
FT                   /translation="MPDHTGPANRSTAAVLLEREFALADEAATTAFGARFAHAIDSVRN
FT                   EARATGQRAFDGLQVQLHGDLGAGKTTLVRATLRALGHAGRVRSPTYTLVEPYAVERPD
FT                   GELELYHFDLYRFNDPAEWADAGFREYFDSGAICLVEWPERAGSLLGVPDLVFSLDVDG
FT                   DGRVLVARAYSEPGKACLERC"
FT   gene            592812..594104
FT                   /locus_tag="Bphy_0521"
FT   CDS_pept        592812..594104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0521"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   domain of unknown function DUF1730; KEGG: bxe:Bxe_A0748
FT                   4Fe-4S cluster binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69713"
FT                   /db_xref="GOA:B2JDT7"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT7"
FT                   /protein_id="ACC69713.1"
FT                   /translation="MNQGQQHPMPDPQTGAQCDPHSSPRATDEATDVTRRFDEAQLAAL
FT                   ASRIRDWGRELGFGAVGISDIDLSHAEAGLAAWLDAGCHGEMDYMAKHGMKRARPAELV
FT                   AGTRRVISVRMAYLPTHATPHAADSPAARKDAESAAADVQHDWRLEERARLNDPSAAVV
FT                   SIYARGRDYHKVMRNRLQHLAERIEGEIGPYGYRVFTDSAPVLEVELAQQAGTGWRGKH
FT                   TLLLQRDAGSLFFLGEIFVDLPLPTDAETSPERAPETPGAHCGSCTRCIGACPTGAIVA
FT                   PYQVDARRCISYLTIELKGSIPQDLRPLIGNRVYGCDDCQLACPWNKFAQAAPVADFDV
FT                   RHGLDRASLVELFGWSADEFDTRLQGSAIRRIGYECWLRNLAVGMGNALRAARESLPAE
FT                   ARAAIVDALRRRAGDPSPLVREHVAWALEAA"
FT   gene            594145..594615
FT                   /locus_tag="Bphy_0522"
FT   CDS_pept        594145..594615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0522"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: bxe:Bxe_A0749
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69714"
FT                   /db_xref="GOA:B2JDT8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT8"
FT                   /protein_id="ACC69714.1"
FT                   /translation="MFNAVIDAPFGKIGVRLESETVREIVYLPDSVANVEPDSPLAKQA
FT                   VEQIEHYLQQASARFDLPLADVGTPFQRRVWKAIGEIPPGVVLTYGQLAKQIGSVPRAV
FT                   GQACGSNFFPIVIPCHRVVASGGIGGFAHTGGDGYYRNVKRWLLKHEGVPYA"
FT   gene            594612..595559
FT                   /locus_tag="Bphy_0523"
FT   CDS_pept        594612..595559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0523"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: bxe:Bxe_A0750 putative phage
FT                   integrase/recombinase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69715"
FT                   /db_xref="GOA:B2JDT9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDT9"
FT                   /protein_id="ACC69715.1"
FT                   /translation="MTDVLTEDAQPASPAVSPLLLTSGASIDAFCDALWLEHGLARNTL
FT                   DAYRRDLRLFSEWLAERRDASLDAASEADLTAYSAARSADKSTSANRRLSVFRRYYAWA
FT                   VREHRASADPTLRIRSAKQPPRFPSTLTEAQVEALLGAPDVTTPLGLRDRTMLELMYAS
FT                   GLRVSELVTLKTVEVGLNEGVVRVMGKGSKERLIPFGEEAHAWIERYLRESRPALLGQR
FT                   SADALFVTARAEGMTRQQFWNIIKRHALTAHVHAPLSPHTLRHAFATHLLNHGADLRVV
FT                   QLLLGHTDISTTQIYTHVARERLKSLHAAHHPRG"
FT   gene            complement(595584..597161)
FT                   /locus_tag="Bphy_0524"
FT   CDS_pept        complement(595584..597161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0524"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bxe:Bxe_A0751 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69716"
FT                   /db_xref="GOA:B2JDU0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU0"
FT                   /protein_id="ACC69716.1"
FT                   /translation="MNTAQHSPDASRSVLVDVAALLAALPERIAGIPKLIAARNPQHPA
FT                   LIEDERRLTRAQLVGAVDGVAALLADRGVRAGDRVMIVAENSIVQIVLMFAAAKLDAWA
FT                   LMSNARLSAAELDAIRAHAQPRLVAYAVGVSPDARQHAERHGAQAAPTLAADIGAWSYA
FT                   LDDNTQAEAVETASDRQCAALIYTTGTTGSPKGVMLSHRNLLFIAAMSSTLRRVNADDV
FT                   VYAVLPISHVYGLASVCLGSLYAGATLRLAPRFSPEAVRRALAEERVSIFQGVPAMHAK
FT                   LLEYLQANGLPWSAPHLRFAYSGGSPLDAALKARVESVYGVALHNGYGMTESSPTVSQT
FT                   MIESPRADCSVGQAIPGIEVRFVGSDGVDVAQGEVGELWVRGPNVMLGYYRNPQQTLAT
FT                   VTRDGWLRTGDLAREDADGAMHIAGRSKELIIRSGFNVYPAEVEHVLNAHPDVVQSAVI
FT                   GRAVADNEEVVAFVELSGSAAATPDDLATWCDARLAPYKRPAEIRVLAALPAASTGKIL
FT                   KHRLRDLI"
FT   gene            597309..597836
FT                   /locus_tag="Bphy_0525"
FT   CDS_pept        597309..597836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0525"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: bxe:Bxe_A0752
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69717"
FT                   /db_xref="GOA:B2JDU1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU1"
FT                   /protein_id="ACC69717.1"
FT                   /translation="MAVASRGHYNAPMSKSRHVSETPATQFLRRHKVKFGEHPYDYVDH
FT                   GGTEESARQLGVDEHHVVKTLVMEDEHARPLIVLMHGDRTVSTKNLARQIGAKRVEPCK
FT                   PEVASRHSGYMIGGTSPFGTKKTMPVYVETTILDMDGIYINGGRRGFLVSIAPSVLTSL
FT                   LDAKPVQCASVD"
FT   gene            597994..598626
FT                   /locus_tag="Bphy_0526"
FT   CDS_pept        597994..598626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0526"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   bxe:Bxe_A0753 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69718"
FT                   /db_xref="GOA:B2JDU2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDU2"
FT                   /protein_id="ACC69718.1"
FT                   /translation="MENLIVAVVAYLIGSVSFAVIVSAAMGLADPRSYGSKNPGATNVL
FT                   RSGNKKAAILTLIGDAFKGWLAVWLTGHFSAHFGLDDTSVAIAAIAVFLGHLYPVFFRF
FT                   KGGKGVATAAGVLLAINPILGIATLLTWLIVAFFTRYSSLAALCAAIFAPLFDGFLFGA
FT                   NVIALSIVAMSALLIWRHRANIAKLVAGQESRIGDKKKAEAAASHKH"
FT   sig_peptide     597994..598068
FT                   /locus_tag="Bphy_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.640 at
FT                   residue 25"
FT   gene            complement(598702..599187)
FT                   /locus_tag="Bphy_0527"
FT   CDS_pept        complement(598702..599187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0527"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   bam:Bamb_2603 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69719"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDU3"
FT                   /protein_id="ACC69719.1"
FT                   /translation="MPSFDVVCEANMIEVKNAIEQSNKEISTRFDFKGSDARVEQKERE
FT                   LTAFADDEFKLGQVKDVLVSKMAKRNVDVRFLDYGKIEKIGGDKVKQVVTVKKGVSGDL
FT                   AKKIVKLVKDSKIKVQASIQGDAVRVTGTKRDDLQSVIAMLRKDVTDTPLDFNNFRD"
FT   gene            599359..600399
FT                   /locus_tag="Bphy_0528"
FT   CDS_pept        599359..600399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0528"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: bxe:Bxe_A0755
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69720"
FT                   /db_xref="GOA:B2JDU4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDU4"
FT                   /protein_id="ACC69720.1"
FT                   /translation="MSQPESLPFIADFPLKPHNTFGFDVRARLACRIETDAQLLAALRD
FT                   PRAAGLRRLVLGGGSNVVLTGDFDGLVLLVALRGRKVVREDDEAWYVEAAAGENWHEFV
FT                   SWTLAEGMPGLENLALIPGTVGAAPIQNIGAYGLEMCERFASLRAVELATGKLVELGAG
FT                   ACRFGYRDSFFKQEGRERFVIVSVTFRLPKVWAPRAGYTDIARQLAAVGLGDATPTPQA
FT                   IFDAVVAVRRAKLPDPFVLGNAGSFFKNPVVESAQFDALAAKEPEIVSYRQADGRVKLA
FT                   AGWLIDRCGWKGRTLGAAGVHERQALVLVNRGGASGTEVLALAKAIQQDVAQRFGVELE
FT                   AEPVCL"
FT   gene            complement(600499..601428)
FT                   /locus_tag="Bphy_0529"
FT   CDS_pept        complement(600499..601428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0529"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: bxe:Bxe_A0757 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69721"
FT                   /db_xref="GOA:B2JDU5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU5"
FT                   /protein_id="ACC69721.1"
FT                   /translation="MTAKTIRHYLQFNDFSLEDYEYVLERARILKRKFKNYETYHPLHD
FT                   RTLAMIFEKNSTRTRLSFEAGIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDII
FT                   MIRTFGQDIIQRFAENSRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDA
FT                   NNMLYTWIEAAQILGFTLRLSTPPGYKLDRALVAPESAPFYEEFDDPNEACKGADLVTT
FT                   DVWTSMGFEAENEARKKAFADWCVDADMMSRASKDALFMHCLPAHRGEEVSAEVIDGPQ
FT                   SVVWDEAENRLHVQKALMEFLLLGKLNH"
FT   gene            601890..602225
FT                   /locus_tag="Bphy_0530"
FT   CDS_pept        601890..602225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69722"
FT                   /db_xref="InterPro:IPR021969"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU6"
FT                   /protein_id="ACC69722.1"
FT                   /translation="MADTPPIEYFIQGITSNGRKFRPSDWSERLAGVMSCYGPGAKGPN
FT                   ARLQYSHYVRPTLIGDLKCVILDSRLRDIEPMAFDFVMNFAKDNDLLVTEACELPLEHA
FT                   AQKAPTR"
FT   gene            complement(602428..602706)
FT                   /locus_tag="Bphy_0531"
FT   CDS_pept        complement(602428..602706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0531"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: bxe:Bxe_A0759
FT                   ribosomal protein S20p"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69723"
FT                   /db_xref="GOA:B2JDU7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDU7"
FT                   /protein_id="ACC69723.1"
FT                   /translation="MANSAQARKRARQAAKANSHNSALRSKYRTAVKAVRKAIEAGDAA
FT                   QAAEIFKASAKTLDIIADKKIVHKNKAARHKSRLAAAVKGLQAPAAQ"
FT   gene            603187..604737
FT                   /locus_tag="Bphy_0532"
FT   CDS_pept        603187..604737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0532"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; KEGG: bxe:Bxe_A0760
FT                   virulence factor MviN-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69724"
FT                   /db_xref="GOA:B2JDU8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU8"
FT                   /protein_id="ACC69724.1"
FT                   /translation="MNLFRALLTVSGFTLLSRVTGLARETLIARAFGASQYTDAFYVAF
FT                   RIPNLLRRISAEGAFSQAFVPILAEFKNQQGHDATKALVDATSTVLAWALAIMSLLGVV
FT                   GASWVVLVVASGLRGDGQAFTLAVSMTRIMFPYIVFISLTSLASGVLNTYKHFSLPAFA
FT                   PVLLNVSFIIAAVFVAPLMKVPVFALAWAVIAGGIAQFIVQLPGLKKIDMIPRIGLNPL
FT                   KALAHRGVKRVLAKMVPAMFAVSVAQISLIINTNIASHIGPGAVSWINYADRLMEFPTA
FT                   LLGVALGTILLPSLSKAHVDADAHEYSSLLDWGLRVTFLLAAPSAVALFFFAEPLTATL
FT                   FHYGKFDGNAVVMVGRALAAYGVGLIGLILIKILAPGFYAKQDIKTPVKIGVFVLVVTQ
FT                   LSNYVFVPVFAHAGLTLSVGLGACVNALCLFIGLRRRGIYMPSAGWSVFFVQLVGACLV
FT                   LAGVMHWFAINFDWIGMHAEPLRRMALLAACLVLFAALYFGMLWLMGFKYAYFRRRVK"
FT   sig_peptide     603187..603258
FT                   /locus_tag="Bphy_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            604734..605585
FT                   /locus_tag="Bphy_0533"
FT   CDS_pept        604734..605585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69725"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDU9"
FT                   /protein_id="ACC69725.1"
FT                   /translation="MITTTRVLDYFSALVAEDDGLPLTEAALSLAQDAYPDLDLQAVLA
FT                   EIDELALRVKRRIPDDADIQQRVGILNRYFFRELGFAANVNDYYDPDNSHLNMVLKRRR
FT                   GIPISLAVLYLEMASQVDIPVRGVAFPGHFLLRVTLPEGDAMIDPTTGHPLTEAEMVEM
FT                   LEPYVAKAGESVSRALRMLLQPATRREIIARMLRNLKATYLQTERWQRLLAVQQRLVIA
FT                   LPESIEEVRDRGFAYARLDFLRPALEDLERYLGDRPDAEDATVVESQLLELRQRTQHND
FT                   RD"
FT   gene            complement(605666..606424)
FT                   /locus_tag="Bphy_0534"
FT   CDS_pept        complement(605666..606424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0534"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A0762 3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69726"
FT                   /db_xref="GOA:B2JDV0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV0"
FT                   /protein_id="ACC69726.1"
FT                   /translation="MDIKDNVFLVTGGASGLGAATARLFAQNGGKVVLADLNHDAGTAL
FT                   AQELGGVFVKCDVSREDDAAQAVEAATKLGALRGLVNCAGVAPAMKTVGKDGPHPLHSF
FT                   ARTVSINLVGTFNMIRLAAAEMSKLEPNALGERGVIVNTASVAAFDGQIGQAAYAASKA
FT                   GVAGMTLPIARDLSRNAIRVMTIAPGIFETPMLLGMPQEVQDALGAMVPFPPRLGKPNE
FT                   YAMLVKQIFDNPMLNGEVIRLDGAIRMQPK"
FT   sig_peptide     complement(606344..606424)
FT                   /locus_tag="Bphy_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.838 at
FT                   residue 27"
FT   gene            complement(606652..607317)
FT                   /locus_tag="Bphy_0535"
FT   CDS_pept        complement(606652..607317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0535"
FT                   /product="Nucleoside-triphosphate--adenylate kinase"
FT                   /EC_number="2.7.4.10"
FT                   /note="PFAM: adenylate kinase; adenylate kinase lid domain
FT                   protein; KEGG: bxe:Bxe_A0763 adenylate kinase, subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69727"
FT                   /db_xref="GOA:B2JDV1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDV1"
FT                   /protein_id="ACC69727.1"
FT                   /translation="MRLILLGAPGAGKGTQANFIKEKFGIPQISTGDMLRAAVKAGTPL
FT                   GLEAKRYMDAGELVTDELIINLVKERLQDSDCANGYLFDGFPRTIPQAEAMKQAGVAID
FT                   YVLEIDVPFDEIITRMSGRRMHPASGRTYHVKFNPPKVEGVDDVTGEPLIQRDDDKEET
FT                   VKKRLDVYVSQTKPLIDYYNNWAQKGDPSTSLAAPQYRRISGLGSVDEIRARVFDALK"
FT   gene            complement(607579..608382)
FT                   /locus_tag="Bphy_0536"
FT   CDS_pept        complement(607579..608382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0536"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: bxe:Bxe_A0764
FT                   3-deoxy-D-manno-octulosonatecytidylyltransferase; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase; PFAM:
FT                   acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69728"
FT                   /db_xref="GOA:B2JDV2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDV2"
FT                   /protein_id="ACC69728.1"
FT                   /translation="MNDTQHTPPFIAVVPARLASTRLPNKPLADIGGKPMVVRVAERAV
FT                   ESGAQQVLIATDAQAVFDVARAHGIDAMMTRADHPSGTDRLAEVAAHYGWRDDMIVVNV
FT                   QGDEPLIDPALVRGVASHLAATDGCAIATAAHPIHDPADVFNPNVVKVVPDARGVALYF
FT                   SRAPIPWARDAYQPHWPNIAQMPAPPAPAAVYRHIGLYAYRAKFLRTYPSLSISPIEQA
FT                   EALEQLRAMWHGERIAVLVTNDAPLPGVDTPDDLARVQAFFGSSA"
FT   gene            complement(608514..608717)
FT                   /locus_tag="Bphy_0537"
FT   CDS_pept        complement(608514..608717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0537"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   bxe:Bxe_A0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69729"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDV3"
FT                   /protein_id="ACC69729.1"
FT                   /translation="MDARLLEILVCPICKGPLSYDRAAQELICNADKLAYPIRDGIPVM
FT                   LVDEARQTVEGTPVDLNPGSVA"
FT   gene            complement(608698..609714)
FT                   /locus_tag="Bphy_0538"
FT   CDS_pept        complement(608698..609714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0538"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: bxe:Bxe_A0766 tetraacyldisaccharide-1-P
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69730"
FT                   /db_xref="GOA:B2JDV4"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV4"
FT                   /protein_id="ACC69730.1"
FT                   /translation="MSDLASRLEARIAREWQQRGPLAWALTPLACVFGAVALGRRAAFK
FT                   LGWLKSVRVRVPVVVVGNVTVGGTGKTPTVIALVQALRSAGFTPGVVSRGYGAKITQPT
FT                   LVTPTSKAAQAGDEPLLIARRTGAPVFVCPDRVAAAHALCKAHRDVDVIVSDDGLQHYR
FT                   LERDAEIVVFDHRLGGNGFLLPAGPLREPLSRERDATLINNPYDRAMPPWPNTFSLDLA
FT                   PGDAWHLDNPRLRRPLAQFAGERVLAAAGIGSPERFFATLRAAGLSPDTRALPDHYAFS
FT                   TNPFVDVDADAILITEKDAVKLGAWHDARLWVVPVEATLDHRLIALVVEKVRGRSPA"
FT   gene            610302..611681
FT                   /locus_tag="Bphy_0539"
FT   CDS_pept        610302..611681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0539"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: bxe:Bxe_A0768 exonuclease VII, large subunit;
FT                   TIGRFAM: exodeoxyribonuclease VII, large subunit; PFAM:
FT                   Exonuclease VII large subunit; nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69731"
FT                   /db_xref="GOA:B2JDV5"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV5"
FT                   /protein_id="ACC69731.1"
FT                   /translation="MNSESQSSSPIGAGGDAVVPVSVLNRAIGNMLERSFPLVWVAGEV
FT                   SNFTRAASGHWYFSIKDAQAQMRCVMFRGRAQYAEFTPREGDKIEVRALVTMYEPRGEL
FT                   QLNVEAVRRTGQGRLYEAFLRLKAQLEAEGLFDPQRKRALPAHPRSIGIVTSLQAAALR
FT                   DVLTTLARRAPHIPVIVYPAPVQGAGVSAKLAAMVEAANRRHEVDVLIVCRGGGSIEDL
FT                   WAFNEEVLARAIAASDVPVVSGVGHETDFTIADFAADVRAPTPTGAAELVSPQRVLLLR
FT                   DLDHRHATLARGFGRMMERRAQQLDWLARRLVSPAERLARQRTHLQQLSVRLASAGVRP
FT                   VRDARARFSLVQMRWQRWRPDLTSHRSHVTGLAERLERALLRQHERQVARVETLAARLE
FT                   VLSPQRTLERGYAALLDAQSGRAVRAPSSLKPGRRMTVHLAEGSADIALSDVQPRLTDG
FT                   F"
FT   gene            611889..612467
FT                   /locus_tag="Bphy_0540"
FT   CDS_pept        611889..612467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0540"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   bxe:Bxe_A0769 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69732"
FT                   /db_xref="GOA:B2JDV6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV6"
FT                   /protein_id="ACC69732.1"
FT                   /translation="MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKG
FT                   TEFESLSLEEIVKKSSGGVFNNSAQVWNHTFFWNSLSPQGGGAPKGALADAINAKWGSF
FT                   DKFKEEFTKTAVGTFGSGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAY
FT                   YIDYRNARPKFVEAYWNIVNWAFAEKNFA"
FT   gene            complement(612689..614011)
FT                   /locus_tag="Bphy_0541"
FT   CDS_pept        complement(612689..614011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0541"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   bxe:Bxe_A0775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69733"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV7"
FT                   /protein_id="ACC69733.1"
FT                   /translation="MASSQDTVSMALFCDFENVALGVRDAKYEKFDIKLVLERLLLKGS
FT                   IVVKKAYCDWDRYKGFKAAMHEANFELIEIPHVRQSGKNSADIRLVVDALDLCYTKSHV
FT                   NTFVIISGDSDFSPLVSKLRENAKQVIGVGVQRSTSDLLTANCDEFIFYDDLVRESQRA
FT                   AAKRENAKPAQQAAQQPSKRAPEGEKRKEDLETRKSKAIEFAVQTFDALASERGDSGKI
FT                   WASVLKNAIKRRKPDFNETYYGFRAFGNLLEEAQSRGLLEVGRDEKSGTFVYRSAVPAA
FT                   AAPVEVVTPRETGDEWAAMPAAAEIVELEEAAVAASVVEAHAPADENVDVAPRTVPNEQ
FT                   ADEGKGETRRKDRATRKPAAKKTKKAKAERGEAVDAATGSPQPADAQHVAERVTTSDAQ
FT                   PATPEAEHPATEAPVTRKKPSRKSATRSRRPRKTEATRDTE"
FT   gene            complement(614099..614698)
FT                   /locus_tag="Bphy_0542"
FT   CDS_pept        complement(614099..614698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0542"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: esa:ESA_01374
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69734"
FT                   /db_xref="GOA:B2JDV8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV8"
FT                   /protein_id="ACC69734.1"
FT                   /translation="MTQALSIDPRSTALVLIDLQHSNVARQLAPHAAADVVARSVRAAD
FT                   ALRAAGGTVVFVRVDVAQLLSLPADAPLRSRDAPVPPPQASDLVAECNVRAGDLIVTKR
FT                   QWGAFYGTDLEQQLRRRGIRTIALTGIATNFGVESTARAAFDQGYELVFIEDAMSGLSA
FT                   DTHRFPVEHIFPRMGCVRSTEEFVGAVAENGSFGGA"
FT   gene            614747..615358
FT                   /locus_tag="Bphy_0543"
FT   CDS_pept        614747..615358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0543"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ana:all2813
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69735"
FT                   /db_xref="GOA:B2JDV9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDV9"
FT                   /protein_id="ACC69735.1"
FT                   /translation="MSLASDNQKMRRIPRQERAAKRVDALLDAAGDVIAERGFDAATMT
FT                   AIAERAGTSIGAVYQYFPNKDALVFALRTRYGDEMEAQWSALGDAAQDCSVDELVDRIF
FT                   ALMTDFMASRPAYLPLLSVTLNFRRDAAARNRLRGRFAESFQRYNPALADADAFRVAEV
FT                   ALQVVKSLNPLYAAAKPKERKALVDEYKLAVSSYLATRLG"
FT   gene            complement(615380..616033)
FT                   /locus_tag="Bphy_0544"
FT   CDS_pept        complement(615380..616033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0544"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: bxe:Bxe_A0776 peptidase S14, ClpP; TIGRFAM:
FT                   ATP-dependent Clp protease, proteolytic subunit ClpP; PFAM:
FT                   peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69736"
FT                   /db_xref="GOA:B2JDW0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW0"
FT                   /protein_id="ACC69736.1"
FT                   /translation="MHRHFTSPANTGFNLVPTVIEQSGRGERAYDIYSRLLRERIVFLV
FT                   GPVNDQSASLIVAQLLFLESENPDKDISFYINSPGGSVYDGLAIFDTMQFIKPDVSTLC
FT                   TGFAASMGTFLLAAGAPGKRYALPNARIMIHQPSGGGQGTASDVEIHAKEVLYLRERLN
FT                   DVLAQRTGQSIAQIEKDTDRDNFMSAEAAKTYGLVDDVLTTRVPLPVDALHGTT"
FT   gene            616193..617152
FT                   /locus_tag="Bphy_0545"
FT   CDS_pept        616193..617152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0545"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_A0777 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69737"
FT                   /db_xref="GOA:B2JDW1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW1"
FT                   /protein_id="ACC69737.1"
FT                   /translation="MEQMHREKRAEFEAVRAKLFALVYRMLGSRAEAEDVVQDAWLKWH
FT                   VADASKLRSSGAWLTTITTRLAIDRLRHLQIERATRSGGWMPDPWIEGLAPSAEDLALR
FT                   AVQMSYGVMLLLERLKPEERAAFVLHEAFECDYAEIAKILAKTPANCRQMVHRAKERLQ
FT                   RQGVPAKRADPAAHARIVERLRAAMEAQDRVGLVRLFCDVPSVISDAPETVDAVATADQ
FT                   IATTLSMRGPGDQMETVSMNGMSAVAWMRNGEVDALLDISIGEDERIVALRIVTGALRL
FT                   APATRVFGRAAIMRLLQPVSSQAASVTMRGHFPVDIDA"
FT   gene            complement(617108..618382)
FT                   /locus_tag="Bphy_0546"
FT   CDS_pept        complement(617108..618382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0546"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bxe:Bxe_A0778
FT                   putative diguanylate phosphodiesterase (EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69738"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW2"
FT                   /protein_id="ACC69738.1"
FT                   /translation="MSMIELDPPGFQSPRPIAGDEGSRRTVRYGGYTVFSVFQPVFSVS
FT                   HRRAIGYHASLRAHDENCKQVPSGEVFTQAARRGDLLELGRLAESLHLGNFNAFDSHDE
FT                   WLFLSLHPAALMDTSYGDALLAGLKALGLPAQRVVLEVSEQAGGETTRFAEIIDSLRKS
FT                   GFLIALDGFGAKHSNIDRVWNLRPDIVTLDRCILAQASEHSHIERVLPGIVSMLHESGQ
FT                   LVLMGGLSTERDALIALECNVDFVQGSFFAAPSVEPVARQATVKLMDELLAALRQRVAA
FT                   RERAQSERLAPFVTALETASAHLVEGETMADATAPLLALRETARCFLLDGSGRQIGDNV
FT                   LPSGRASQRAKRFRPLLHSEGASWERRPYFIEAVRAPGQVHLTPPYLSINEAHLCVTAS
FT                   IAAETARGMQVLCVDINWEVAAHRN"
FT   gene            complement(618653..620122)
FT                   /locus_tag="Bphy_0547"
FT   CDS_pept        complement(618653..620122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0547"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_A0779 MFS drug efflux pump, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69739"
FT                   /db_xref="GOA:B2JDW3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW3"
FT                   /protein_id="ACC69739.1"
FT                   /translation="MSESTKSASATAGDRTGKPTPTARSLTVMLWIVATGFFMQTLDST
FT                   IVNTALPAMARSLGELPLRMQSVVIAYSLTMAVMIPVSGWLADKLGTRRVFMAAILVFT
FT                   IGSLLCANAQTLTQLVVYRVLQGVGGAMLLPVGRLAVLRVFPAERYLPALSFVAIPGLI
FT                   GPLIGPTLGGWLVKIASWHWIFLINVPVGIVGVIATFVFMPDSRNPDTATFDIKGYVLL
FT                   IVGMVSISMALDGRTEFSIQHATVLMLLILSLGCFVAYGLHAVRAANPIFSLDLFKIHT
FT                   FSVGLLGNLFARIGSGAMPYLIPLLLQVSLGYSAFEAGLMMLPVAAAGMSSKRLVTRLI
FT                   MKYGYRRVLVSNTVLVGLAMASFSLTSEHQPLWLRLVQLAFFGGVNSMQFTAMNTLTLK
FT                   DLGTGGASSGNSLFSLVQMLAMSLGVTVAGALLTTFTGLMPRVTAANSLPAFHATFLCV
FT                   GLITAATSWIFAQLSADIRQPTKRADPQERT"
FT   gene            complement(620238..621650)
FT                   /locus_tag="Bphy_0548"
FT   CDS_pept        complement(620238..621650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0548"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bxe:Bxe_A0780 bifunctional
FT                   --transcriptional regulator, GntR family /
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69740"
FT                   /db_xref="GOA:B2JDW4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW4"
FT                   /protein_id="ACC69740.1"
FT                   /translation="MKLDIDLNRENGVPLTEQIVSGVQEWIRSRTAHPGAKLPSIRQFA
FT                   ADNDISRFPVIEAYDRLVSLGYLDSRPGSGFYVAERQRASMSGQGASDPRRAEGESVHI
FT                   LQQFNHPGESLKLGSGFIPEAWRDMDSLAQAIRHVSRTDGASMIDYATPLGNATLREHL
FT                   QARVAQLGIEAEASQILITIGASQAMDLLMRYMLKPGDTIFVEDPGYYNFNGLLKLHGV
FT                   NLIGIARTRTGPDLDAMQKQLQLHRPKVFFINSVYHNPTGTTIAPPIAFRLLQLAREHN
FT                   FKIIEDDIYADFQSDPTDRLATLDQLEHVIYIGGLSKTLSSSLRIGYVIADHATIKDLA
FT                   DIKMLTSIGGSRFAEAVTVALLERGMYRKHLDRLRRRMRDALGATVQTLEMSGWQVFEN
FT                   PSGGKFVWARVPHIDDAGRLVECGAPLGVTVAPGSYFRPNGEPSPWIRINAAFANEPRA
FT                   RMFFEAAAALKP"
FT   gene            621832..622143
FT                   /locus_tag="Bphy_0549"
FT   CDS_pept        621832..622143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_0947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69741"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW5"
FT                   /protein_id="ACC69741.1"
FT                   /translation="MREIRTFELEHREPASAWRVAQPLAVNVLAGELWLTVEGDAEDYW
FT                   LAAGETFELKRGAVAWLSAGREGARLSLTVASGAGDTVRVERRRTPRWTWMPRWLLTA"
FT   gene            complement(622170..623414)
FT                   /locus_tag="Bphy_0550"
FT   CDS_pept        complement(622170..623414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0550"
FT                   /product="Citrate synthase"
FT                   /note="PFAM: regulatory protein MerR; Citrate synthase;
FT                   KEGG: bxe:Bxe_A0781 bifunctional --transcriptional
FT                   regulator, MerR family / citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69742"
FT                   /db_xref="GOA:B2JDW6"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW6"
FT                   /protein_id="ACC69742.1"
FT                   /translation="MSTVRYVCASEAAAMLGISVTTLYAYVSRGMLRSAPDANSKRRLY
FT                   DEDEVRRLARRKKDGKRAGKVAQKVLDWGVPVLESSITLIADGKLLYRGRDAMELARTA
FT                   TLEEVAALLWECSARRVVAAPAAPLAAAQWSAWLKLWSDSAPLDRALVLLPAAAAQMPR
FT                   VWALGRDAQLDNACALIRLLAGAMILAAPSNDPLHRQLASAWGVRNRAQINLLRAALVA
FT                   CADHELNASTFTVRCITSTGAHLFGAVAGGLAALSGPRHGGETARVAALFDEAARAADL
FT                   DRYLATRLAHDEQGATAPVISGFGHPLYPDGDPRARLLLDLLDECASSRSPLADVQRLA
FT                   RTVRDTTGAEPTVDYALAAIERVLGLPAGAAFTLFATGRATGWIAHAMEQTADGRLIRP
FT                   RARYIGAYQVNREVV"
FT   gene            623533..624927
FT                   /locus_tag="Bphy_0551"
FT   CDS_pept        623533..624927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0551"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bxe:Bxe_A0782 putative CoA transferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69743"
FT                   /db_xref="GOA:B2JDW7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW7"
FT                   /protein_id="ACC69743.1"
FT                   /translation="MTPQLALDHLWSVAGCDAALLEHVSMKGDDPALPSVFRVGTLASA
FT                   SIAAMALAAANCFRLRTGLMQHVDVSVRRALIAFRSERYLRVNDGLPQELRHPVTGFYA
FT                   TRDGRWIQLHTNFPHHLQGVLKVLGCDGERDAVVAAIRNWDGAQLDQTLAEAGLCAALI
FT                   RSPREWAALDQAKAIANLPLLEIERIGDAPPEAPGRGAATRPLTGTRVLDLSRIIAGPV
FT                   AGRALAQHGADVLLINGPHLPNIAPLVIDNGRGKRSATLDLRDAAAREQLQALAGEADV
FT                   FLEAYRPGSLAARGFDPGTLARARPGIVCVSISAYGRAGPWATRRGFDSLVQSASGIAF
FT                   EESRAAAVDGPKHLPCQALDHATGYLAAFGAMVALARRAHEGGSWHVRLSLAQTGRWLQ
FT                   SMGQIKDGWRTPDVTFDEVQDGLQEVDSPFGRVHAAAPAERMSQTPAFYARPPVPIGTD
FT                   TARWEA"
FT   gene            complement(624955..625701)
FT                   /locus_tag="Bphy_0552"
FT   CDS_pept        complement(624955..625701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0552"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bxe:Bxe_A0783 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69744"
FT                   /db_xref="GOA:B2JDW8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW8"
FT                   /protein_id="ACC69744.1"
FT                   /translation="MNPVSEDRWRDLRPDPENDTPLYLQLARKLGTAIHENRWNAGEAL
FT                   PSERVLSDALGVSRITARKAIALLVEQGLIRRSQGAGSFITPRYEDPLSRLSSFSEMLR
FT                   RRGFTPSSQWLSREIVPANRDEVIQLGLSPAAAVTRLRRLRLADGIVMAVENSTFPASV
FT                   IPDPQAIGDSLYSYLEQRGLTIVRALQHFRAVNASDEIAQQMSIAPNDALLLITRVGYT
FT                   ADQRAIELTDTYCRNDYYDFVAELRK"
FT   gene            625881..626726
FT                   /locus_tag="Bphy_0553"
FT   CDS_pept        625881..626726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0553"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bxe:Bxe_A0784
FT                   putative aldo/keto reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69745"
FT                   /db_xref="GOA:B2JDW9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDW9"
FT                   /protein_id="ACC69745.1"
FT                   /translation="MTNDIASVTLPDGERIPKLGQGTWEMGENPSRRKAEIDALRGGIE
FT                   LGMTLIDTAEMYGEGATESLLGEALHGLRDEVFLVSKVYPHNASRRGVQHACEQSLRRL
FT                   KTDRIDLYLLHWRGSVPLEETVAGFEALRRDGKIRHWGVSNFDVDDMEELVGVTDGDAC
FT                   ATNQILYNVARRGPEFDLLPWLAARKMPAMAYSPVDHARLPKRSPLDDIAGRLGVSAVQ
FT                   VALAWVLRQPDVLAIPKSGRIEHVRDNRRALELPLSADDLAAIDAHFRAPRSKRPLEML
FT                   "
FT   gene            626781..627248
FT                   /locus_tag="Bphy_0554"
FT   CDS_pept        626781..627248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69746"
FT                   /db_xref="GOA:B2JDX0"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX0"
FT                   /protein_id="ACC69746.1"
FT                   /translation="MMHVHRAEHGDFGGRVFERVGADLARVLNEFVDEQYCVSIELSFI
FT                   APLPMKRRARARHSLCNAYCVVLFSCVGPIGSGCALLFLAQSRRVPLSVARRALLPPIP
FT                   LPAASRSACVHPSNAGPTVLSMRRCVVGIPARIRVARGLVDPDATPCVSVI"
FT   gene            complement(627422..629527)
FT                   /locus_tag="Bphy_0555"
FT   CDS_pept        complement(627422..629527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0555"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A0787 ABC oligopeptide/dipeptide
FT                   transporter, fused ATPase subunits; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69747"
FT                   /db_xref="GOA:B2JDX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX1"
FT                   /protein_id="ACC69747.1"
FT                   /translation="MNGPSPPPPPASFPAFDVSKSEQSDALTIVGLTVAYRTRGRERDV
FT                   LQDVSFRIRRGESYGLVGESGCGKSTVAMATLRYLARNGRVKAGRVSIAGKDVNALDAA
FT                   ALRALRANSISMVYQDPSRALNPSLTVARQVAEAFEAAGAVHEAALRQTVEILRKVRIA
FT                   EPERVMDSYPHQLSGGMQQRVVIAMALASKPALLILDEPTTGLDATVEAEVLDLVAQLR
FT                   EEFHTAVLFISHNLAVIGRMCERVGVLYAGKLVEEGATQDVFGRPRHPYTVGLLRCLPT
FT                   VGRSKDTDRLDTIAGSLPQPGSVTQGCVYLERCRLADDRCRREAPPPYRVSAQHGDQMS
FT                   RCHYHERAVELPRVTPVAPPANGRIAYDASPVLRAQNVSKTFHVNGSALRAVDDVSLEV
FT                   AKGETLGLVGESGSGKTTLAKLLLGLVSPDAGSVLELDGAPLPPRVTHRNDDQVKSLQI
FT                   VFQNPDSALNRAHSVRRLIGRALSRLSALRGDAREARLASLTQAVRLPDRYLTSRTRQL
FT                   SGGLKQRVAIARAFAGDPRIVVCDEPTSALDVSVQAAILNLLAELQRDRGVSYVFISHD
FT                   LNVVRYLSDRIAVLYVGRLLEIGPAAAVFDGPHHPYTEALLSSVPTLDLHDGETPGSAR
FT                   TQRIHLSGELPSPASPPSGCVFQTRCPRKLGAICEQQDPPYAEAGDGHRIRCHIPVDEL
FT                   RKLQRHT"
FT   gene            complement(629524..630423)
FT                   /locus_tag="Bphy_0556"
FT   CDS_pept        complement(629524..630423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0556"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A0788 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69748"
FT                   /db_xref="GOA:B2JDX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX2"
FT                   /protein_id="ACC69748.1"
FT                   /translation="MSASTSSTPPTPQTPAAPSTPRARDSRHDVLRALMRSPTFVVGAL
FT                   IVLWWIVCAIAGVWVAPLDPYASDPLNSLTPPAHGHWFGTDQLGRDVLSRVIVGARDIL
FT                   TIAPLATLLGTLAGTALGLVVGYFDGWVDNVVGRAIDAVLALPLVIVALLALAAVGASN
FT                   FTVILVIGITFTPITARTVRAAVFAERHLDYVAAAQLRGENAFYIMFAEILPNVLPPII
FT                   VEATVRLGYAIFAVATLSFLGFGIQPPSADWGLALSESYTLMAGGAWWTVVFDAAAIAS
FT                   LVVGVNLIADAVQGAVDV"
FT   gene            complement(630420..631430)
FT                   /locus_tag="Bphy_0557"
FT   CDS_pept        complement(630420..631430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0557"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A0789 ABC
FT                   oligopeptide/dipeptide transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69749"
FT                   /db_xref="GOA:B2JDX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX3"
FT                   /protein_id="ACC69749.1"
FT                   /translation="MSTTVSSSVARGSGSSAARIARFVATRVGLSLITLWLLSVIVFAG
FT                   GQLLPGDIGRAILGPLADARAVAALNHQLGADRPLLAQYTQWIIHFVQGDMGVSFVFRE
FT                   PVAQFVGNALANSAKLGLLAFAVVVPLGIAGGVWAAMHAGRWLDRTISIAGLSATVVPE
FT                   FVSSIVLILVFGVWLQWLPIDASYPPGSGILTQLKHLVLPVLPLVFVFFGYIARMARAG
FT                   TVEALDADYTRTAILKGLPPHIVIFRHVLRNALLPTITVAATQLGYMIGGLVVVETLFH
FT                   YQGIGSLIYNAAKAKDFPMLEAGVLTIGVVYTVANLIADGLYVLLNPRLRVRSAE"
FT   gene            complement(631460..633145)
FT                   /locus_tag="Bphy_0558"
FT   CDS_pept        complement(631460..633145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0558"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bxe:Bxe_A0790 ABC oligopeptide/dipeptide transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69750"
FT                   /db_xref="GOA:B2JDX4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX4"
FT                   /protein_id="ACC69750.1"
FT                   /translation="MKNSADPRFAPRLAGSVDLEAARVGADAHGNHAIDEFLAGRLTRR
FT                   ELLRYASVIGMSLAGGSLLAPRSARAQGAAGANATIRVAHLTPAGAVDPMTVTDAASLC
FT                   LLNQTGEFLIDDDGEKQTLKPALALSWKPNDKGDVWTFKLRENVKFHDGQTFTAKDVAA
FT                   TFDRLADPAAGSAALSTLKGVLSKGNTKVVDDHTVAFHLDAPNGNFPYYVSSDNYNAVI
FT                   LPANYAGNYEKTFIGTGPFKLEKYQAKVGASFVRNPDYWGDKALPQRVQFTFYADQQAQ
FT                   ILALQGHQADVMGTFTVQGGQGLMNNPEFKVIGVKSSAHRQIHMRVDSPQFKDKRVRQA
FT                   LALSLDREVIVKGLFKGRAQVGNDSPFAPAFPSSDAGVAQRKIDVAKAKQLLAQAGVPN
FT                   GFDATLTTEKYMEIPDLAVVVQNYAKAVGIRINLKVESQSQYYGSGTPGKSDWLDSPLG
FT                   ITDYGSRGVPNVFLSAPLTSGGTWNAAHFKNPQYDKLVADYVAALDIAGQKKVSAQIQT
FT                   LLLDETPVIFPFFYDQLIAARKQLNGVRFTAIAQLYFDRATLAG"
FT   gene            complement(633404..634423)
FT                   /locus_tag="Bphy_0559"
FT   CDS_pept        complement(633404..634423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0559"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="TIGRFAM: high-affinity nickel-transporter; KEGG:
FT                   bxe:Bxe_A0791 high-affinity nickel-transporter, (NiCoT)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69751"
FT                   /db_xref="GOA:B2JDX5"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX5"
FT                   /protein_id="ACC69751.1"
FT                   /translation="MTPSLSLRSRLVALYAGLIAANLAAWAWALIALRHYPLLLGTALL
FT                   AYGFGLRHAVDADHIAAIDAVTRKLMQEGKRPLGVGLAFSLGHSTIVLAATVGIALTAL
FT                   SLHGRFEAFHAVGGTIGTIVSSVFLLVLAGVNLVILRDVWRRYRHVQQGGQLTHDDAAR
FT                   SAPGGLLSRALKPLFKLVTNSWHMYPVGVLFGLGFDTATEVGLLAIAAAEAGKGLPLYS
FT                   ILVFPALFTAGMTLVDSTDNVLMVHAYSWAMDDPKRKLYYNASITFVSAVVAIAIGGIE
FT                   ALDLLADKLRLSGSAWDAVAAVNERFGMLGYGIVSVCMLCWFGSILLHRWRRPAAATR"
FT   sig_peptide     complement(634340..634423)
FT                   /locus_tag="Bphy_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.954 at
FT                   residue 28"
FT   gene            complement(634452..634937)
FT                   /locus_tag="Bphy_0560"
FT   CDS_pept        complement(634452..634937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0560"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin domain protein; Cupin 2 conserved barrel
FT                   domain protein; KEGG: bxe:Bxe_A0792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69752"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX6"
FT                   /protein_id="ACC69752.1"
FT                   /translation="MSQDNEQPIDWRINGVKVIKGNQLDTNTPQTPGMNRAAAINAARV
FT                   GAQKIWAGTVTIHPNAKTGAHHHGALESVIYVVRGHARMRWGEHLEFTAEAGPGDFIFV
FT                   PPYVPHQEINASTDDPLECVLVRSDNEAVVVNLNIDAVEQPETVYWVDPIHRHPHDH"
FT   gene            complement(635154..637259)
FT                   /locus_tag="Bphy_0561"
FT   CDS_pept        complement(635154..637259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0561"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: bur:Bcep18194_A5860 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69753"
FT                   /db_xref="GOA:B2JDX7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX7"
FT                   /protein_id="ACC69753.1"
FT                   /translation="MPRKTPIERYRNIGISAHIDAGKTTTTERILFYTGVTHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMAGNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYDSVGGVQPQSETVWRQANKYKVPRIAFVNKMDRVGADFFRVQKQIGERLK
FT                   GVAVPIQIPIGAEEHFQGVVDLVKMKAIVWDDESQGIKFTYEEIPDNLKELAHEWREKM
FT                   VEAAAEASEEMLEKYLTDHESLTEEEIKTGLRKRTIANEIVPMLCGSAFKNKGVQAMLD
FT                   AVIDYLPSPIDVPAILGHTEDDKEAERHPSDDEPFSALAFKIMTDPFVGQLIFFRVYSG
FT                   VVESGDTVYNPVKEKKERLGRILQMHANERKEIKEVRAGDIAAAVGLKEATTGDTLCDP
FT                   NNIIILERMIFPEPVISQAVEPKTKADQEKMGIALNRLAQEDPSFRVQTDEESGQTIIS
FT                   GMGELHLEILVDRMKREFGVEATVGKPQVAYRETVRTKVEDIEGKFVKQSGGRGQYGHA
FT                   VITLEPVPGKGYEFIDAIKGGVIPREFIPAVDKGIQETLKAGVLAGYPVVDVKVTLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRKAKPVLLEPMMAVEVETPEDFMGNVMGDLSGRRG
FT                   IVQGMEDIAGGGGKLVRAEVPLSEMFGYSTSLRSLTQGRATYTMEFKQYAETPNNVSEA
FT                   IINSKSK"
FT   gene            complement(637527..638042)
FT                   /locus_tag="Bphy_0562"
FT   CDS_pept        complement(637527..638042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0562"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   bxe:Bxe_A0794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69754"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX8"
FT                   /protein_id="ACC69754.1"
FT                   /translation="MRFSLRSLIARLAIAVALPVAALSAVSFAAMSAQDAYAQQMPQGA
FT                   KQPGDFPRAKLTAGMFVIDAAVAASDADREQGLMYRTQLAPNEGMLFVFGENAVHCFWM
FT                   KNTLIPLSIAFMRADGTITDIDEMQAETTNNHCPKNNGVYALEMSKGWFTSKGIKPGMK
FT                   IQGLPAPQ"
FT   sig_peptide     complement(637944..638042)
FT                   /locus_tag="Bphy_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.485 at
FT                   residue 33"
FT   gene            638164..638406
FT                   /locus_tag="Bphy_0563"
FT   CDS_pept        638164..638406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69755"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDX9"
FT                   /protein_id="ACC69755.1"
FT                   /translation="MTALSQQTYSDAAEAAAAGAAFLCDFLCETFFVALCDEAAAAGAA
FT                   EAASGAEACANAAVAKRPATRAAISLFILRILSFR"
FT   gene            complement(638815..639384)
FT                   /locus_tag="Bphy_0564"
FT   CDS_pept        complement(638815..639384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0564"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bxe:Bxe_A0796
FT                   pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69756"
FT                   /db_xref="GOA:B2JDY0"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY0"
FT                   /protein_id="ACC69756.1"
FT                   /translation="MTLLALNKPFGTICQFSPHETRASLADWVKVPGVYPAGRLDSDSE
FT                   GLLLLTDDGTLQARIAEPRHKLVKRYWAQVEGAPTEQHLEALARGVDLGDYVTRPCRAG
FT                   FVEPGQALWDRTPPIRYRAAIPTTWIELSITEGKNRQVRRMTAAVGFPTLRLVRVGVGA
FT                   LDIFSLGLQPGESIGLSPRAPWDGVT"
FT   gene            639716..640972
FT                   /locus_tag="Bphy_0565"
FT   CDS_pept        639716..640972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0565"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   bxe:Bxe_A0797 isocitrate dehydrogenase NADP-dependent,
FT                   proktype"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69757"
FT                   /db_xref="GOA:B2JDY1"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY1"
FT                   /protein_id="ACC69757.1"
FT                   /translation="MAYQHITVPADGDKITVNADFSLNVSDQPIIPYIEGDGTGVDITP
FT                   VMIKVVDAAVEKAYGGKKKIHWMEIFAGEKATRVYGPDVWLPDETLEVVKEYIVSIKGP
FT                   LTTPVGGGIRSLNVTLRQELDLYVCLRPVQYFKGVPSPLREPEKVNMVIFRENSEDIYA
FT                   GIEWPAGSPEAKKVIQFLRDEMGVKKIRFPDSSGIGVKPVSREGTERLVRKAIQYALDN
FT                   DRRTVTLVHKGNIMKYTEGAFRDYGYALAQKEFNAELIDGGPWMKVKNPKTGNDVVVKD
FT                   VIADAFLQQILLRPAEYDVIATLNLNGDYISDALAAQVGGIGIAPGANMSDSVAMFEAT
FT                   HGTAPKYAGKDYVNPGSEILSAEMMLRHLGWTDAADRILASMEKSILSKRVTYDFARLM
FT                   EGATQVSCSGFGQVMIENM"
FT   gene            641531..642664
FT                   /pseudo
FT                   /locus_tag="Bphy_0566"
FT   gene            complement(642761..642967)
FT                   /locus_tag="Bphy_0567"
FT   CDS_pept        complement(642761..642967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0567"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: bxe:Bxe_A0798 cold-shock DNA-binding domain
FT                   protein; TIGRFAM: cold shock domain protein CspD; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69758"
FT                   /db_xref="GOA:B2JDY2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR012751"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY2"
FT                   /protein_id="ACC69758.1"
FT                   /translation="MATGTVKWFNDAKGFGFITPDEGGEDLFAHFSAIQMNGFKTLKEG
FT                   QKVSFEVVQGPKGKQASNIQSAA"
FT   gene            643500..643814
FT                   /locus_tag="Bphy_0568"
FT   CDS_pept        643500..643814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0568"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: bxe:Bxe_A0800 putative ATP-dependent Clp
FT                   protease adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69759"
FT                   /db_xref="GOA:B2JDY3"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDY3"
FT                   /protein_id="ACC69759.1"
FT                   /translation="MAIIPDKQDNTVLERQEQKLKPPAMFKVVLLNDDFTPMEFVVMIV
FT                   QEYFNKDRETATQIMLKVHREGRGVCGVYTRDIASTKVEQVVTHARQAGHPLQCVMEEA
FT                   "
FT   gene            643811..646111
FT                   /locus_tag="Bphy_0569"
FT   CDS_pept        643811..646111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0569"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="KEGG: bxe:Bxe_A0801 putative ATP-dependent Clp
FT                   protease ATP-binding subunit; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit clpA; PFAM: AAA ATPase
FT                   central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69760"
FT                   /db_xref="GOA:B2JDY4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY4"
FT                   /protein_id="ACC69760.1"
FT                   /translation="MIAQELEVSLHMAFMEARQARHEFITVEHLLLALLDNPTAAEVLR
FT                   ACAANIEDLRQNLRNFIHDNTPTVPGTDDVDTQPTLGFQRVIQRAIMHVQSTSNGKKEV
FT                   TGANVLVAIFGEKDSHAVYYLQQQGVTRLDVVNFISHGIAKTNSSEAAKSTDANAESDE
FT                   AAAQKETPLAQFTQNLNQMAKDGRIDPLIGREAEVERVVQVLCRRRKNNPLLVGEAGVG
FT                   KTAIAEGLAWRITRGEVPDILVDAQVYSLDMGALLAGTKYRGDFEQRLKTVLKELKERP
FT                   NAILFIDEIHTLIGAGAASGGTLDASNLLKPALSSGTLKCIGATTFTEFRGIFEKDAAL
FT                   SRRFQKIDVTEPTVEQTVAILRGLKSRFEEHHGVKYSSGALSAAAELSARFITDRHLPD
FT                   KAIDVIDEAGAAQRILPKSKQKKTIGKSEIEEIISKIARVPAQSVSQDDRSKLQTLDRD
FT                   LKAVVFGQDPAIDALSASIKMARAGLGKTDKPIGAFLFSGPTGVGKTEVARQLAFTLGI
FT                   ELIRFDMSEYMERHAVSRLIGAPPGYVGFDQGGLLTEAVTKKPHCVLLLDEIEKAHPDI
FT                   YNVLLQVMDHGTLTDNNGRKADFRNVIIIMTTNAGAESMQKSTIGFTTRRETGDEMADI
FT                   KRMFTPEFRNRLDATISFRSLDEEIIMRVVDKFLMQLEDQLHEKKVDALFTDALRKHLA
FT                   KHGFDPLMGARPMQRLIQDTIRRALADELLFGKLMNGGRVTVDVDADDKVQLTFDENSA
FT                   PPRNPNPEAVEVD"
FT   gene            complement(646213..646659)
FT                   /locus_tag="Bphy_0570"
FT   CDS_pept        complement(646213..646659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0570"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: bxe:Bxe_A0803 DeoxyUTP pyrophosphatase,
FT                   subfamily 1; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69761"
FT                   /db_xref="GOA:B2JDY5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDY5"
FT                   /protein_id="ACC69761.1"
FT                   /translation="MKLDIKILDPRMREQLPAYATTGSAGLDLRACLDAPLTLEPGQTV
FT                   LVPTGLAIHLADPGYAALILPRSGMGHKHGIVLGNLVGLIDSDYQGQLMISTWNRGTTT
FT                   FTLNPMERLAQLVIVPVVQATFNIVDEFDTSERGEGGFGSTGKH"
FT   gene            complement(646724..647728)
FT                   /locus_tag="Bphy_0571"
FT   CDS_pept        complement(646724..647728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0571"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bxe:Bxe_A0804
FT                   putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69762"
FT                   /db_xref="GOA:B2JDY6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY6"
FT                   /protein_id="ACC69762.1"
FT                   /translation="MTLLSVLDQTPVIDGHTVTDAIAATVELAQLADDLGYTRYWCAEH
FT                   HGLYGVSNPCPEVMLARLGSVTRRIRIGSGGIMLPYYSPFKIAEQFMMLEALFPNRVDL
FT                   GVGRAPGGDMRTAQAVAAGAYNRGELFPQQVTDLVALMDGTLPSDHLAHGVLLQPQIDT
FT                   RPQLWVLGSSDFGGMLAAQLGIRFSFAHFINAHFGHAVAHAYRERFKPGHEPKPYLAAA
FT                   VFVICADTEQEAADLEKAVDLRRVQMAYGLNAPIPSVAQGLAQEYGEREQLIIDREKPR
FT                   SIIGTPESVTERLHALQEQFVADELIVLTVAGSYRARLRSYELLAGAFDLGKS"
FT   gene            complement(647802..649013)
FT                   /locus_tag="Bphy_0572"
FT   CDS_pept        complement(647802..649013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0572"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: bxe:Bxe_A0805 DNA/pantothenate metabolism
FT                   flavoprotein; TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69763"
FT                   /db_xref="GOA:B2JDY7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDY7"
FT                   /protein_id="ACC69763.1"
FT                   /translation="MATELAGKHIVLGMTGGIACYKIAELTRLLVKAGATVQVAMTEAA
FT                   TQFITPVTMQALSGRPVYTSQWDARIANNMPHIDLSREADAIVIAPASTDFLARLAHGL
FT                   CDDLLSALCIARDCPLLVVPAMNRQMWMNPATQRNVAQLRADGIELLGPDSGAQACGEV
FT                   GDGRMLEPEAVYEAIAAFFTPKTLTGRRVLLTAGPTFEPLDPVRGITNRSSGKMGFALA
FT                   RAAQQAGANVHLVAGPVGLETPWGVYREDVQTAQQMHDAVMRAVPGYDIFIGVAAVADW
FT                   RVDHVAEHKIKKTADRAIPSFSFVENPDILAAVAKLPHPPFCVGFAAESGDLDVHGEEK
FT                   RKRKNVPLLIGNLGPQTFGLDHNEVVLFEAAGTTRLPRADKQTLARALIAEIAKRLPDA
FT                   SVTG"
FT   gene            complement(649163..649663)
FT                   /locus_tag="Bphy_0573"
FT   CDS_pept        complement(649163..649663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0573"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_A0806 peptidase A8, signal peptidase
FT                   II; TIGRFAM: lipoprotein signal peptidase; PFAM: peptidase
FT                   A8 signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69764"
FT                   /db_xref="GOA:B2JDY8"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDY8"
FT                   /protein_id="ACC69764.1"
FT                   /translation="MSRTLSKPAGGSLAPWLGVAVIVILFDQLTKIAVAKVFAYGSSHA
FT                   IAPFFNLVLVYNRGAAFSFLAMAGGWQRWAFTALGVAAAVLICYLLKRHGTQKMFCTAL
FT                   ALIMGGAIGNVIDRLLYGHVIDFLDFHVGAWHWPAFNLADSAITIGAALLVFDELRRVR
FT                   GAR"
FT   gene            complement(649663..652500)
FT                   /locus_tag="Bphy_0574"
FT   CDS_pept        complement(649663..652500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0574"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   bxe:Bxe_A0807 isoleucyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69765"
FT                   /db_xref="GOA:B2JDY9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDY9"
FT                   /protein_id="ACC69765.1"
FT                   /translation="MSNKKADSKPQARYPVNLLDTPFPMRGDLPRREPQWVKDWQERKI
FT                   YEKIRAASKGRKKFILHDGPPYANGDIHLGHAVNKILKDMIVKARNLAGFDAVYVPGWD
FT                   CHGMPIEIQIEKQFGKSLPAAEVMQKARAYATEQIEKQKAGFRRLGVLGDWDNPYKTMN
FT                   FANEAGEIRALAKIMEKGYVFRGLKPVNWCFDCGSALAEAEVEYKDKTDPTIDVMFTFA
FT                   DPEKTAHAFGLAALPRNEGGIVIWTTTPWTIPANQALNLHPEIVYALVDTPRGLLILAE
FT                   ERVEACLKSYGIAGTVIATAPGAKLANLRFNHPLASAHPSYKRTSPVYLGDYVTTETGT
FT                   GIVHSSPAYGVEDFISCKTHGMADSDILSPVMGDGRYIESLALFGGLSIWDANPKIVEA
FT                   LDEAGTLLRTEKYLHSYMHCWRHKTPIIYRATSQWFAGMDIKPNDSDKTLRETALEGIE
FT                   ATAFYPSWGKQRLFAMIANRPDWTLSRQRQWGVPMAFFVHKETGELHPRTLELLEEVAK
FT                   RVEVSGIEAWQTLDPRELIGDDANMYEKNRDTLDVWFDSGTTHWHVLRGSHKDELQFPA
FT                   DLYLEGSDQHRGWFHSSLLTASMLDGRPPYNALLTHGFTVDGEGRKMSKSLGNGIDPHE
FT                   VSNRLGAEIIRLWIASTDYSGELAISEEILKRVTESYRRIRNTLRFLLANLSDFDIGKH
FT                   ARPVGEWLEIDRYAVALTANLQADILSHYDRYEFHPVVAKLQTFCSEDLGGFYLDVLKD
FT                   RLYTTAADSKARRSAQTALYHIAHGLLRLMAPFLSFTAEEAWKVFQPQSETIYTETYHA
FT                   YPDVPEASTLLDKWTLLRAVRSDVTKALEEARVANQIGSSLQAEVEIRAAGARHDALAS
FT                   LGADLKFVLITSGATVVKVDSVDEEGVDVITSKYLKCERCWHYRKDVGESAEHPTLCGR
FT                   CISNLFGNGETRSAA"
FT   gene            complement(652688..653680)
FT                   /locus_tag="Bphy_0575"
FT   CDS_pept        complement(652688..653680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0575"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain protein; PFAM: FAD
FT                   synthetase; Riboflavin kinase; KEGG: bxe:Bxe_A0808
FT                   riboflavin kinase / FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69766"
FT                   /db_xref="GOA:B2JDZ0"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ0"
FT                   /protein_id="ACC69766.1"
FT                   /translation="MRVFRGLPNAESRAPCALTIGNFDGVHRGHQALLARVRAAADARS
FT                   LPVCVMTFEPHPREFFNPAGAPPRIAMLRDKLEALRMNGVDRVVVEHFNHTFASQSPDA
FT                   FVERIIVNGLHARWVMIGDDFRYGAKRAGDFNSLKTAGAEYGFEVEQMATVADPSGARI
FT                   SSSGVRTSLIAGDLDSARAALGRDYLISGHVVHGLKLGRDLGFPTLNLPIAHKRPALSG
FT                   IFIVQVHGIDDKPLPGVASLGLRPTVDDSGRVLLEVHLLDWHGDAYGKLVRVEFLKKLR
FT                   DEEKFVDLETLTAAIARDVENARAWFEAVGDAPGSRCTGFATSATDRIR"
FT   gene            653799..654464
FT                   /locus_tag="Bphy_0576"
FT   CDS_pept        653799..654464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0576"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="KEGG: bxe:Bxe_A0809 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69767"
FT                   /db_xref="GOA:B2JDZ1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ1"
FT                   /protein_id="ACC69767.1"
FT                   /translation="MKNLVILISGRGSNMEAIVRACASEGWPARVAAVIANRPDAAGLA
FT                   FAASQGIATAVVDHRQFPDRESFDAALAREIDGFAPDLVVLAGFMRVLTDAFVNRYMGR
FT                   MINVHPSLLPSFPGLKTHQAALDAGVRLHGASVHFVTPTLDHGPLVLQSAVPVLAGDDA
FT                   ATLAARVLETEHVIYPRAVRWFVEGRLAVDGLRVTVTPPEPQWLFLDTTSKYNAGEGA"
FT   gene            654461..655720
FT                   /locus_tag="Bphy_0577"
FT   CDS_pept        654461..655720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0577"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: bxe:Bxe_A0810
FT                   NOL1/NOP2/Sun family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69768"
FT                   /db_xref="GOA:B2JDZ2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ2"
FT                   /protein_id="ACC69768.1"
FT                   /translation="MRLHGFLIGQTETLLADVLKFTGPADAATSRFFRAHPKLGHGERG
FT                   VIAEAVFAVLRRRMEFAHLAESGAGSPNRRLALLGLMQTAGRTALKPFVSEAENVWLEH
FT                   VAKIDPQSLPLRIRMNLPDWIYQALSNRFEAEELAHLAAALNYPAPLDLRANPIKASRD
FT                   DVLGVLSKAAIEAAATPYAPLGIRVVGKPPLTKLDAFQSGWLEVQDEGSQLLCSLVAPK
FT                   RGEMIVDFCAGAGGKTLALGAMMRSTGRLYAFDISERRLAKLKPRLARSGLSNVNPVLI
FT                   DSEHDAKIKRLAGKIDRVLVDAPCSGLGTLRRNPDLKWRQSPESIAELTPKQLSILTSA
FT                   ARLVKKGGRLVYATCSILDAENEGVVQQFLAAHSDFELVPARDVLAEQRIDLEMGDFLS
FT                   LWPHRHSTDGFFAAVLERRG"
FT   gene            655807..657162
FT                   /locus_tag="Bphy_0578"
FT   CDS_pept        655807..657162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0578"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bxe:Bxe_A0811 small-conductance mechanosensitive channel,
FT                   MscS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69769"
FT                   /db_xref="GOA:B2JDZ3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ3"
FT                   /protein_id="ACC69769.1"
FT                   /translation="MQNHLFFHMLGDVVRDFGQPVILWQVGVLLGTLALAWLLAHLARH
FT                   ALDAQRETRYGALRFGAEALNRALFPLLGGVLVWIARAIAGQFIHTSLLDLALVPLFGI
FT                   GLIYIVFYLARRVFGRDGSAHTWLSLVEKVVSLIVWIGMVLTVMGIQNDVLKWMASVQF
FT                   RIANTHVTLLSLLSGLLWVCVTMIVAMWLGAALEDRLMRSGSLDANLKVVLSRVGRALL
FT                   ILGAVLISLSLVGIDITVLGVFGGALGVGLGFGLQKIASNYVSGFIILIDRSLRIGDTI
FT                   NVSGLQGMVTQIRTRYTVVRGLDGIETLIPNEKLITDVVQNQSSYLTRGNAKATVQIAY
FT                   STDVEQAMALLVEATAGVARVLQEPAPTPYLAGFGPDGINLELGYWIEDAATGTSGVRS
FT                   NVNRNIWRLFSENGIAIPYAQREVRIVAGGSDIMPQAVSVTGQTANDPGSAA"
FT   gene            657363..658565
FT                   /locus_tag="Bphy_0579"
FT   CDS_pept        657363..658565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0579"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bxe:Bxe_A0812
FT                   putative transmembrane fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69770"
FT                   /db_xref="GOA:B2JDZ4"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ4"
FT                   /protein_id="ACC69770.1"
FT                   /translation="MALLNSLLDFLAHGALRFSWWQIVLWTLAVTHVTIIGVTVYLHRC
FT                   QAHRALDLHPVASHFFRFWLWMSTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKV
FT                   LLEGAELYRAEAKNEETMRKFSHGTPNDWLERNVYTKYPILGVSLMMVIDVALFGIVGL
FT                   TVWAVQMIWIPFWAAGVVNGLGHFWGYRNFNSSDASTNLFPWGIIIGGEELHNNHHTYA
FT                   TSAKLSNKWYEFDIGWMYIRIMSAFRLATVKKIAPTPRLTSGKMVLDQDTLQAVLANRY
FT                   EVMARYAKAIKRAYRQELAHLKEVGAREKYQLMRGARTWFHKEEAGLDEPQRRQLPQIF
FT                   ASSQKLRTYIELRNELAAMWERSNASREQLLIQLQDWCHRAEESGIKALQEFAMRLRRY
FT                   A"
FT   gene            658697..659827
FT                   /locus_tag="Bphy_0580"
FT   CDS_pept        658697..659827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0580"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: bur:Bcep18194_A5838 quinolinate synthetase A;
FT                   TIGRFAM: quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69771"
FT                   /db_xref="GOA:B2JDZ5"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023513"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDZ5"
FT                   /protein_id="ACC69771.1"
FT                   /translation="MNQAIRSVEYDRPQGTACSIGQAWAKVPDSPSTHERLALKERIRG
FT                   LLKREKAVLVAHYYVDAELQELADETGGCVADSLEMARFGRDHDAQTLVVAGVRFMGET
FT                   AKILSPNKRILMPDLDATCSLDLGCPVDEFSAFCDAHPDRIVVVYANTSAAVKARADWM
FT                   VTSSIGLEIVADLHARGEKIIWAPDRHLGGYIQKKTGADMLLWQGSCLVHDEFKGVELD
FT                   LLRAEYPDAKVLVHPESPESVVAQADVVGSTTQLIDAAKNSSATHFIVATDLGILHKMR
FT                   IAAPGKTFIEAPTAGNSATCKSCAHCPWMAMNGLRNLAEVLERGHNEIFVDAAIGERAR
FT                   LPIDRMLDFAARHKKRVQASGDLAHDTALFSNVGAA"
FT   gene            659827..660729
FT                   /locus_tag="Bphy_0581"
FT   CDS_pept        659827..660729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0581"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: bxe:Bxe_A0814 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69772"
FT                   /db_xref="GOA:B2JDZ6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ6"
FT                   /protein_id="ACC69772.1"
FT                   /translation="MGVNEPLEFKDAVSPLFAEIQEQYGEAFAAAIARNVADALAEDVG
FT                   SGDLTGLLVPADEMRDARIIVREEAVLCGVPWFNEVMRRVDPRIEAQWRYREGDRMTAD
FT                   SVVCTLRGPARALLTAERNGLNFLQMLSGVASATRKFADAIAHTRARVLDTRKTLPGLR
FT                   LAQKYAVRVGGGANQRLALYDGILIKENHIAAAGGVGAAMQAAIALNAGVSIQIEVETL
FT                   GQLESALAHGAQSVLLDNFSFDMMRDAVRITAGRAVLEVSGGVNLDTIRLIAETGVDRV
FT                   SVGSLTKDVRATDFSMRIV"
FT   gene            complement(660810..662408)
FT                   /locus_tag="Bphy_0582"
FT   CDS_pept        complement(660810..662408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0582"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: bxe:Bxe_A0815 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69773"
FT                   /db_xref="GOA:B2JDZ7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2JDZ7"
FT                   /protein_id="ACC69773.1"
FT                   /translation="MNFDVAIVGSGLAGLSVALNLAPTRRVAVIAKRSLTDGASDWAQG
FT                   GIAAVLDSADSVENHVADTLVAGGGLCDEAATRFIVEHGREAIQWLIDQGVPFTKDDAA
FT                   ELGFHLTREGGHSHRRIIHAADATGHAVVATLTERVRQHPNITLLEEHYAIDLITSDRL
FT                   GLPGRRCHGLYALDLASGRTVTIEAPHTVLATGGAGKVYLYTTNPDTATGDGIAMAWRA
FT                   GCRVSNMEFIQFHPTCLFHPYAKSFLISEAVRGEGGVLKLPDGTRFMPAHDERAELAPR
FT                   DIVARAIDFEIKKRGIDCVYLDISHQSPEFLREHFPTILARCLEFGIDITKEPIPVVPA
FT                   AHYTCGGVVTDLAGRTDLAGLYAVGETSCTGLHGANRLASNSLLECLVIGRSAAQAIEE
FT                   EGFGAAVHAPLPDWDESRVSDPDEEVVVAHNWDELRRLMWNYVGIVRTDKRLARAKHRL
FT                   ALLRDEIHEYYANFKVSRDLLELRNLVDVASLIVDGARSRRESRGLHYSRDWPNALPKA
FT                   LPSVLSPERVPNRNV"
FT   gene            complement(662653..662820)
FT                   /locus_tag="Bphy_0583"
FT   CDS_pept        complement(662653..662820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0583"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: bte:BTH_I0779
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC69774"
FT                   /db_xref="GOA:B2JDZ8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JDZ8"
FT                   /protein_id="ACC69774.1"
FT                   /translation="MAKGARDKIKLESTAGTGHFYTTTKNKRNMPEKMEIMKFDPVARK
FT                   HVAYKETKIK"
FT   gene            complement(662831..663064)
FT                   /locus_tag="Bphy_0584"
FT   CDS_pept        complement(662831..663064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_0584"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG: bte:BTH_I0780
FT                   ribosomal protein L28, putative"
FT                   /db_xref=