(data stored in ACNUC29543 zone)

EMBL: CP001044

ID   CP001044; SV 1; circular; genomic DNA; STD; PRO; 2697374 BP.
XX
AC   CP001044; AAUG01000000-AAUG01000055;
XX
PR   Project:PRJNA17409;
XX
DT   23-APR-2008 (Rel. 95, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Paraburkholderia phymatum STM815 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia phymatum STM815
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
XX
RN   [1]
RP   1-2697374
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   "Complete sequence of chromosome2 of Burkholderia phymatum STM815";
RL   Unpublished.
XX
RN   [2]
RP   1-2697374
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   ;
RL   Submitted (11-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7b1dfa1427e4271a216e7f9a4cb10c8e.
DR   BioSample; SAMN02598384.
DR   EnsemblGenomes-Gn; Bphy_R0016.
DR   EnsemblGenomes-Gn; Bphy_R0017.
DR   EnsemblGenomes-Gn; Bphy_R0018.
DR   EnsemblGenomes-Gn; Bphy_R0019.
DR   EnsemblGenomes-Gn; Bphy_R0076.
DR   EnsemblGenomes-Gn; Bphy_R0077.
DR   EnsemblGenomes-Gn; Bphy_R0078.
DR   EnsemblGenomes-Gn; Bphy_R0079.
DR   EnsemblGenomes-Gn; Bphy_R0080.
DR   EnsemblGenomes-Gn; EBG00001013774.
DR   EnsemblGenomes-Gn; EBG00001013775.
DR   EnsemblGenomes-Gn; EBG00001013776.
DR   EnsemblGenomes-Gn; EBG00001013777.
DR   EnsemblGenomes-Gn; EBG00001013778.
DR   EnsemblGenomes-Gn; EBG00001013779.
DR   EnsemblGenomes-Gn; EBG00001013780.
DR   EnsemblGenomes-Gn; EBG00001013781.
DR   EnsemblGenomes-Gn; EBG00001013782.
DR   EnsemblGenomes-Gn; EBG00001013783.
DR   EnsemblGenomes-Gn; EBG00001013784.
DR   EnsemblGenomes-Gn; EBG00001013785.
DR   EnsemblGenomes-Gn; EBG00001013786.
DR   EnsemblGenomes-Gn; EBG00001013787.
DR   EnsemblGenomes-Gn; EBG00001013788.
DR   EnsemblGenomes-Tr; Bphy_R0016-1.
DR   EnsemblGenomes-Tr; Bphy_R0017-1.
DR   EnsemblGenomes-Tr; Bphy_R0018-1.
DR   EnsemblGenomes-Tr; Bphy_R0019-1.
DR   EnsemblGenomes-Tr; Bphy_R0076-1.
DR   EnsemblGenomes-Tr; Bphy_R0077-1.
DR   EnsemblGenomes-Tr; Bphy_R0078-1.
DR   EnsemblGenomes-Tr; Bphy_R0079-1.
DR   EnsemblGenomes-Tr; Bphy_R0080-1.
DR   EnsemblGenomes-Tr; EBT00001536980.
DR   EnsemblGenomes-Tr; EBT00001536982.
DR   EnsemblGenomes-Tr; EBT00001536984.
DR   EnsemblGenomes-Tr; EBT00001536986.
DR   EnsemblGenomes-Tr; EBT00001536987.
DR   EnsemblGenomes-Tr; EBT00001536989.
DR   EnsemblGenomes-Tr; EBT00001536991.
DR   EnsemblGenomes-Tr; EBT00001536992.
DR   EnsemblGenomes-Tr; EBT00001536993.
DR   EnsemblGenomes-Tr; EBT00001536995.
DR   EnsemblGenomes-Tr; EBT00001536997.
DR   EnsemblGenomes-Tr; EBT00001536998.
DR   EnsemblGenomes-Tr; EBT00001537000.
DR   EnsemblGenomes-Tr; EBT00001537002.
DR   EnsemblGenomes-Tr; EBT00001537004.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001044.
DR   SILVA-SSU; CP001044.
DR   StrainInfo; 302139; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002725
CC   Source DNA and bacteria available from Michelle Lizotte-Waniewski
CC   (mlizotte@bio.umass.edu)
CC   Contacts: Michelle Lizotte-Waniewski (mlizotte@bio.umass.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2697374
FT                   /organism="Paraburkholderia phymatum STM815"
FT                   /chromosome="2"
FT                   /strain="STM815"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391038"
FT                   /type_material="type strain of Paraburkholderia phymatum"
FT   gene            complement(28..624)
FT                   /locus_tag="Bphy_3102"
FT   CDS_pept        complement(28..624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3102"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bxe:Bxe_B0772 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3102"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72270"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR44"
FT                   /protein_id="ACC72270.1"
FT                   /translation="MTMHRRRFIAMATATLATGGLALAGCTTTGPSSDASPEANAGKRQ
FT                   SIDADVNATLTRLFNAIGGSRELADKARGILVFPSVISAGFWFGGQYGQGALRVGGQTS
FT                   GYYSLTAASFGLQIGAQSKAVVMLFMTDEALSSFTRSQGWAAGVDATVALVKVGANGNV
FT                   DTSTAMSPVEAFVLTNGGLMAGVSLEGSKISRLII"
FT   sig_peptide     complement(550..624)
FT                   /locus_tag="Bphy_3102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.516 at
FT                   residue 25"
FT   gene            complement(737..1435)
FT                   /locus_tag="Bphy_3103"
FT   CDS_pept        complement(737..1435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72271"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR033468"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR45"
FT                   /protein_id="ACC72271.1"
FT                   /translation="MLTLYSYPDLYGVADNNAFGLKVYAFMRLCGLEFEHRHILDTSHA
FT                   PRGQLPYLSDDGETVGDSDAIIAYLKGRYDLRVDAALSQGQANLDFLVRRTLDDLYWPM
FT                   SYSRWRDERYWPAFRDAVLREHADVTANDLEAAREYNRQRYHYQGIGRYEPDQVYVRGI
FT                   GDLRVVADLLGNSGFVFGPEPATIDAAIYGFVANIYFYEIDTPLKAYVVSRPELVRHCR
FT                   AVHERIAAKA"
FT   gene            1620..2570
FT                   /locus_tag="Bphy_3104"
FT   CDS_pept        1620..2570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3104"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: dar:Daro_1083
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72272"
FT                   /db_xref="GOA:B2JR46"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR46"
FT                   /protein_id="ACC72272.1"
FT                   /translation="MTKTRAILRAIFGIHHAHEPAARRDAASRSVMMRVTLDAQHVTPL
FT                   RRALTRDCAGQPWTIRIATLPHTERVQLSLYLPKDAVHGAIQQVTRIAPAAQFGHLFEI
FT                   PDTPTDGWRDLLRASSWAQAASVLRPAKPARTSEADDIETLDRLLGAGNVLLDADIADR
FT                   DALFAQLGAFCASRYGVPASQVIDGLNKREALGSTGLGQGVAVPHSQIAGLLSAVVLYV
FT                   RPRVPLDFDAPDAKPVSDVIALLVPEGANTMHLNLLADVAQRFCDQHFRERLHACGSAS
FT                   EVCRLFANAAQASGLASAIPHAASRGDASGAQLRA"
FT   gene            complement(2614..3207)
FT                   /locus_tag="Bphy_3105"
FT   CDS_pept        complement(2614..3207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3105"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72273"
FT                   /db_xref="GOA:B2JR47"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR47"
FT                   /protein_id="ACC72273.1"
FT                   /translation="MTTIDTDSQARAPAGSRTDAAAGAHSDYRPPASEDELLLKWIRRA
FT                   RESQKSHYDMADLLASRNRLFGIGVTVLSAVVGTTVFLSLVVSEDSPWARLVVGLVSIT
FT                   AAASAALQTFLRYAERAEAHRAAGARYGAVRRRLEAIYAGDPGARDGRYVSEVREILDR
FT                   LAEDSPSVPPRVFRRTQQTLRVAAPHGRRENGWE"
FT   gene            3387..3707
FT                   /locus_tag="Bphy_3106"
FT   CDS_pept        3387..3707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72274"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR48"
FT                   /protein_id="ACC72274.1"
FT                   /translation="MAKHEVQSWYRPPQDEVCPLCGRTIPPEQRDEHHMVPKAEGGRET
FT                   VALHRICHRQLHALFSERELATTYASVDRLLDNEQVRAFVNWVRTKPAGFHERTRSSRR
FT                   KR"
FT   gene            3747..3965
FT                   /locus_tag="Bphy_3107"
FT   CDS_pept        3747..3965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3107"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: bch:Bcen2424_6619
FT                   putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72275"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR49"
FT                   /protein_id="ACC72275.1"
FT                   /translation="MPVYDYTCADCGAFEAVRRIAERDEPAACPRCGTLAQRVRIGAPA
FT                   LLGGASGDASGGEGGYGMRHRGCSCCP"
FT   gene            4050..4988
FT                   /locus_tag="Bphy_3108"
FT   CDS_pept        4050..4988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3108"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0952 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72276"
FT                   /db_xref="GOA:B2JR50"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR50"
FT                   /protein_id="ACC72276.1"
FT                   /translation="MPLRLPPLNSLRFFEAAARLGSFKLAAAELNVTPSAVSHGIVALE
FT                   ETLGVALFVREPRKLSLTPAGELYFPYIAEAFSLILTGTQRLPDGRTHRTISVSCAPTL
FT                   AARWLVPRLHDFRAQWPNLDVSVDTSRRQVGFPVDGFDFGIRLSRGPVPGSDWNRLFGE
FT                   KLVPVCSPACRETLVDAHGEVDLRRATLIHVDTASDDWQTWLDGAGIRNIDATGGLRFD
FT                   TIQLALEAATTGMGVAVGRRPLVNRELDAGMLVKASTLSVDAKTSYWLVCSERADERPE
FT                   LQAFKRWLLHEALAFEALSTHDVTACAAAMR"
FT   gene            5093..6337
FT                   /locus_tag="Bphy_3109"
FT   CDS_pept        5093..6337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3109"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B0951 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3109"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72277"
FT                   /db_xref="GOA:B2JR51"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR51"
FT                   /protein_id="ACC72277.1"
FT                   /translation="MSTARSSAYAAPLRNPTLYVILAAALILSAAMGIRQTFGLFIGPF
FT                   SYDRGLPVTLIAFAIALHNLVWGFAQPFAGAAADRYGAAPVVAFGATTFAAGLALAASA
FT                   PSGIALIAGLGLLVGIGVSCTTFGVVLTAVGRVATPAQRSMAMGLASAGGSLGQVLMVP
FT                   FAQLVRESSGVSTSLFALAFLMLVAAPFGILLDRRRDASVQHVEAPAATSLRETLTDAT
FT                   QHRGYRLLTLGFFTCGFQLAFIATHLPGYLTLCHMPMGLGATALALIGLFNMAGSWACG
FT                   WLGGRFRQQHVLGWLYLMRGATIAAFFLLPKSTISVVLFAAVMGLTWLGTVPLTSGLIA
FT                   KMFGTRHLGTLFGVVFLSHQLGSFLGAWLGGYVFDATGSYTPIWAATALAGLFAALLHF
FT                   PIDDTVHASAEPASA"
FT   gene            complement(6443..7117)
FT                   /locus_tag="Bphy_3110"
FT   CDS_pept        complement(6443..7117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3110"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: dar:Daro_2298 response
FT                   regulator receiver:transcriptional regulatory protein,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3110"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72278"
FT                   /db_xref="GOA:B2JR52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR52"
FT                   /protein_id="ACC72278.1"
FT                   /translation="MRVLLVEDDLQIGQSLMRALQDADYSVDWVRDGNAGSAAIAAAEY
FT                   TVVLLDLGLPGMGGIELLKTARGAGNTVPVLILTARDDLEARVQGLDVGADDYVLKPFD
FT                   VPELMARMRAVLRRKAGYASSRLGDDALNLDLDKRMLCCNGVSSVLSAREFALMLAFLE
FT                   RPGTILSRDQLEDKLYGWGKEVESNAVDVLIHSVRKKFGQAVIRNVRGLGWTVMLGDTP
FT                   KT"
FT   gene            complement(7319..8647)
FT                   /locus_tag="Bphy_3111"
FT   CDS_pept        complement(7319..8647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3111"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: nha:Nham_0997 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72279"
FT                   /db_xref="GOA:B2JR53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR53"
FT                   /protein_id="ACC72279.1"
FT                   /translation="MSMPKIRSLRNQLVLALCVLVSVVGVVQGISSWQLAKAGMSALLD
FT                   LRLEQAASRLYKSGLAESLPAIPSRGSQPERDIYVTVWRDDIATPYRSTDPALALPRDA
FT                   DPGFTTAMVGGESWRIYTLREPSMVIQVAQRSRVRHELAQARSLDTLWPMIVLVPLVWI
FT                   AVLLVVRRALRRLTRLGAQVKAIDMTHFEQLSTSGVPTEIRPFITSINTMIGRLEQSIE
FT                   SERKFISDAAHELRTPLTALQLQADNLQPHIAPGNQERFRELQSGIRRSGRLIAQLLRL
FT                   ARADAALKADTLTRVDVSAVVVDAVAEVLPIALQRGIDIGADEMMGAHVYANEADIGVA
FT                   LRNLVSNAIRYTPDGGKVDLSVHVRDGMAWIEVVDSGPGIDEAQLPRVFDRFFRANTQI
FT                   EGSGLGLSIVQAIANRYGGAVTLRNRTDGQSGIVASIGFAAVP"
FT   sig_peptide     complement(8558..8647)
FT                   /locus_tag="Bphy_3111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.702 at
FT                   residue 30"
FT   gene            complement(8881..9189)
FT                   /locus_tag="Bphy_3112"
FT   CDS_pept        complement(8881..9189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72280"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR54"
FT                   /protein_id="ACC72280.1"
FT                   /translation="MKTLIRTAAAAIALALPIATFAQSNAPVTRAGVLAQVVQPDSAGD
FT                   DPAGGNAHYPAAIEAAQARIDARQTDEYGGVTGGTSQAGAPFHPQYDAGLKSIYVGH"
FT   sig_peptide     complement(9121..9189)
FT                   /locus_tag="Bphy_3112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.737 at
FT                   residue 23"
FT   gene            9287..9535
FT                   /locus_tag="Bphy_3113"
FT   CDS_pept        9287..9535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72281"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR55"
FT                   /protein_id="ACC72281.1"
FT                   /translation="MPRVNGWPLMRLPPFQGGRLVQQLDLAFRIANERALHVVAPFEST
FT                   FQRARESAQQSHFPLIQPAYDAFRRCIVPDLRRPKDT"
FT   gene            9590..9775
FT                   /locus_tag="Bphy_3114"
FT   CDS_pept        9590..9775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3114"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72282"
FT                   /db_xref="InterPro:IPR021946"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR56"
FT                   /protein_id="ACC72282.1"
FT                   /translation="MFSEIARRLGTLLPHSRESEREAWLASSTDLADLERRMRTVDDTD
FT                   YPFHVHSSVVPRDWIA"
FT   gene            9835..10290
FT                   /locus_tag="Bphy_3115"
FT   CDS_pept        9835..10290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3115"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72283"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR57"
FT                   /protein_id="ACC72283.1"
FT                   /translation="MRHYRSDSPEAAARIVAACLLSDGHVGIDELEALERHGMEERLKL
FT                   NRAQLLAVIQQMCEDLTSTAYLNWGDTCRLDPAAIFGLAQDIKDWRLRREIIALCEEGA
FT                   QADGHLSDAQALFIRTLHAAWYMPGARETYESPRSRERLTLARNHSR"
FT   gene            10511..11461
FT                   /locus_tag="Bphy_3116"
FT   CDS_pept        10511..11461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3116"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bur:Bcep18194_B2065 taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3116"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72284"
FT                   /db_xref="GOA:B2JR58"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR58"
FT                   /protein_id="ACC72284.1"
FT                   /translation="MSNTHAALASSKGGALAGHTAPETLDVRRVAGRIGAEIRGIELSG
FT                   SIGAPTFDAIHAALLKHKVLFFRGQQHLDDAAQEAFARRFGETVAHPTVPSVDGSRHLL
FT                   ELDSQHGARANSWHTDVTFVDAYPKISILRAVVIPPFGGDTVWANTAAAYEHLPEPLRR
FT                   LADTLWALHTNAYDYASSHVDADGEQLKRYREVFTSTVYETEHPVVRVHPETGERSLVL
FT                   GHFVQRLKGLSASESAHLLQVFHDHVTRLENTVRWSWTQGDVAIWDNRATQHYAINDYG
FT                   DAHRVVRRATVHGDVPVSIDGRHSVVVRGAGATLQ"
FT   gene            complement(11487..12611)
FT                   /locus_tag="Bphy_3117"
FT   CDS_pept        complement(11487..12611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3117"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   rme:Rmet_1823 heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72285"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR59"
FT                   /protein_id="ACC72285.1"
FT                   /translation="MKIHSHYDNLKVSRDAPQEVIRAAYKILCQKYHPDRRIDDPDAER
FT                   VMKIINASYAVLSDPVQRKEHDEWLARKEREAAAAAAVPAQSKSPQTTRRTNSQTATQT
FT                   KREASPRRQPRSSAWTSQARVDPRAAPSRPAAAGFSLRKISLRSWIAIGLCAFFGYVAI
FT                   SESMTPWPFTRNTSSSYGSHYGSPYGSRDQGGADGATSAEGKRRALATLSSAQAATSPW
FT                   TNDASAGGDASSARPAFARPAVAPNGLPWPSTAAYLEGMPVGADGGHSSVTIDNTPNRF
FT                   DVFAKLVFNASVFDQPVRHFYIPAGKSFTLLGVAPGSYDVRYQNLDDGGLYKSQNFAVT
FT                   EQDSGNGIDATNVSITLYAVPGTVQPTTIGRGDF"
FT   gene            complement(12787..13785)
FT                   /locus_tag="Bphy_3118"
FT   CDS_pept        complement(12787..13785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72286"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR60"
FT                   /protein_id="ACC72286.1"
FT                   /translation="MLNKLIDIARHIRRSERFKHSISTPGRITLHAQQRLNRGYFAIEI
FT                   RAHSGFFSVMQMVLFILMYCDEKRLTPLISARGGIYGDPQGQVDWFGEYFDTVGVPAAP
FT                   ASNMRLRTSVVHDLGGLGFRRRYESKLELRHASALFRAHYQPTAPIRAEVDAIRRRIGI
FT                   GAATLGVHFRGTDKKLEAHTIGWEDFCRLVERTLAEEPQLTHIFVSSDEQAFLDYFVKW
FT                   DFPVPVSVAPARLLATGSTPVHFSGHPGLAIGREALVASLLLANCGYLLKTPSYLSAWS
FT                   KLFNPSLPVMLAVPPREGAFWFPDSQIWNEQQARRRDAVEPDVRMPNQKTA"
FT   gene            complement(14272..14484)
FT                   /locus_tag="Bphy_3119"
FT   CDS_pept        complement(14272..14484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72287"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR61"
FT                   /protein_id="ACC72287.1"
FT                   /translation="MTIPMLTTHRGYRLQASAAIGDDGLHAADLTIEKPGLPPRTFNAL
FT                   DYFYDGEQALKYATAWGRIWVDMTG"
FT   gene            complement(14658..15689)
FT                   /locus_tag="Bphy_3120"
FT   CDS_pept        complement(14658..15689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3120"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: bxe:Bxe_A1266 ABC
FT                   phosphate transporter, periplasmic ligand binding protein,
FT                   PstS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3120"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72288"
FT                   /db_xref="GOA:B2JR62"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR62"
FT                   /protein_id="ACC72288.1"
FT                   /translation="MRHALFAAAGLLGALSFSFAHATDVTGAGSTFAAPVYTKWADAYQ
FT                   KAGGGRINYQGIGSSGGIKQVLAKTVDFAGSDAPLKDDELAKDGLFQFPTVVGGVVPVV
FT                   NLRGIKPGGLVLSGPVLGDIYLGKIKKWNDPQIAALNSGAKLPDTDIAVVRRADGSGTS
FT                   FIWTHYLAQVSPEWKSKVGEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKQ
FT                   NKMTYTSLKNAAGAVVEPKTETFKAAAAGAEWSKSFYQILTNEPGKDAWPVVGATFVLV
FT                   HSAQDKPDHGKETLKFFDWAFRNGSQTAQELDYITLPDAVVSEIRAQWKAKVKDASGKP
FT                   IAD"
FT   sig_peptide     complement(15621..15689)
FT                   /locus_tag="Bphy_3120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(15886..17373)
FT                   /locus_tag="Bphy_3121"
FT   CDS_pept        complement(15886..17373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3121"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bur:Bcep18194_B1880 transcriptional
FT                   regulator, GntR family with aminotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72289"
FT                   /db_xref="GOA:B2JR63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR63"
FT                   /protein_id="ACC72289.1"
FT                   /translation="MNLLNDESLLSHDRAHAQADAPLYERLAAHYRRVIASGTLAPGDR
FT                   MPSVRALMSRHKVSLSTAIQVFRRLEDGGWLQARPRAGYFVRRPAASKLATVAEPDIPV
FT                   LPEPARYVGLHERISRVIERAQAFPDALNLGGATAGAALYPTERLQSLASRILRHKPTL
FT                   LTEVGEDGGAAELRQAIAKRALTADVTVAPDDVLITSGGVEAVNLALRAVAQPGDTIAV
FT                   ESPAFFGLLQILESLGLRALEIPTSPTTGLSLEALDIALTACPEIKAVVAVPNLQNPLG
FT                   CVMPDTRKAELVALCARRGVALIEDEPYRELVEAAQPARPLKSWDRDGGVIHCASLNKA
FT                   LAPGMRLGWMSSGRWHARVRLLKFAQTRHNESLAQFVAAEFIGSGAYDRHLHRLRDKLR
FT                   VQREASADAIGRYFPAGTRLNLPPGGLLLWVALPDGRSSDALFEAALPHGIRIAPGSIF
FT                   SNSERFRSFIRLSCPVPFDERMDAALRQLGRLAAGIA"
FT   gene            17578..17919
FT                   /locus_tag="Bphy_3122"
FT   CDS_pept        17578..17919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72290"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR64"
FT                   /protein_id="ACC72290.1"
FT                   /translation="MKTFDQRYAPGQIHANWFKRGSAITALNGALRLSYRDGSLDWLLG
FT                   DAPKVSVALHEGGCHVLPYEAFVEIIATGESAAIARIDAGPDNSSIAARAVRWCVSMAG
FT                   FNGARLRRS"
FT   gene            complement(17953..19107)
FT                   /locus_tag="Bphy_3123"
FT   CDS_pept        complement(17953..19107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3123"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   bxe:Bxe_B2067 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72291"
FT                   /db_xref="GOA:B2JR65"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR65"
FT                   /protein_id="ACC72291.1"
FT                   /translation="MSVTVRRIAHLDMDAFYASVELLRYPELRGMPVVIGGGRNAAPET
FT                   LADGTRRFARLKDYAGRGVVTTSTYEARASGVFSAMGMMKAAQLAPDAILLPTDFDSYR
FT                   HYSRLFKIEVAKFTTRIEDRGIDEIYIDLTDVPGDAANIGSRIKEAVRAATGLTCSICV
FT                   APNKLLAKIGSELDKPDGLTILTPEDIPSRIWPLAARKINGIGPKASERLATLGINTVG
FT                   DLAHAAPDLLQSNFGLKYATWLTHVARGIDERPVVVESEPKSMSRETTFERDLHPRHDR
FT                   PALSESFTRLCVRVAEDLQRKGYVGHTIGIKLRFDDFSTVTRDLTLPVATSDAGAIRRA
FT                   ATECLKRVALTRKLRLLGVRVSGLSLASEQAPPLPIQAELPFTA"
FT   gene            complement(19271..19576)
FT                   /locus_tag="Bphy_3124"
FT   CDS_pept        complement(19271..19576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72292"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR66"
FT                   /protein_id="ACC72292.1"
FT                   /translation="MKAGRLWVGLAALVLTSAAHAEKYVEIWNPPEARGHAAGATAQKP
FT                   VRPHAQKPASPRLARKVTEPGNRPAVQGASSVVSTKRPGNRSIPRKIGPDGNVFRV"
FT   sig_peptide     complement(19511..19576)
FT                   /locus_tag="Bphy_3124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(19573..19791)
FT                   /locus_tag="Bphy_3125"
FT   CDS_pept        complement(19573..19791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3125"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR67"
FT                   /protein_id="ACC72293.1"
FT                   /translation="MDMRVHHPAGHPMPEIAAFVAALKSAFGEREIDEAIRRGKAGEPT
FT                   FYACENGRSVGTAGWSVATSEAQESEQ"
FT   gene            complement(20007..21191)
FT                   /locus_tag="Bphy_3126"
FT   CDS_pept        complement(20007..21191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3126"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: rso:RSc1082
FT                   probable porin transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72294"
FT                   /db_xref="GOA:B2JR68"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR68"
FT                   /protein_id="ACC72294.1"
FT                   /translation="MKTLTCMRMRAVALACLPFAGAVLSTNALAQSSVTLYGVVDNAFS
FT                   YVSNQRGHSNFYMSQGNLQASKFGLLGAEELGGGTKAIFRLESGFNSLTGAQSSAGNIF
FT                   NRQAYVGLSNDRYGTVTLGRQYTPYFNMVGALGPTGVLTGATGAHPGDLDALDTTLRFN
FT                   NSITYASPTIAGFSFGAQYGLGGVPGSVTNGSNFSAALRYDYQSFSVAAGYVKLKDITT
FT                   SQSLGSFAINSPVNNGYASASSTQMVAAAARYNFNDLMVGVNYSNVQYAPGSHSLFASE
FT                   AVFNTYGAIATYRFTPSVIAGIGYSYTRASKANGIDDPAQYHQISLEQTYSLSKRTTFY
FT                   ALEAYQLARGRSLIASGSGTRIADAVAVVGDSQNTTPSSGPSQFVGMVGIRHAF"
FT   sig_peptide     complement(21099..21191)
FT                   /locus_tag="Bphy_3126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 31"
FT   gene            complement(21259..23700)
FT                   /locus_tag="Bphy_3127"
FT   CDS_pept        complement(21259..23700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3127"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   rso:RSc1081 probable glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72295"
FT                   /db_xref="GOA:B2JRG8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRG8"
FT                   /protein_id="ACC72295.1"
FT                   /translation="MATLKHPPQFSVSEAGAEPARAGQTGKPVVLCAADGARIEVFVLA
FT                   DDIIRVLVLPHGELRGPRTWSIAPGLDDVPLEGRDRHDLQGFEPVAFSAASDAERLVVE
FT                   TAKVRLTVALNGGFCSWEIARDGAWHHVMSDRKTQAYNFGWWDERVYHYVERQRGEMYV
FT                   GLGERAGTLDRANQSYEMRNIDAMGYSARSTDPLYKHIPFYVTWQPQTSLGFGLFYDTL
FT                   ADCRFDMGRELDNYHGHYRHFVAEHGDLDYYFIASADTPLHAVRRFTWLTGRPALMPKW
FT                   GLGYSGSTMSYTDAPDAQRRMGEFIERCREHDVLCDSFHLSSGYTSIGPKRYVFNWNHD
FT                   KFPDIEGFVQGYLREGVRLCPNIKPCLLQDHPAFDEAAKAGLLIQSRDGEPAWVQFWDE
FT                   VGAYLDFTNPNTIDWWKARVKDSLLRYGIASTWNDNNEFEIWTPDAIAQGFGEPFPARQ
FT                   AKVLQTQLMMRASRDAQREYAPRTRPFLVSRSGGVGMQRYVQTWSGDNYTSWETLRYNL
FT                   KMGLGLAMSGVSNSGHDIGGFSGPAPEPELLLRWVAFGIFLPRFSIHSWNDDGTVNEPW
FT                   MYPEATSTIAGLIKLRYRLIPYLYELLWQSHRSYEPVLRPMFAEFPTDPRCLVDGDDMM
FT                   LGSSLLVAPVVEKGQSERDVYLPAGVRWASYWSGEVFDGGQCITQAVPFDQPLMLLREG
FT                   SVIALNVAEQHFAQPADERAFMAVPFQGVGTAQGGCVEDDGETEAWRDGAQGRWNVAIA
FT                   SDATILRISIEREGQMPFEQTEVRLSVPASDTRAVTCTSGTVTGDSIVNGWRRLTLRLA
FT                   S"
FT   gene            complement(23724..25031)
FT                   /locus_tag="Bphy_3128"
FT   CDS_pept        complement(23724..25031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3128"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc1080 putative hexuronate transporter transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72296"
FT                   /db_xref="GOA:B2JRG9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRG9"
FT                   /protein_id="ACC72296.1"
FT                   /translation="METQLKTIIGLRWWIIALVCLGTIVNYLSRNALGVMAPELKTLLH
FT                   MNTQQYSYVVGAFQIGYTIMQPVCGLVIDLIGLRLGFALFACLWSATGMLHGLASGWLS
FT                   LAALRGLMGLSEAVAIPAGMKVVAEWFPNREKSVAVGYFNAGTSLGSLFAPPLVVFLSL
FT                   RYGWQSAFAVTGAMGFVWAALWYVFYRAPADHKRISDKERATITEGQTPPAAYAQDKRR
FT                   IREVLGTRRFWAIAQARFFAEPAWQTFSFWIPLYLATERHMDLKQIALFAWLPFLAADL
FT                   GGLFGGYLSPFLMKRLRVPLIWSRIAGVVLGAFMMIGPACIGLVASPYEAIALFCVGGF
FT                   AHQMISALVNTLAADVFEPGEVGTAAGFAGMAAWIGGLGFSLMVGALADKIGYTPLFGA
FT                   LGAFDLIGAALLVILMRGVTRDARLQRVGNGAGSAA"
FT   gene            25068..25403
FT                   /locus_tag="Bphy_3129"
FT   CDS_pept        25068..25403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72297"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH0"
FT                   /protein_id="ACC72297.1"
FT                   /translation="MTDNVRIRTSDAHLSSVIVSPKHLRDTRENHVAHINIGRKAARMA
FT                   HVRSCQRNLPKNDMACVSFAACSFEHQFVLLRAKSNITTPAECAQNRRARAKKVLTFAT
FT                   FILALAR"
FT   gene            complement(25871..26041)
FT                   /locus_tag="Bphy_3130"
FT   CDS_pept        complement(25871..26041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72298"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH1"
FT                   /protein_id="ACC72298.1"
FT                   /translation="MDILDVARQAGMTVVLEGRIGRQEYHSVHGSLAALQSFAERVRAS
FT                   TMEEVPAVEQQ"
FT   gene            26362..27120
FT                   /locus_tag="Bphy_3131"
FT   CDS_pept        26362..27120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3131"
FT                   /product="putative glutathione S-transferase"
FT                   /note="KEGG: rme:Rmet_1137 putative glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72299"
FT                   /db_xref="GOA:B2JRH2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR026928"
FT                   /db_xref="InterPro:IPR033468"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH2"
FT                   /protein_id="ACC72299.1"
FT                   /translation="MIVYKFGDGSGAMPPDLSPFVVKLETWLRLSNIPYEGRVGNLNAM
FT                   PKKKLPVADIDGVTVCDSSAIIGYLQSRYPHALNDARLDPTQRAQSAAIKALLETHLYF
FT                   VTVYFRWAVDANMALYKPLLVDYARLTAPLPARPVVGALAPLLLPVIRRKVLRQTWEQG
FT                   TGRHSYDEVARMGVDGWQAIADLLGDQLFLLGNEPSTIDATGFAWVHTTAVHPFDSPVR
FT                   EFVSTHPALMAYHERIAARCWPNLVRAARR"
FT   gene            27262..27900
FT                   /locus_tag="Bphy_3132"
FT   CDS_pept        27262..27900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3132"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B2075 amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72300"
FT                   /db_xref="GOA:B2JRH3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH3"
FT                   /protein_id="ACC72300.1"
FT                   /translation="MTTLPILSANVLFAYSAYFVGTASPGPSNLAIMSIATADGRKAAF
FT                   SFAAGVVCGSCFWAMLAALGLSAALLAFSGLMAGLKIFGGCYLLWLAFKSGRSAWQPRA
FT                   AQAQTAGGNPSLRRLYTRGLLLHLTNPKAILVWISVVALASPPNGSAPHMLTIVAGCLA
FT                   IGMLVFGSYAALFSTPFARRVYLSVRRWLDGGLAVVFGLAGLKLLTARA"
FT   gene            complement(27908..28852)
FT                   /locus_tag="Bphy_3133"
FT   CDS_pept        complement(27908..28852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72301"
FT                   /db_xref="GOA:B2JRH4"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016062"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH4"
FT                   /protein_id="ACC72301.1"
FT                   /translation="MRRVLAAFAAFAAFALPLAGAHGADRAAAVETRAFEASPWMSYYG
FT                   DAAGLGSLARVASRFRVIDVDLDPGTDNFTPAEVAVLKNGGRNIVLSYLNLGSCETWRS
FT                   YWREAPAGFVSCAANTAAHAGMYCGYGQEVWMNLSNAAYRRLIVDYVAPRLVAQGADGF
FT                   YLDNLEIVEHGTATRNGPCDAACAQGGLDLVRELREKYPRLVFVMQNATGRTTREGSTG
FT                   GVAFAALLDGVAHEEVYAPKYDASAEAELAVWQAMTLTPNGHAFWIATLDYVGGCDAST
FT                   RARRVFARSRAKGFVPYASDSSARQGVVCYWGK"
FT   sig_peptide     complement(28781..28852)
FT                   /locus_tag="Bphy_3133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 24"
FT   gene            complement(28957..31275)
FT                   /locus_tag="Bphy_3134"
FT   CDS_pept        complement(28957..31275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3134"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: bxe:Bxe_A1494 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   and GAF sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH5"
FT                   /protein_id="ACC72302.1"
FT                   /translation="MSRQVTADIATDKPAGRTRHGADLAAEVRASEQSVLRLLTRSTPL
FT                   PELLAEVCRRAETLLGEGARCSILVLDTDGFTVRVGAAPSLPPQYSAAIDGMRLGPCAG
FT                   SCGTAMHDRRLVIVEDIERDPLWADYRHLALPLGLRACWSVPFEDDAGQVLGAFGVYYD
FT                   RRRRPNDGEQALLREIGQSVGLAVHQDLMRKRLAQSEEHHRLVVDHLNEGIVVQSREGV
FT                   VLACNPSARRMLRATGEVIGRDIYKVIRAAFWDDGSPVETAEQPTRRVLRTGRPVVGIT
FT                   LRLELVGGGSIWITENVVPIFKRGETEAGAVLVSFNDISAVQAARAQLQYLATRDSLTG
FT                   LYNRAYLADRMSERLAPHTSAAAHGRGEPRAAARRLAVLFVDLDGFKKVNDIAGHEAGD
FT                   ALLCSVAARLAGCVRSEDTLARVGGDEFVIATGDYTDASFLTSLAQRVLDTIARPFAVG
FT                   GNEYYLGASIGISLFPDDGCDAQTLMRNADSAMYDAKQRGRHNFQFFTAELSQRLKRRF
FT                   GIEQSLRRALAAGELSLAYQPIVEGATGRIVGAEALLRWRNDELGQVSPVEFIPVAEDT
FT                   GMIIDIGRWVLENACRQAVEWRRTITPHLMIAVNLSPRQINGELIGHVAATLEQTGLEP
FT                   SALELEITEGVLMSDSESVMPLLTTLAGMGVRISVDDFGTGYSSLSYLKRFPLHSLKVD
FT                   RSFVAGLPGHRDAVAITHAVVAMAHSLGMSVTAEGVETSEQSAFLRSIGCERQQGYLFG
FT                   RPVVPGDFAREAQRLHAGT"
FT   gene            complement(31367..32200)
FT                   /locus_tag="Bphy_3135"
FT   CDS_pept        complement(31367..32200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72303"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH6"
FT                   /protein_id="ACC72303.1"
FT                   /translation="MCRWLAYTGNPIQLEAVLFRAKHSLIDQSLHSRLGQTTTNGDGFG
FT                   VGWYGHPTDIPFRYRCAHPAWSDRNLRDAARAVRAPLFVAHIRAATDTPSQETNCHPFR
FT                   YGRWLFMHNGLIRDYPKVRRDLMLGIDPDLFASIEGSTDSEVMFYLALTFGLEFDPVLA
FT                   LERMAGFIEETGRRHGIEAPLNMTVCATDGEQIVSARYSSERQSRSLYHSTSIRHLMEL
FT                   YPDDPRLAAVGEDAFLVLSEPLVDLEGWWEEIPESTAIVARGGAIESQTFDPHRT"
FT   gene            complement(32261..32932)
FT                   /locus_tag="Bphy_3136"
FT   CDS_pept        complement(32261..32932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3136"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bte:BTH_II1391 putative multiple antibiotic
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72304"
FT                   /db_xref="GOA:B2JRH7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH7"
FT                   /protein_id="ACC72304.1"
FT                   /translation="MIASLVSEILFGFTGLISIINPIAIAFVFLDRTDSLTDAERAALA
FT                   RRVAINAFFVLLVVFFVGTPILHFFGISMEALRIGGGLAVAVSAWNMLNAPERQPNEAA
FT                   VKPVDPDNAMSKAFFPLTVPLTTGPGTMATAIALNANRSHKLSEFLMSSIASVTISVLV
FT                   MFAIWFTYNHAATFARLLGKEGTKVALRVSAFLLLCIGVQIILTGLAEFLAPIAAGRLN
FT                   N"
FT   gene            33246..33458
FT                   /locus_tag="Bphy_3137"
FT   CDS_pept        33246..33458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72305"
FT                   /db_xref="GOA:B2JRH8"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH8"
FT                   /protein_id="ACC72305.1"
FT                   /translation="MSFRLLAVLPFIGILLGVPFVNRVEPLVLGMPFVLAWIVMWVVLS
FT                   SIIMGLIYRFDPTNRHAGPGEEVRS"
FT   gene            33455..34933
FT                   /locus_tag="Bphy_3138"
FT   CDS_pept        33455..34933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3138"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bxe:Bxe_B1295
FT                   Na+/monocarboxylate symporter, SSS family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72306"
FT                   /db_xref="GOA:B2JRH9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH9"
FT                   /protein_id="ACC72306.1"
FT                   /translation="MSSALAIIVAVTLFALYLGVRARHGHDMSLEQWTVGGRSFGTAFV
FT                   FLLMAGEIYTTFTFLGGSGFAYGKGAPVYYILAYGTLAYILSYWMLPPVWRFAKAHRLV
FT                   SQPHFFARKYDSASLGVLVAIVDVAALIPYLVLQLKGLGIIVSTASYGAIPSTAAIWIG
FT                   AAVVTIYVTVSGVRGSAWNSVVKDLLILGIVLFLGIYLPIHHYGGLGQMFHAIDAARPG
FT                   FLTFPEKGSSVTWFQSTVLLTALGFFMWPHTFGSVFTAKDERIFRRNAIVLPLYQLILL
FT                   FVFFVGFAAALKVPGLKGGDIDLSLFKLSLATFDPWFVGVIGAAGVLTALVPGSMILTT
FT                   ASTLLANDIYRGLVQRNAADETVARLARFFVPVVAVVAVLFTLHGGETIVALLLMGYSF
FT                   VTQLFPAVICSLAPRTRATKQGAFCGILVGVAVVAVTTLFKMSIAQLMPFLPDALKDVN
FT                   IGFVALALNVVVFFVVSALTQPHARADQSRVHTH"
FT   sig_peptide     33455..33532
FT                   /locus_tag="Bphy_3138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.500 at
FT                   residue 26"
FT   gene            complement(35056..35787)
FT                   /locus_tag="Bphy_3139"
FT   CDS_pept        complement(35056..35787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3139"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: bch:Bcen2424_1678 precorrin-4
FT                   C11-methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72307"
FT                   /db_xref="GOA:B2JRI0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI0"
FT                   /protein_id="ACC72307.1"
FT                   /translation="MTVFFIGAGPGDPELITVKGQRLVRSCPVILYAGSLVPEAVLRGN
FT                   VADKVVNTADLDLDAIVALLAQAHAKGQDVARVHSGDPSLYGAIGEQIRRLKALGIPYE
FT                   IVPGVTATAACAASLGVELTLPDVSQTVILTRYARKTSMPEGEHLGDLARHRATLAIHL
FT                   GVRHLARIVEELTPHYGGDCPVAVIYRASWRDEEKVTGTLANIAAKVEATDIERTALIL
FT                   VGRVLDAEHFANSTLYAKEAE"
FT   gene            complement(35784..36521)
FT                   /locus_tag="Bphy_3140"
FT   CDS_pept        complement(35784..36521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3140"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: bxe:Bxe_B1248 precorrin-6X reductase; TIGRFAM:
FT                   precorrin-6x reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72308"
FT                   /db_xref="GOA:B2JRI1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI1"
FT                   /protein_id="ACC72308.1"
FT                   /translation="MNRVLLLGGTGDALQIARQLGTRHVYSLAGLGRMPEGLACEVRVG
FT                   GFGGSEGLARYIEREGIALVIDATHPYAAQMSANAAAACRETNVPCWALRRAGWSPQTG
FT                   DDWRMVDGWDALVDAIRPFRRVLFTSGREPLAHLDDIPAHQFWIVRCLDAHRGNERARI
FT                   IDARGPFDIDGERALFALNRIDVLVTKHSGGSATQAKLEVARELKVPVVMMRRPSLPEV
FT                   DREFDSPAQLLRALNEEEGSAER"
FT   gene            complement(36518..37618)
FT                   /locus_tag="Bphy_3141"
FT   CDS_pept        complement(36518..37618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3141"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   bxe:Bxe_B1247 cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72309"
FT                   /db_xref="GOA:B2JRI2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JRI2"
FT                   /protein_id="ACC72309.1"
FT                   /translation="MRDETPEQPALLRSGYTTGSCATVTSLAAARLLLSGIASDVAEIV
FT                   LPKGQHVPMKLVFCRLLNDGKDGAEAGTIKDAGDDPDVTHGAIVFARVRLADAPGVRFH
FT                   AGPGVGTVTRAGLTLAVGEPAINPVPRQMMTAHLTDLAAEYGYAGGFEVAIGVENGEAL
FT                   AQKTMNPRLGIVGGLSILGTTGIVRPFSCSAYIASIHQGIDVARANGYRHIAACTGNAS
FT                   EDAMRAYYQLPDIALIEMGDFAGAVLKHLKRAPVDKLSMCGGFGKLSKLAAGHLDLHSR
FT                   NSSIDLRQLAQWCASHAASNATLQAAIVGANTSQEALAMALKEGVPLGDIVCARARDVA
FT                   REIVPASVEVEMFAIDRQGNIVGEAR"
FT   gene            complement(37618..38823)
FT                   /locus_tag="Bphy_3142"
FT   CDS_pept        complement(37618..38823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3142"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: bxe:Bxe_B1246 precorrin-6Y
FT                   C5,15-methyltransferase(decarboxylating); TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72310"
FT                   /db_xref="GOA:B2JRI3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI3"
FT                   /protein_id="ACC72310.1"
FT                   /translation="MPAWLTVVGMGDDGFAGLGKAARRALIDASVIYGGERHLSMLPAC
FT                   LNAVREPWPQPFDIAPVLARRNTPVCVLASGDPMFYGVGATLARQVPADELRVLPAPSS
FT                   VSLAAARLGWALQDVPTVSLVGRPLAALQTHLHEDARVFVLSADGTTPAAVAAWLGERG
FT                   FGATRMIVMEHLGSEAERAIDARAHEWSIGETAALNLIALECRRAAPDAPRLPLTPGLP
FT                   DNAFRHDGQLTKRDVRALTLGRLAPAPGELLWDVGAGCGSIGIEWMRSHASCRAIAIEA
FT                   NGERQGFIEHNRDALGVPGLQLIAGKAPAALQDLPAPDAIFIGGGVTVEGVLDTCWRAL
FT                   KSGGRLVANAVTLEGEAALIAWRAQHGGTLTRIALAEAQPLGGFETWRSGLPVTLLDTR
FT                   KP"
FT   gene            39178..40575
FT                   /locus_tag="Bphy_3143"
FT   CDS_pept        39178..40575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3143"
FT                   /product="precorrin-3B synthase"
FT                   /note="TIGRFAM: precorrin-3B synthase; PFAM:
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; nitrite and sulphite reductase
FT                   4Fe-4S region; KEGG: bxe:Bxe_B1245 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72311"
FT                   /db_xref="GOA:B2JRI4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI4"
FT                   /protein_id="ACC72311.1"
FT                   /translation="MNQAFHSSNAFPLRPSACPGLLRIVPALDGGICRVKLQRGELSAT
FT                   QALAIADAIDEHASGIVDLTNRANLQLRGVKRGHENALIAALLGAALGPRDAAHAHADD
FT                   VRNVMTSPAAGCDAHALYDTTALAAELLSLLQSDARCAALSPKFALLLDGGERLMMLDH
FT                   PHDIWCSALHPRDHAEPMFALGLAGCPPVLEGHPAALAAVPASELVALTRALLHTFLDL
FT                   AAPDHTRMRDLLAKQSVESVLARAERESGVRLLRGQSIQSWRREPADASRRFGAWQQRD
FT                   AHRDKQRWHIGGQPALGRVNSATLRRLALLTKEQGATLRMTPWQSVLLTDIGTANLDAT
FT                   LQTLDALGLATTTDNPLTRVIACAGSTGCVKSLADTKADAVKLAARLPDNTRVHLSGCP
FT                   RSCAAAQCAPFTMLAAQNGRYDLYHTHDPRESTGFGRLLARGLTIDEAADLLNASAAPP
FT                   FDEPFDA"
FT   gene            40556..41194
FT                   /locus_tag="Bphy_3144"
FT   CDS_pept        40556..41194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3144"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   bxe:Bxe_B1244 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72312"
FT                   /db_xref="GOA:B2JRI5"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI5"
FT                   /protein_id="ACC72312.1"
FT                   /translation="MSHSMPDYIRDGQEIYRQSFATIRAEADLSRIPADLEKLAVRVIH
FT                   ACGMVDIVGDLRFSDGAGRAGRHALANGAPILCDARMVAEGITRARLPANNDVICTLAD
FT                   PSVPALARELGNTRSAVALELWRPHLAGSVVVIGNAPTSLFYLLDMLDAGAPRPALILG
FT                   FPVGFVGAAESKAMLAADSRGVPFVAVYGRRGGSAMAAAAVNALASEDE"
FT   gene            41195..41950
FT                   /locus_tag="Bphy_3145"
FT   CDS_pept        41195..41950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3145"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: bxe:Bxe_B1243 precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72313"
FT                   /db_xref="GOA:B2JRI6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI6"
FT                   /protein_id="ACC72313.1"
FT                   /translation="MAEQKVMRGRLYGLGVGPGDPELITIKALRLLKSAHVVAYFVAKG
FT                   KKGNAFSIIEAHLSAEQEQLPLVYPVTTEALEPPLSYEAIIADFYDTAAEVVARHLDAG
FT                   RDVAVICEGDPFFYGSYMYLHDRLANRLSPRFEAEVVPGVCSMLGGVAVLGQPLVYRNQ
FT                   TLSVLSGVLPEDELKRRLAAADAAVVMKLGRNFDKVRRVLDELGLAERALYVERATMAN
FT                   QRIVPLAEVDPMASPYFSLLVVPGEKWQG"
FT   gene            41947..43665
FT                   /locus_tag="Bphy_3146"
FT   CDS_pept        41947..43665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3146"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; cobalamin (vitamin B12) biosynthesis
FT                   CbiG protein; KEGG: bur:Bcep18194_A4821 precorrin-3B
FT                   C17-methyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72314"
FT                   /db_xref="GOA:B2JRI7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI7"
FT                   /protein_id="ACC72314.1"
FT                   /translation="MTVPPAIVTLGVGALDTARRVQALYDGAQVHGLQGRVNEADIAYT
FT                   ELGAHLRELYASGTPIVALCAAGIVIRCVAPLLSNKGGEPPVLAVAEDGSAVVPLLGGL
FT                   SGVNAMAREIAGALDVPPAITTSGELRFGACVLNPPEGYALASLDHGKRFVSDLLAGEA
FT                   TRIEGDAPWLDDVQLPRVDNARRTIRVTPLAWSGATDELVIHPRSVVVAVHASATGDNL
FT                   HERVLEAARVQGLAAPSLAVLLAPASQIGDPVLRDVADALHVALRFAADSEAASNAADM
FT                   LRQTLRVPHTAFVTDAPIAFAAAHAPLDPATVGRARGKLSVVGLGPGDASLMVPAARAA
FT                   LTQATDILGYDTYVKMAGPFRAEQRVHGTDNREEMQRARHAFELASAGHHVAMVSSGDP
FT                   GVFAMAAAVLEALDEAHADAHRAAWSAVELEIVPGVSAAFATAAQAGAPLGHDFCVLSL
FT                   SDNLKPWTVIETRLRHAAEADLVMAFYNPISRARPWQLDRALDIVRDLRAPSTVVVLGR
FT                   DIGRPGATLKTTTLAELQSSDVDMRTMVIIGSTTTRAFNAAEPRRTWVYTPRWYA"
FT   gene            43826..44779
FT                   /locus_tag="Bphy_3147"
FT   CDS_pept        43826..44779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3147"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   bxe:Bxe_B1643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72315"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI8"
FT                   /protein_id="ACC72315.1"
FT                   /translation="MQTSEDTVQTGASAPVLSRQLAPDAVPVGEPLAFPVVDSDGMLLF
FT                   DRGAVVIGAEEHRFLFQHFKPQRGDLSEVPQDGAAAPLSTAKQQADADSLALKDMHLTI
FT                   GALIGVRSQVGMGAPMHPSRIIGFAPNESLFVTPPLVDGKAMQLAVGENIEIVAIASQA
FT                   VFRFVCTVDSVCLVPFHYLVLSKPGAVRRLRERKSVRVRANLPLRFGIDANGTGYESLG
FT                   LVQSVSAMGMSFAAPWTVGEVGKRIRVAFALRSKDLETSIETTAIIRNVQAGSSPGDPI
FT                   THGIEFEKLDQVEQMALKVYVFDRIDDVIFWTSGPK"
FT   gene            complement(44904..46019)
FT                   /locus_tag="Bphy_3148"
FT   CDS_pept        complement(44904..46019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3148"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: asa:ASA_0507
FT                   outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72316"
FT                   /db_xref="GOA:B2JRI9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI9"
FT                   /protein_id="ACC72316.1"
FT                   /translation="MKTPKLRGPVFMTLAATLAAVIAAPAFAESISSQVKALTPLAQRI
FT                   ADPYRRGAAEGFLEIAERQDSHVLVSNVYNDAANRALGNARFLIDNGAPWQGLYAAKNW
FT                   PTRDKWVQAIRSIEATNARAASSTCKGESAGRLLALTDEVWKEQDETHGTHWVHGWEAI
FT                   ERAKKLSVQVNDELDHCAPPPPPPPAADSPLPEKPISLSADALFDFDSAKLKAEGFEAV
FT                   DVLASNLKRVKAIDVVTVIGYTDRFGSVAHNRDLSRRRAQAVADALKQRGVDPGHFDVR
FT                   GAGSTAPVVTCPGPKKPAVIECLAPNRRVEIRVSGQTAASVPTPDAGSQRFAQAPQPVQ
FT                   PARVRPQAQQQLQLRKQWQMPAQSQPAPQQP"
FT   sig_peptide     complement(45933..46019)
FT                   /locus_tag="Bphy_3148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(46071..54677)
FT                   /locus_tag="Bphy_3149"
FT   CDS_pept        complement(46071..54677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3149"
FT                   /product="Haemagluttinin domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   bxe:Bxe_A0586 putative membrane-anchored cell surface
FT                   protein, haemagluttinin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72317"
FT                   /db_xref="GOA:B2JRJ0"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ0"
FT                   /protein_id="ACC72317.1"
FT                   /translation="MNKTYRSVWNESTGTWVAVQENAKGRRKKAAQSAVALLAAGAGLT
FT                   SSLAHAGALDGGYAPGYGASSLGYASSATGDYSTALGSFTNASGNWSTAVGNQSTASGF
FT                   ASAAFGDSAIASAQYATALGQNTYASGAGATAVGQNARATGYVSSSLGYASSSSGSWST
FT                   ALGSFATATGDWSTGVGNQATATGFSAAAFGDSAVASANYATALGQAAHASGTGSSAVG
FT                   QDATSVGAYSVALGESASATTSKSVALGAYSVANSTTLSSAGFEPGGAVISAASAAGGE
FT                   MSVGSAGAERRVTNVAAGLNGTDAVNVSQLMAEDARVNVLSNTVNNIGNNGNGGTIKYF
FT                   HANSTAADSAASGQNSIAVGPQALASNSYGIAMGPLATASGVSGVAIGAASLSTAQQSD
FT                   AFGDYATASGLYSVALGNQSTASAQSALAVGDTAIASGVNSSAIGRQATASTSNSVALG
FT                   ANSIASSTTLGSAGFNPGGASINASTAVGEVSIGSANAERRLTNVAAGYSATDAVNVSQ
FT                   LMSEDAKVNAEGAATAAALGGGSSYNSTTGAITNPTYNISGGTYNNVAGALTSIDARIN
FT                   NIGNGSSGGNLKYFHANSSLADSTATGVDSVVAGPAATASANSAVALGADSVADRDNTV
FT                   SVGSSTAQRQITNMAAGTAATDAVNVSQLTGVTTAIGGGASVKADGTIAQPTFNVYGQT
FT                   YSNVGDALASINNNTGNIVQNLKYIKFGASTAAAAQAGGTDSIAIGGNAVATANGAIAI
FT                   GRGANATASNSVALGVNSVANTANTFAVGSAVLTRRIVNVADGTATTDAATVGQVNADI
FT                   QAAIASLQTPLTSKPALLGSTPTLRSTQLLGATSSLTPDQLIFSGPTDKAGMTYAQGQD
FT                   SIAIGLNSQATADYAVAIGDNAQSLDNSTVAIGQTAITDGQSAVAIGSQVSANGSYAIA
FT                   IGNNGTLAQADNAIAIGNNVQVGGVNTMAVGENIVSTGTNSIVLGYASADGGRANVLSV
FT                   GSSTQQRQIVNVAAGTQNTDAVNVSQLKGAVSALGGGATVNPTTGVVTAPAYNVAGGTY
FT                   VNVGAALSALDAGEKAISNNVMNVTNVVNNITNGGGIKYFHTNSTLADSLANGANSVAI
FT                   GGNAVATTSNSVALGSNSVASAATLSSAGFAPGGFSISATTATGEVSVGAQGAERRVTN
FT                   IAAGYAATDAVNVSQLMAEDQRVNVVSNNLSNLSNVVNNLGGSINLKYFHSNSTLTDST
FT                   ASGTDAVAVGPQATAAGTSAIAIGNSASATAANSVALGSNATTTANLSAAAYNPGSATL
FT                   SGTTASGEVSVGNASFNRRITNVAAGSAATDAVNVSQLMSEDAKVNAEGAGTAAALGGG
FT                   SSYNASTGAITNPTYNVSGGTYNNIAGALTGIDARVTNMGNNITYLNNVINNTIINGGG
FT                   IKYFHANSTLADSTASGTDSVAIGGAASASASNSVALGSNATTTANLSAAAYNPGSTTL
FT                   SGTTAAGEVSVGNAGLNRRITNLAAGSAATDAVNVSQLMSEDAKVNAEGAATAAALGGG
FT                   SSYNPSTGAITNPTYNVAGATTNNVGGALTSIDARINNIQVGGGIKYFHANSTLADSTA
FT                   SGMNSVAIGGAAMASASNSVALGANSLANSSTLASTGFAPGGLTISAGTAAGEVSVGTS
FT                   GAERRITNVAAGYSATDAVNLSQLMAEDAKVNNVSNNLTNLSNIVNNISGGSNLKYFQV
FT                   NSSLANASATGTDSVAAGPNAVATASNAVALGANSVADRANTVSVGSSGSQRQIVNLAA
FT                   GTNPTDAVNVSQLAGVTAALGGGATVNPTTGAIVAPAYNVLGNTYSNVGSALSAFLDAS
FT                   SNLQTSLKYINFGPSTAAKSQASGTDAIAIGGNAVATANGAVAIGRGANATASNSVALG
FT                   VNSVANTANTFAVGSAVSTRRIVNVADGTAATDAATVGQVNADIQTAITNLQTSLASKP
FT                   ALLGSAPAVRSTQLVGAVGGAFPSPSSLTPDQLIFSGPTDKVGMTYAEGQDSMAIGLNS
FT                   QATADYAVAIGDNAQSLDNSAVAIGQTAITDGQSAVAIGSQVSANGDYAIAIGNNGTLV
FT                   QGANDMAIGNNVQVGGVNTMAIGENIVTTGTNDVVLGYASTDGGRANIVSVGSNTQQRQ
FT                   IINVAAGTQKTDAVNVSQLSGVTTALGGGASVNPTTGAVVAPAYSLAGSTYSNVGAALS
FT                   SLDTRIASSGDPLAVDYDAAAKNQITLKGASGTKISGLMAGALNATSSEAVNGSQLYAQ
FT                   GVSTAQALGGGASVNTTTGAITAPQYTFGGATYTNVGDALTALNNAAGSGNALGVVYNA
FT                   QDKSEITLAGANGTKIDKLAAGDVNASSSDAVNGAQLYNVAASAANAIGGGSTVNNDGT
FT                   ISNPTYVVGGSTVTTIGGAITNLDARVYANSTDITNLQTQINEGGIGLVTQDATSKNIL
FT                   VASATGGSLVDFTGTAGARRLTGVAAGNVSASSLEAVNGTQLYNVAASAANAIGGGSTV
FT                   NNDGTISNPTYVVGGSTVTTIGGAITNLDARVYANSTDITNLQTQINEGGIGMVTQDQP
FT                   GSNILVASKTDGSVVDFTGTAGARILSGVAAGVAATDAVNVGQLQAAGIIDPNGKTKAA
FT                   VTYDTNANGSTDYSSITLGDGTANAAPVTIHNVAAGTQSNDAVNYSQYAALQAQVNNIT
FT                   NAGTGVDTLFVGDGDRNTEAAQAGGTHATAMGALSVANGTQSVAAGYASNASGQNAVAM
FT                   GANASASGNNAVALGAGSVADQDNTVSVGSATQQRRVTNVAAGTASTDAVNVGQLNEAI
FT                   AQANASVDDKVSQGVQSANAYTNQQINNLDKKMNSLGAAAMAATSLIPNARAEGNFQMS
FT                   AAAGTYGGAAAIALGANYWVNDRLLVNAHVTRSTGYGASTGASVGATFGF"
FT   sig_peptide     complement(54522..54677)
FT                   /locus_tag="Bphy_3149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 52"
FT   gene            complement(55130..55777)
FT                   /locus_tag="Bphy_3150"
FT   CDS_pept        complement(55130..55777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3150"
FT                   /product="magnesium chelatase subunit ChlD"
FT                   /note="KEGG: bpm:BURPS1710b_2102 magnesium chelatase
FT                   subunit ChlD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72318"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ1"
FT                   /protein_id="ACC72318.1"
FT                   /translation="MRSGFRWRQGAGDVSRVGLAGARIAWPRTLAAKRNEQLTTDHLRF
FT                   KHEEAHSGVLHCFLLDCSASMMAGQRLALAKGILVALFDQARMTRDQVALICFGGSEAD
FT                   VRFGPAVPRWWNERWLSPIGGGGGTPLLLGIETAASLLERAARKRPTQQRWLWVFSDGR
FT                   SSGSPVRPRVADEVVFVDFEDSPSRLGRCSRMAGLWRAQCISSDELICARSR"
FT   gene            complement(55807..56835)
FT                   /locus_tag="Bphy_3151"
FT   CDS_pept        complement(55807..56835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3151"
FT                   /product="Magnesium chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: bxe:Bxe_B1645 putative magnesium chelatase,
FT                   ChlI subunit; PFAM: magnesium chelatase ChlI subunit;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72319"
FT                   /db_xref="GOA:B2JRJ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ2"
FT                   /protein_id="ACC72319.1"
FT                   /translation="MSEANARRAAFPFSALIGQAPLQQALLLAAVDPGIGGVLVSGPRG
FT                   TAKSTAARALAELLPEGQFVTLPLGASEDRLIGTLDIESALRDASVRFSPGLLAKAHRG
FT                   VLYVDEVNLLPDGLVDALLDAAASGVNTVERDGVSHTHDASFVLIGTMNPEEGELRPQL
FT                   TDRFGLMVALENCYEPQIRQDIVKARLAFDLDPFAFRARHAVQQAAYIERLCDARAALT
FT                   RLSFDEAVHAHVSALCIAAGVDGLRADLMMLRAARALAAFEAAEVVTVEHVDRVAESVL
FT                   LHRRRFDDEAAHPHEAASSPGQPSSTDSANSSTDSDYGYLPPEPAGITHVKGVIPLSTK
FT                   KR"
FT   gene            complement(56832..60635)
FT                   /locus_tag="Bphy_3152"
FT   CDS_pept        complement(56832..60635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3152"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: bxe:Bxe_B1646 putative cobalamin
FT                   biosynthesis-related protein; TIGRFAM: cobaltochelatase,
FT                   CobN subunit; PFAM: CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72320"
FT                   /db_xref="GOA:B2JRJ3"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ3"
FT                   /protein_id="ACC72320.1"
FT                   /translation="MHLLRTVPGGFVDDAKGVIRIDQKPADIVILSSADTTLSLLASVV
FT                   PRLGEGFPSVRLANVTYLRQPASVDFYVDDVLQHARVVVVDHLGGEAYWPYGIEQVVAL
FT                   AQRNRQTLAMFSGDLQEDPNLLARSTADADLCHQLWRYLREGGARNAESFMRCIAWRAL
FT                   GWGDEPAPPNALPAAALYHPARDAATIEDWQARWTPGAPVVAILFYKAHVQAANTAVFD
FT                   ALIDALEARGMNALPVAITSLKDAISRDVVQQLAERHDVALVLNTTAFAASAIDDPEPL
FT                   ALAGDAPVMQVILSGGNREEWVKDNHGLNSRDIAMHVALPEVDGRIITRAISFKGLAYR
FT                   CPHTEVDVVRYQPDQERVAFVAELTERWCKLRRTSNADKKLALILANYPMSEGRIGNGV
FT                   GLDTPASVVNILQMLRNDGYRVDDAPLNGDALMVALTQGVTNDPAVRDLRPALQSLALG
FT                   DYMTHFARLPQSLRDALNAKWGPPERDPTLRRGRFMIAGRRCGHVFIGIQPPRSREQND
FT                   YASYHDAELAPPHAYLAFYFWLRHQFGIDAVVHVGKHGNLEWLPGKSVALSDACWPDAI
FT                   LGPLPHLYPFIVNDPGEGSQAKRRTQAVIVDHLMPPLTRAESYGPLQDLERQVDEYYDA
FT                   LMVDARRAKLLRRTILDTIVKHRLHEELSLEAPSDADSEDTLLTRVDAWLCELKEAQIR
FT                   DGLHTFGQSPQGMQRRDTLLALGRFPVSDGQGANAGLIDALARDLQVDHLFDPLSADWA
FT                   AAWEGPYPALLQQVSDAPWRHNGDTRERLELLAASLLDDMCGLPGDSRIQLNAGELPHA
FT                   ARVLQRLRNDILPRLDACGAHELMHLKRGLEGRFVPPGPSGSPSRGRPDVLPTGRNFYS
FT                   VDTRAIPTQAAWSLGLKSAQTLIERHLQEHGDYPRAIGLSVWGTATMRTGGDDIAQALA
FT                   LIGVRPKWAPGSHRVTDFEIMPIAAFDRPRIDVTLRVSGFFRDAFANVMHLFDAAVQAV
FT                   AELDEPEDVNPIRARVMRERDAWIARGVAPHEARRRAGFRVFSARPGAYGAGLQQMIDT
FT                   QQWQTDADLANAYLSWGGYAYTQKSAGEEARHAFGTRLAAMDVVLQNQDNREHDVLDSN
FT                   DYYQFHGGMTAAVRHLAGSQPHVYHADHSNPDTPRIRTLHEEIARVIRSRVVNPKWLDG
FT                   VKRHGYKGAAEIAATVDYLYGYDATARVVADHQYALVADAYVNDADTREFMQRHNPHAL
FT                   SAVCERLLEAMQRGLWQQPGDYRAQIEQHLLDSEQHIEGSRS"
FT   gene            complement(60646..61755)
FT                   /locus_tag="Bphy_3153"
FT   CDS_pept        complement(60646..61755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3153"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobW; PFAM:
FT                   cobalamin synthesis protein P47K; cobalamin synthesis CobW
FT                   domain protein; KEGG: bxe:Bxe_B1647 CobW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72321"
FT                   /db_xref="GOA:B2JRJ4"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ4"
FT                   /protein_id="ACC72321.1"
FT                   /translation="MQTQMRKIPVTIVTGFLGSGKTTLMRHILQRAGGLRIAVIVNEFG
FT                   ELGIDGEILKGCGIGCDENGNETEGQLYELANGCLCCTVQEEFLPVMEQLVERRGQIDH
FT                   VLIETSGLALPKPLVQAFNWPSIKNSFTVDAVVTVVDGPAVASGQFADDPVAVDRLRKA
FT                   DPNLDHESPLHELFEDQLSAADLVILNKTDLLDEAQQAAVESTLREEIPPQVKVVRAHM
FT                   GQLDLHALLGLESASEETIHLRHDHHGSADDPDHADHHHDEFDSVVVTVRAPSRETMIA
FT                   ALTQVVEGHAIYRVKGFAALPGAAMRLVIQGVGRRFDSYFDRRWQAGEVDSATLSRFVL
FT                   IGSDLDQRVLQRALDEALNDIMSAQAQQA"
FT   misc_binding    complement(61941..62220)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 45.24"
FT   misc_binding    62330..62588
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 72.73"
FT   gene            62775..63518
FT                   /locus_tag="Bphy_3154"
FT   CDS_pept        62775..63518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3154"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: bxe:Bxe_B1649 uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72322"
FT                   /db_xref="GOA:B2JRJ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ5"
FT                   /protein_id="ACC72322.1"
FT                   /translation="MTRAWLIGAGPGDVELLTLKAVRTLAQADVVLIDDLANPEVLQFA
FT                   RDDALIVHVGKRGGHASTPQPAIVAMMLDHLRAGRSVARLKGGDPFVFGRGGEEQQALQ
FT                   AAGVHVEIVNGITAGIAAPAAIGIPVTHRDYAQGVIFVTGHGAHEHEADWPALAATRMT
FT                   LVIYMGMRRLNDIVDALLRADMSPDTPCAAIESATRPEQRHVCAALRDLAQRVARAKLG
FT                   SPSIIVIGGVASLATPVDAFLQRAS"
FT   gene            63515..63949
FT                   /locus_tag="Bphy_3155"
FT   CDS_pept        63515..63949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3155"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: cvi:CV_1563 precorrin methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72323"
FT                   /db_xref="GOA:B2JRJ6"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ6"
FT                   /protein_id="ACC72323.1"
FT                   /translation="MTGLIVGIGCRRGVSAEQIEAAVRDALGGTLPFDALGAVATVDMK
FT                   AGEPGLVAFCARHALPLRTFTREQIAALDARTNASHAVREHMGVDGVCEPCALLATQNG
FT                   RLLVHKRARDGVTVAIACAADAGRAIHQHSNYTPGSKDNR"
FT   gene            63946..64548
FT                   /locus_tag="Bphy_3156"
FT   CDS_pept        63946..64548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3156"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: bxe:Bxe_B1655 ATP-corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72324"
FT                   /db_xref="GOA:B2JRJ7"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ7"
FT                   /protein_id="ACC72324.1"
FT                   /translation="MKTDPESHARMTQRRREGHEKKQAQATIEKGLLIVYTGTGKGKST
FT                   AAFGMAVRVLGHGLKLGVVQFIKGALHTSERDFLGTQANCDFVTMGDGYTWNTQDREAD
FT                   MATARKGWNEARRMIESGEYQMVILDELNTVLKYEYLPLEEVLGVINARPEMLHVVITG
FT                   RHAPDALIDAADLVTEMRLVKHPYREQHVKAQRGVEF"
FT   gene            64552..65856
FT                   /locus_tag="Bphy_3157"
FT   CDS_pept        64552..65856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3157"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG:
FT                   bxe:Bxe_B1656 CobB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72325"
FT                   /db_xref="GOA:B2JRJ8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ8"
FT                   /protein_id="ACC72325.1"
FT                   /translation="MPACPALFISAPASGQGKTTVTAALARHHRRMGRDVRVFKTGPDF
FT                   LDPMILARASGASVMSLDLWMVGEHACRALLAEAARNADLILIEGVMGLFDGTPSSADL
FT                   AAKFDVPVAAVISAKAMAQTFGAVAFGLARFRPDVPFHGVFANRVGSARHAQMLEESLP
FT                   AGLTMLGYLSSTDAIELPDRHLGLLQAAEIGDLDARLDRAAEALASTALAQLPPVVAFD
FT                   EPAQEATLPRLLDGMHIAIARDAAFAFIYPANVQLLEALGARVTYFSPLADEPVPVDAS
FT                   ALYLPGGYPELHALALAANARSAASVRAHAAANKTIVAECGGMLYLLDSVTDTQGITTP
FT                   MLGLLPGHAAMQTRFAALGMQQVDDSLHGTLTGHTFHYSRVSTPLAPVRHATRAQSDAP
FT                   GEAVYRQGSIVATYMHGYWPSNPAFAAALFNGRAF"
FT   gene            65840..66535
FT                   /locus_tag="Bphy_3158"
FT   CDS_pept        65840..66535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3158"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /note="TIGRFAM: cob(II)yrinic acid a,c-diamide reductase;
FT                   PFAM: nitroreductase; KEGG: bxe:Bxe_B1657 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72326"
FT                   /db_xref="GOA:B2JRJ9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRJ9"
FT                   /protein_id="ACC72326.1"
FT                   /translation="MAEPFDDAERAAVYRAIYERRDMRHFVPTPVDPGVLARLVDAAHH
FT                   APSVGYMQPWRIGRITDPALRQNLHTAVERERVLTADALGKRRDEFMKLKVEGMLECGE
FT                   LLVMALMDGREKHVFGRRTLPEMDLASVACAIQNMWLAARAEGLGMGWVSLFDADEVRA
FT                   MLGMPAGARPVALLCLGHVEHFYREPMLESEGWATRMPLAACLFENKWPATPPDCHAKK
FT                   PEDDASETV"
FT   gene            complement(66565..67251)
FT                   /locus_tag="Bphy_3159"
FT   CDS_pept        complement(66565..67251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3159"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B1661 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72327"
FT                   /db_xref="GOA:B2JRK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK0"
FT                   /protein_id="ACC72327.1"
FT                   /translation="MRIAVLEETRAQADFVCRTLSAAGHMCHAFEDGQALVRQLRSQPF
FT                   DLLVLDRHPPGQSGDEVLRWVRQDLAERLPVLFMTRATDVAHQDVDADDHLVKPVSAAA
FT                   LLARVGVLLRGAFQRQQMAEKEVFGEYEFEPGSKRVHVRGSAVTLTHKEFELALLLFKH
FT                   LSRPLSRSHILDAIWKQAAGIPSRTMDTHVSMLRSKLGLRPENGYRLMPIYGYGYRLDR
FT                   IEKGDA"
FT   gene            complement(68114..69004)
FT                   /locus_tag="Bphy_3160"
FT   CDS_pept        complement(68114..69004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3160"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bxe:Bxe_B1665 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72328"
FT                   /db_xref="GOA:B2JRK1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK1"
FT                   /protein_id="ACC72328.1"
FT                   /translation="MGPTRPCGFIWTYIESAQLGLLDWRSFPDPAPMFATHRQNEILRL
FT                   VRARQTCTIAELAATFAVSDETIRRDLKPLVAGGLLVKVHGGVMLPAQLDEPPFRRRMV
FT                   EQREAKRAIAARVAQLIEDGDSLMLDGGTTCVHIAQALESHTRLSVVTNSAEVARLLSP
FT                   RNGNRVLMAGGELRADDASAVGDSALAFFRQFHVRHAIVSVTAIDAKARFMDAHPADAA
FT                   IAQAAFAQAERRIVAADHTKFGHSALVHVFGAQGLDTLVTDIEPATGLSKVLTHAGVEI
FT                   IRASSVADDTSEEVV"
FT   gene            69118..71601
FT                   /locus_tag="Bphy_3161"
FT   CDS_pept        69118..71601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3161"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; glycine cleavage
FT                   T protein (aminomethyl transferase); Glycine cleavage
FT                   T-protein barrel; KEGG: bxe:Bxe_B1666 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72329"
FT                   /db_xref="GOA:B2JRK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK2"
FT                   /protein_id="ACC72329.1"
FT                   /translation="MSTPLPTQARVVIVGGGIIGCSVAYHLTKLGWTDVVLLEQGQLSC
FT                   GTTWHAAGLVGQLRAQESMTKLIRYSTALYAELEADTGLATGWKQCGSLSVARTAQRMT
FT                   QLRRTAAIARAYGVACDVIGPQEAGELWQPMRTDDLLGAVWLPGDGKANPTDLTQALAR
FT                   GARRRGARIVENTRVTAIHTRAAAKGRAASGVAWRDKQGDEGAIAAEIVVNCAGQWAKQ
FT                   VGRLCGVTVPLHSAEHYYIVTERIEGVHPDLPVMRDPDGYIYFKEEVGGLVMGGFEPDA
FT                   KPWGMNGIPDHFEFQLLPDDWDQFQILMENALQRVPALETAQVRQFYNGPESFTPDNNF
FT                   MLGEAPELRNFYVGAGFNSMGIASAGGAGMALAEWIVAGEPTMDLWPVDIRRFARFNGN
FT                   DTWLHDRVKETLGLHYAMPWPNREPDSARPFRRSPLYALLRDDGACFGSKMGWERANFF
FT                   APTGEQAHIDYSFGQQNWLSWSGEEHRACREGAALFDLTPFSKFLVKGRDAEAVLQQIV
FT                   ANDVAVPPGTSVYTGMLNERGGYESDFTLTRLCDDQYLLVTGSAQTTRDFDAIERRIPP
FT                   DSHCMLVDVTSQYAVLAVMGPRARDLLASVSKAGWNNEAFAFGQSREVDIGYATVRATR
FT                   ITYVGELGWELYVPVEFAVGVYETLHAAGKQFGLKNAGYYALDSLRIEKGYRAWGRELS
FT                   PETNPFEAGLAFACKLDKDVPFVGREALVRLRGEPLQRRLAVLTADGASDRMLWGGEAI
FT                   VRDGVAVGFVSSAAFGHTLGCPVAMGYVKRNDGAALDDAWLTSGRYQIDVAGELLHATL
FT                   HLRAPYDPAATRVKS"
FT   gene            complement(71625..72482)
FT                   /locus_tag="Bphy_3162"
FT   CDS_pept        complement(71625..72482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3162"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B1673 putative transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72330"
FT                   /db_xref="GOA:B2JRK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK3"
FT                   /protein_id="ACC72330.1"
FT                   /translation="MNANHPAWVPHSGARESLLSSASLGWSGFGAELLGISAGTHCLPA
FT                   FAEHRVGVHVGAPVRAVCRCDGQRAARIQAHGDADVVPAGVDGEWSDDASCTVLRIWFA
FT                   DDFVRTTVDQLGPRSAHAHIRPQLQLRDARVQHLAWAMRAELEAEHACDPLYAESLCTA
FT                   MIVRLAGAAPAGDGKRRTLSSRAAARVIDYIDAHLDGRLTLTELAALVELSVPHFKVLF
FT                   RETMGVPLHRYVVQRRVERARELLLQGRSNASQVALEAGFAHQSHMAHWMKRLLGVTPR
FT                   ELLR"
FT   gene            72675..73556
FT                   /locus_tag="Bphy_3163"
FT   CDS_pept        72675..73556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3163"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: TrkA-N domain protein; NmrA family protein;
FT                   KEGG: bxe:Bxe_B1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72331"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK4"
FT                   /protein_id="ACC72331.1"
FT                   /translation="MYVIFGASGNVGRKTAAALRDAGHAVRAVVRNPAHSDMFTGIGCE
FT                   VVQGDLDDEASLHRALHDAHAVQMLCPLPHGGADPAIAMHRMIATAARALRKHPHLHVV
FT                   ALSDYGAEQHEGTGITMLFHDLEAAFAESVRRLTLLRSAEHMHNWARVLPVALATGKLP
FT                   SLHHPLDRPFPTVSAQDVGELAAQLLVEGRDADGVRIVSIEGPRRYDANDVARALSEAA
FT                   RRDITALALPRSEWTPTMLRAGLGANHAKLITDLYDAQNAGCIDVDPRSERRFGKTELP
FT                   GVFAGLVRDARA"
FT   gene            complement(73689..74621)
FT                   /pseudo
FT                   /locus_tag="Bphy_3164"
FT   gene            complement(74700..75017)
FT                   /locus_tag="Bphy_3165"
FT   CDS_pept        complement(74700..75017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3165"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   hha:Hhal_0617 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72332"
FT                   /db_xref="GOA:B2JRK5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK5"
FT                   /protein_id="ACC72332.1"
FT                   /translation="MGKHRTPYPAEFRAHMVELVKSGRTPEELAREFEPTAQTIINWCA
FT                   QADRDAGVRHDGLTTAERQELTRLRRENRQLKMERDILSQAAAWFARETGAVPPKGGTD
FT                   S"
FT   gene            complement(75130..75636)
FT                   /pseudo
FT                   /locus_tag="Bphy_3166"
FT   gene            complement(75755..76021)
FT                   /locus_tag="Bphy_3167"
FT   CDS_pept        complement(75755..76021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72333"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK6"
FT                   /protein_id="ACC72333.1"
FT                   /translation="MEKVVASAGWSLRKMVTDWLAPDPTRGFRISHVGRSGLGRYVCVV
FT                   ADNGAESRAMFFYRHRDGKWCIHPPEPERPAMRVTEFAADRET"
FT   gene            complement(76349..77254)
FT                   /locus_tag="Bphy_3168"
FT   CDS_pept        complement(76349..77254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3168"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: bxe:Bxe_A2670 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72334"
FT                   /db_xref="GOA:B2JRK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK7"
FT                   /protein_id="ACC72334.1"
FT                   /translation="MTELETFAAVVEYRSFSQAAAALSISSAAATRRVKRLERSTGALL
FT                   LTREPTVMPTQAGEKVYRHFVSIRLREDDLLRDIEPGRGGTTALALAINADSLATWFEP
FT                   ITRELVQRHVELEVLVDDQDHTLDALARGDVKGFLSTQKKPVGERFAAEPVGQMRYQCV
FT                   ASPEFSSEYFADGLVLPGVLKAPAILFDRKDRLHDVFLGSYFDTTVGRYIKHYLPSPSA
FT                   LLNAIVDGLGYGLVPAMQSEPLITVGSLVALAPDHDVMIDLYWHHWEEEPEPLAKISAL
FT                   VMDAARRSLVQPIPKGDLDG"
FT   gene            complement(77996..78463)
FT                   /pseudo
FT                   /locus_tag="Bphy_3169"
FT   gene            78617..78859
FT                   /pseudo
FT                   /locus_tag="Bphy_3170"
FT   gene            79052..79513
FT                   /pseudo
FT                   /locus_tag="Bphy_3171"
FT   gene            complement(79549..80556)
FT                   /locus_tag="Bphy_3172"
FT   CDS_pept        complement(79549..80556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3172"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG: ypk:y0204
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72335"
FT                   /db_xref="GOA:B2JRK8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK8"
FT                   /protein_id="ACC72335.1"
FT                   /translation="MMTQTKAFKAMLLREKDRTTTSANLETLTVDQLPEGDTLVQIDYS
FT                   TLNFKDALAVTGNGKIVKTWPMVPGVDFSGTVVETTHPRLAIGQRVVLTGWSVGEKHWG
FT                   GYSQYQRIRGDWLVPIPEGLDSRLAMMIGTAGFTAMLCVIALERSGVTPTSGAVLVTGA
FT                   GGGVGSVAVTILSALGYSVSALTGDVGKHEYVLSLGAKECVDGPVWKDAPRPLEAQRWS
FT                   AAIDTVGSNVLARVLAEMNYGGTVAACGLAGGPDLPTTVMPFILRGVRLLGVDSVMLPY
FT                   AERLATWQRVSRDLPKAVLERIAARTVSLDEVRDAASDLLSGKLKGRVLVDVNK"
FT   gene            80895..81908
FT                   /locus_tag="Bphy_3173"
FT   CDS_pept        80895..81908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3173"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: bte:BTH_I1612 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72336"
FT                   /db_xref="GOA:B2JRK9"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK9"
FT                   /protein_id="ACC72336.1"
FT                   /translation="MSETTYTKIHGAPKADLHVHLEGTISPELMYGLAQRNHVDIPFDS
FT                   PQAIASAYEFRDLNAFLQVYYAGLRVLENQQDFYDITMDYLKRAHAENTHYIEFYTSPQ
FT                   SHIERGVPLAQVLDGIFAGCDDAYSKWGIKANVIFGLQRHRTEASALAAIAQAEPHSSR
FT                   IIALGLGGPERDNPPSRFVRAFERARELGWRTTAHAGEEGPADYVSQAIELLRVDRIDH
FT                   GVAAQQNARLVIALAARRIPLTVCPVSNVKLKVFDKLEHHNARYLLESGCVITINTDDP
FT                   SYFLANLTDNLYQTSRALDLSDDQIFQIIWNGFDGAFCDDASKRRMQQALNEYWHG"
FT   gene            81901..83100
FT                   /locus_tag="Bphy_3174"
FT   CDS_pept        81901..83100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3174"
FT                   /product="L-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.3"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: pde:Pden_5045 (S)-2-hydroxy-acid
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72337"
FT                   /db_xref="GOA:B2JRL0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL0"
FT                   /protein_id="ACC72337.1"
FT                   /translation="MANGAINRRLTGALSIGDLRKLAQRALPRVLFDYVEGGPDDEHGI
FT                   VHNREVFNRWALVPRYMQDVSDRSTATSILETRHSAPFGVSPTGFAGLLRPRADLMLAR
FT                   AANEAGLPFVLSGVSNATLESVAAEIGEALWFQLYPSRDRQISDDMVRRAGSAGVTHLV
FT                   VTVDLPVTSNRERDARNGFGFPPALKPSGYLEAMTHPAWCLRYLTSGGAPLFANWTEYA
FT                   SENPSTSDVARLIKSNSPAMFTWSDVRRLRDSWPHKLIVKGILHPDDALNAQRHGVDAV
FT                   IISNHGGRQLDRAIASINALPLIRREVGDDFPLMIDGGVRRGSDIAIALCLGANFVFVG
FT                   RPTLYGVAAAGEAGASRAIQILRTEFDRVMGQLGATRPEILDTSFLADSYCAAGSLRNA
FT                   "
FT   gene            83465..84568
FT                   /locus_tag="Bphy_3175"
FT   CDS_pept        83465..84568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3175"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72338"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL1"
FT                   /protein_id="ACC72338.1"
FT                   /translation="MRNQFHRIFVLTLVLYTTFFLDPTYAAGPLKPVRIVVGTQTLNIG
FT                   YPWLTLPQAQALGYWKEEGYDVQVVPLAPPAQPIALLLAGQADFAMVNGAVVVQAHALK
FT                   NEPVKVAMLNGVTDWSIGVLADSPYKSVKDLKGKVIGTFGLASGGVALLRAYFQDNGMD
FT                   PDKDVQIIATGSGAPAIDALRSGRVQALVFWATAMASYENAGLKMRYMRGADWRQIPDY
FT                   SLSVMEKTAQTDPKMVEGIVRGMAKATVFALANPDCARRIQWKTWPSTKPTGSSDDKVL
FT                   AKWDDNVLNAQLATLSDAFTMTGGKYYGNFDPAAYDRLQQFMLRTKQIPKTVPPSDYAL
FT                   QIPDFYGRANSFDAGAIKQASLKCSGW"
FT   gene            84670..85584
FT                   /locus_tag="Bphy_3176"
FT   CDS_pept        84670..85584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3176"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mmw:Mmwyl1_3825 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72339"
FT                   /db_xref="GOA:B2JRL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL2"
FT                   /protein_id="ACC72339.1"
FT                   /translation="MINNVGLKYFIGVARSGSIRRAAEQLHVAASAISRQIQMLEEELN
FT                   AELFERHRGQKSLRLTAAGELLLNYTRLIENELDQVRADIRAIDTLQKGTVRLGASESF
FT                   SREFLPSFLHRFHSQYPGITFNVIVGGGGKLVELLAKDEIDVALAYRAPDAFDVQVIAE
FT                   THVTPCLLVSATHPFANRRSVDIEECGEIEIALPDESLTIRESYVRMFSKARIRPRTIL
FT                   VTNSFELMRAAAVSGLCNAIVNKYFGNYKVPRGLRYVPLHGEGVERWPLRLCVHTGRSL
FT                   PVSVKLFIEQLQAEMDAVDESRQ"
FT   gene            complement(85619..87050)
FT                   /pseudo
FT                   /locus_tag="Bphy_3177"
FT   gene            87447..89603
FT                   /locus_tag="Bphy_3178"
FT   CDS_pept        87447..89603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3178"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   rle:pRL120177 putative pimeloyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72340"
FT                   /db_xref="GOA:B2JRL3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL3"
FT                   /protein_id="ACC72340.1"
FT                   /translation="MHPLSPLLNPNSIAVLGASPRAEALGNTVIRNLQRIGYAGAIYPV
FT                   HPGAPEVLGIPAYANLDDIPGSVDCAVIALSYDKALPALEALNARGVRNAVLYASGFAE
FT                   TGAEGAALQEELTRYCNQNGINLCGPNCLGLYSVASRVSLYSAALPENLRPGGLALLSH
FT                   SGSACIALSNLDRLGFSHLVSLGNGAVTDIADYLDYVAQDEHTTVAALFIETLRDPEKF
FT                   AVAARKMRAAGKPVVALKVGRSSSGAAASAAHTGALATPDTALQAFFHRLGVVLVEDYD
FT                   ELIETCVLFLGNDRKPKSNGVAVLNVSGGELALTCDIAERVGLTLPDLAPATVNLLREI
FT                   LPPFGAPRNPLDATGVAVFDIDMYGACLRALLADPAISLVAISQDCPSTLGKDQAATYR
FT                   RLVQAVAKVNADAAKPIVFFNNISDTIHPAVLEPLNEASVPSLCGMRNALRAIGHLIDH
FT                   HAHAEVKHTSVGHLRDEQWAERLASGLPFTERESKAFLADHGIAVTREQLATNADDAAS
FT                   AAKRLGFPVVLKIDSEDIPHKTEVGGVVLNLASEAEVATAFDDLIARVRKHMPQAHING
FT                   ALVQQQIDKGIEAIVGIATHKPFGPGVLVGSGGVLVELVKDATFDIAPVTTRDASSMIA
FT                   RTRLADLTRGFRGATPADREALAELVSRLSEVAIVYADELDAMDLNPVSVQPIGKGAIV
FT                   LDALIIPKADNKTPSATNIEEAQT"
FT   gene            89600..90427
FT                   /locus_tag="Bphy_3179"
FT   CDS_pept        89600..90427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3179"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xau:Xaut_3350 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72341"
FT                   /db_xref="GOA:B2JRL4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL4"
FT                   /protein_id="ACC72341.1"
FT                   /translation="MIRETIELVIQGPVATITLARPDKMNALSDQLLIELQHALDEIEQ
FT                   NVSVRAAIITGRGKAFCAGFDLSPREEPFVTVRDWREHVKLGNDTWWKIWKSRVPFIAA
FT                   VNGYALGGGCDLTMVCDYTLAADTAWFGEPEIQFQSAPPYNITPWILGMKKAKEFLLLG
FT                   DRVDAHEAERLGIANRIVPLNELNATAMQIALRIARLPPPAVELNKLGLNRSYELRGFT
FT                   STVEYGAEIFTQVLMSKSEEAEEFFERMNREGLKAAFKWRDARFSADNKDHTT"
FT   gene            90473..91237
FT                   /locus_tag="Bphy_3180"
FT   CDS_pept        90473..91237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3180"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bbt:BBta_7628 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72342"
FT                   /db_xref="GOA:B2JRL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL5"
FT                   /protein_id="ACC72342.1"
FT                   /translation="MITVSSLNKTYQTREGNEIRALHDVSFDVESGEFITVVGPSGCGK
FT                   STLLKILAGILRRSSGKVAVAGRPIDGPNREVGVVFQAPVLLPWRTVIENILMPSELHG
FT                   KVDKTQRDRAARYLAMVGLEGFEDKYPSELSGGMQQRVGIARALCHDPTLLLMDEPFGA
FT                   LDAMTRESMNLDLLRIRAESGKTVLLVTHSIPEAVFLADRVIVMSPRPGRITDILPVNL
FT                   PRERKLEMINSEPFGAVVSRIRTHFNSHGTLD"
FT   gene            91237..92070
FT                   /locus_tag="Bphy_3181"
FT   CDS_pept        91237..92070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3181"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpb:RPB_3099
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72343"
FT                   /db_xref="GOA:B2JRL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL6"
FT                   /protein_id="ACC72343.1"
FT                   /translation="MSTSIEHPASMDTSAETSSKKRSDKLLSITLLIVILATWEFGVRY
FT                   FQISQLIVPTPSSTATSLIQGFSDGSLLSNLGVTFYETMVGFFAGAGLGLLLGGIIGQS
FT                   ALAEKILYPYVIAFQTVPKVAIAPLIVIWFGYGVTSKVVITATIAFFPVLANTIVGLRS
FT                   APRDQIDLIVAFTGSKWHIFRYVKVPNALPYIFVGLDVAIVLAVIGAIVGEFVGSQAGL
FT                   GYLILQRNFSMDTAGVFAILLILSLMGIGLHWVMQAIKRKVVFWINHDADSVSGA"
FT   gene            92112..92525
FT                   /locus_tag="Bphy_3182"
FT   CDS_pept        92112..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0882 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72344"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL7"
FT                   /protein_id="ACC72344.1"
FT                   /translation="MTTLEKGFTTSLTVTVTEEHLASRLDIDAGERFPNVLSTPWLIAH
FT                   LERAAAKALHPLLQDGQLSVGSRVVFDHFAPTPLGATFTAYAKFTGMEGPLYLFDLWAA
FT                   DAGGAIGKGTHARAVVPGVAVEKRAAKRLGQTA"
FT   gene            92538..93308
FT                   /locus_tag="Bphy_3183"
FT   CDS_pept        92538..93308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3183"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pol:Bpro_0427 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72345"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL8"
FT                   /protein_id="ACC72345.1"
FT                   /translation="MAASVSQQVGEERATRDDLAAAYRLIAFLGMDDGIYTHISARVPG
FT                   ADENFLINPFGLLFREVTASSLVKIDLEGKLLEPSDYEVNPAGFTIHSAIHAARPDALC
FT                   VMHTHTIGGVAVSSLEDGLQPTNQWAFQFYDRVAYHEYEGLALDLDERARLVASLGPDK
FT                   RCLILRNHGLLTIGRSVAEAFILMHNLERACRVQLAIQSSGQKVRGVPAEVCERTARQY
FT                   ERGGSSASQLDGIAREWKSFRRLLEAQIGSGYRQ"
FT   gene            93305..94315
FT                   /locus_tag="Bphy_3184"
FT   CDS_pept        93305..94315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3184"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: pol:Bpro_0422 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72346"
FT                   /db_xref="GOA:B2JRL9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL9"
FT                   /protein_id="ACC72346.1"
FT                   /translation="MREIAARETARGASGRHEPVALGKPPCVALLSSSIDMSYLVPAFR
FT                   RLDPEIDLRWGANLGSLTDIEAAVCWRPARGLLRQLPNLQLIQSSGAGVDHLLDDPDLP
FT                   DDVPLCRAIDPSMAAGMAAYVCWAVIHHQRNMKDYLGNAIVHAWFERPVTLPSSHVVGI
FT                   AGMGELGRASARALTTIGYNVRGWSRTPPSEPIEGVDYFSGESELRSFLRVCDTLVCLL
FT                   PLTNETRGFLGGKLFSALKHGAHIVNVGRGEHLVESELLDALANGSIGAATLDTFRHEP
FT                   LPASSALWSNSRVCITPHIASRCDPLVLARQTIDRLNSIRTGAPTNGLVDRNAGY"
FT   gene            94397..95422
FT                   /locus_tag="Bphy_3185"
FT   CDS_pept        94397..95422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3185"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: rpc:RPC_4230 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72347"
FT                   /db_xref="GOA:B2JRM0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM0"
FT                   /protein_id="ACC72347.1"
FT                   /translation="MPTMQTYINGLPKAELHMHLEGCIEPDMMFTLAERNGHSLRWPSA
FT                   EALRSAYEFNDLQSFLDLYFEGCHVLVEEQDFYDVTHRYLQKAHEQTVRHAEMFTGPQT
FT                   FTERGTPLEAVMEGVLGAMQNAKHEFGITSGLLISAHRHRTQEAAIELLDSIQPWRENI
FT                   SGIGMGGAELPNPPSKFVEFFARCRAQNLPVTIHAGEEGPADYIRQAIDLLHVNRIDHG
FT                   NACLTDPSLVRELAERRIPLTVCPLSNLKLNVVPSDVPHPLRGMLDAGLCATINSDDPP
FT                   YFGGYVNENFAYVQRNLKLTRNELVQLAKNSFEASFIDRALAQRYIDSVDAYDRSVAHI
FT                   N"
FT   gene            complement(95489..96628)
FT                   /locus_tag="Bphy_3186"
FT   CDS_pept        complement(95489..96628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3186"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_B3151 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72348"
FT                   /db_xref="GOA:B2JRM1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM1"
FT                   /protein_id="ACC72348.1"
FT                   /translation="MKRVPLKKRIAVASAVASLAAAIPQLAQAQSSVTLYGLISTGILY
FT                   TSNSGGKSVVSMASGPEQLPRMGLKGREELGGGTAAIFTLENGFNSVNGSLGQGGRMFG
FT                   RWAYVGLTNNTYGTVTVGRQLEEMAQQLYWSESGVIFAAFGTRIGDNDNIFNSNRFNNS
FT                   IRYASPNIHGLTFAGSYAFSNQVGGFSNNNGYSFGANYVSGSLKLGAAFTQFNHPAVAS
FT                   NLNGAVDDGSWGFSNPFVKSLGGAVTAQQRIMGVGASYNFNIVQVAAGYTNVLYNYLDN
FT                   TGLRLQNAELTVTKQITPTTLIGAGYIFTAGNYSADRQPRYHQVNLGSVYSLSKRTDLW
FT                   LVGMYMHAAGDAHHAQIYTTTASSTQNQMAVVTGIRTRF"
FT   sig_peptide     complement(96539..96628)
FT                   /locus_tag="Bphy_3186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 30"
FT   gene            complement(96892..97815)
FT                   /locus_tag="Bphy_3187"
FT   CDS_pept        complement(96892..97815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_6218 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72349"
FT                   /db_xref="GOA:B2JRM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM2"
FT                   /protein_id="ACC72349.1"
FT                   /translation="MRTILMSPLMHYVREVALEGSIRRAADNLHISPSAIARQIQQLEE
FT                   QFGAALFERQPRGMRLTEAGQIVLETIQQFERNAASALSHVEELRGLKRGRVSIGALQT
FT                   LGEDILPRALTDLRERYPGICFNAYIGNSSDIIRKVADGDIDIGVCWDPGGAVPIERLR
FT                   VVPIAIGVAMQSGHALAEKDLVSLRDCAPYPMIFPSRDMMFRTLIDRINVGVGSSVTPV
FT                   IETNSMSMMRRLVRDGAGLVLTTSMSLLGDLAVGKVVHRPLLESAVHTFPLCLFVRSDR
FT                   DLPLAVKIVVEQFTLEMDSLAAQHCG"
FT   gene            98076..99416
FT                   /locus_tag="Bphy_3188"
FT   CDS_pept        98076..99416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3188"
FT                   /product="xenobiotic compound monooxygenase, DszA family, A
FT                   subunit"
FT                   /note="KEGG: ava:Ava_4330 xenobiotic compound
FT                   monooxygenase, DszA family, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72350"
FT                   /db_xref="GOA:B2JRM3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM3"
FT                   /protein_id="ACC72350.1"
FT                   /translation="MMKLGGLFHPTGNHIAAWLSPDSQLDAGSNFQHYVKLAKTAEAAR
FT                   FDLLFLADAAAVRGGDLAALSRWPQYMAYFEPTTLLAGIAAMTQHIGLVATATTSYNEP
FT                   YNIARRYASLDHISAGRAGWNVVTSSNLDESMNFGRDEHFSHETRYERAREFVGVVRGL
FT                   WDSWEDDAFIRDRESGVYFRPDSLHTLDHRGTHFSVRGPLNIARPPQGHPVIAQAGSSN
FT                   DGMELAAETAEIVFTAQHTLEKAKAFYDDLKSRMSRYGRQPEQLKIMPGLNPVIGSTRE
FT                   EAKQRHAELQAMIQPEVGLELLSNALGGFDLRGYDLDGPLPGTISAENTNTSKSTVQSV
FT                   LDMANRENLTIRQLYQKMAGARGQRTIIGTPVDIADEMEAWFRAEAVDGFLVQPAVLPG
FT                   DLDVFAATVVPELQRRGLFRTKYEGATLRENLGLTRPANRFTKAGSQ"
FT   gene            99416..99934
FT                   /locus_tag="Bphy_3189"
FT   CDS_pept        99416..99934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3189"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: psp:PSPPH_2161 flavin reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72351"
FT                   /db_xref="GOA:B2JRM4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM4"
FT                   /protein_id="ACC72351.1"
FT                   /translation="MEAIQNEACVVDFAKAMRRLASTVCVVATHDDVQPYGMVATAVTS
FT                   LSATPASLLVCINKDASSHPVIERVGRFSVTLLRKDQRHISDRFGSRYSQAERFASSQW
FT                   KMSMRWTLPCLENAQATFFCSLARQFEHGTHTVFVGDVLQTVVNDEVDPLLYADGAYRC
FT                   LDSVQAHLT"
FT   gene            100032..100238
FT                   /locus_tag="Bphy_3190"
FT   CDS_pept        100032..100238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72352"
FT                   /db_xref="GOA:B2JRM5"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM5"
FT                   /protein_id="ACC72352.1"
FT                   /translation="MKAVYLLAVLPVLGFFSGTSVVQYWGPLAFGMPTLLLWNLASMIT
FT                   SAAILWIIHTFDAHDTDDSRGES"
FT   sig_peptide     100032..100100
FT                   /locus_tag="Bphy_3190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.438 at
FT                   residue 23"
FT   gene            100235..101707
FT                   /locus_tag="Bphy_3191"
FT   CDS_pept        100235..101707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3191"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG:
FT                   bur:Bcep18194_B2476 Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72353"
FT                   /db_xref="GOA:B2JRM6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM6"
FT                   /protein_id="ACC72353.1"
FT                   /translation="MNSALLILTVFFVGALAIGLVAKRGVEMNLEEWSIAGRGFGVVIS
FT                   FVLIAGEIFSTYSFLGATGWAYAKGAPVFYYMGCASLAFVIGYWTLPRLRDIAQEYQLV
FT                   SFSDYFERVFNSRMLGAMAAVIGLGAMIPLLVIQMKGLGIIVHEASYGGLSETAAIWAG
FT                   LAIMVAYIVVSGIRGAATVAVVKDVLILIVALSLAAYLPLHYLGGYAHLFETIERTHPG
FT                   HFNMPETGLNATWYNSTVLLVSLGYFLFPHAFTSVYAIKTRDAARKNAIMMPLYQMLIV
FT                   CMYIVGFTAIVVVPGLTGSSTDIALFAIAKKSFPAWVVGVIGGAGLLTALVPGAMILLN
FT                   ASTMFSKNLVRGYLLPHASDAVINRIARITVPVYALICVTALFSSGASMVPISLFASNL
FT                   LDQLFPAFLLGLIPRVTKRVAPLALGIVVGVLMLGYVSLGCAGDFARAFPFLPTWLASV
FT                   NVGLSALAVNVIVVSTTACLSRVGARPITVAR"
FT   sig_peptide     100235..100288
FT                   /locus_tag="Bphy_3191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.470 at
FT                   residue 18"
FT   gene            101766..102038
FT                   /pseudo
FT                   /locus_tag="Bphy_3192"
FT   gene            complement(102131..103338)
FT                   /pseudo
FT                   /locus_tag="Bphy_3193"
FT   gene            103536..104627
FT                   /locus_tag="Bphy_3194"
FT   CDS_pept        103536..104627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3194"
FT                   /product="ISRSO5-transposase protein"
FT                   /note="KEGG: rso:RSp1675 ISRSO5-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72354"
FT                   /db_xref="GOA:B2JPF0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2JPF0"
FT                   /protein_id="ACC72354.1"
FT                   /translation="MPMGRPKAELELSEDERSQLISIARSRSISAALVTRARIVLAAAD
FT                   GEPNSAIAQRLQLTRATVGKWRLRFLEQRINGLYDEVRPGKPRTIDDERLAQLIHKTLH
FT                   TKPADGSTHWSVRTIAAETAISPTSVHRYFKLLGLQPHRSESFKLSTDQFFIEKLRDVV
FT                   GLYLSPPENALVLCVDEKSQCQALERTQPMLPMGFGYVEGVTHDYVRHGTTTLFAALNV
FT                   LNGAVLATCKPRHRHQEFLSFLREIDKAVPAELDVHCIVDNYSSHKHPKVKAWLAARPR
FT                   WHMHFIPTYSSWLNQVERFFALITDKAIRRGSFGSVKQLIRRIDQFVSHYNENCKPFIW
FT                   TASADSILEKLHRLCSRISGTEH"
FT   gene            complement(104657..105730)
FT                   /locus_tag="Bphy_3195"
FT   CDS_pept        complement(104657..105730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3195"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   rso:RS02364 putative methyl-accepting chemotaxis transducer
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72355"
FT                   /db_xref="GOA:B2JRM8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM8"
FT                   /protein_id="ACC72355.1"
FT                   /translation="MVLLGLWELATVVYRVEPGSHVTRLLSIAMVVLATTGCVFSIYCG
FT                   VHLHSVVCGGLNRMGKRLEDIAATLDLSKRSSSPRMDEFGRAAVAFDALMLRIQEAVSD
FT                   VSLSTDTVSRATRALVSGNLDISARTEEQAASLQETASSMTQLTETVKQNADNARCAKD
FT                   EVAKANRIVERSGKVVHEMVATMEKIYGSSSKISEITGVIEGIAFQTNILALNAAVEAA
FT                   RAGEQGRGFAVVASEVRGLAQRSASAAREIKELIGTSVATISEGSKQADRVSVAMDEMK
FT                   AAIENASQMVDEIASASEQQSQGIEQVNQAVILMEQVTQRNAAVIEQGAIAAQALEEET
FT                   HRLEATVTSFKISQDPG"
FT   gene            complement(105992..107077)
FT                   /locus_tag="Bphy_3196"
FT   CDS_pept        complement(105992..107077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3196"
FT                   /product="outer membrane protein (porin)"
FT                   /note="KEGG: bam:Bamb_1076 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72356"
FT                   /db_xref="GOA:B2JRM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM9"
FT                   /protein_id="ACC72356.1"
FT                   /translation="MKTIRSLSLISVSALVAGSACAQSNVTLYGIVDTGVQYYNNATAS
FT                   GGSVVGMPSLSGKLPSRFGLRGVEDLGGGYKAFFVLENGFAVNNGALGYGGRIFGRAAN
FT                   VGIDSRFGTLTLGRQMNMTLYALTDADVIGPSNHSLAVFDTYLPNARSDNAVGYMGKWH
FT                   GFTIGATYSFGRDAAGPAGPSATNCAGQVPGDFVACRQYTVMLAYASETLGVTASYDVM
FT                   RGGTGASAPLSSSANTDTRTIVDGYAKYGNLKLGAGWIRRNTSSTTHSQSDIFFAGGTY
FT                   LLTPAFAVDAQAVRYILRTRSDATLFVGRVSYFLSKRTSIYSSAGYMINSPTSAVPVSA
FT                   GGTVGIGKNQVGFMVGMQQRF"
FT   sig_peptide     complement(107009..107077)
FT                   /locus_tag="Bphy_3196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 23"
FT   gene            complement(107221..108864)
FT                   /locus_tag="Bphy_3197"
FT   CDS_pept        complement(107221..108864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3197"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; GMC oxidoreductase; KEGG:
FT                   swi:Swit_4277 glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72357"
FT                   /db_xref="GOA:B2JRN0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN0"
FT                   /protein_id="ACC72357.1"
FT                   /translation="MDYDFIVVGAGSAGCVTANRLVREWQAKVLLIEAGPSAKSALIRM
FT                   PAGTFKMLFNGSPFIKRYASSPQASLGERVVSIPQGNVVGGGSSVNAMAYTRGSRADYE
FT                   RWFAATGDPGWSWNGLLPYFKKQEGNQRFDNESHGSDGPLKVSDPRYTVEVADRFVRTM
FT                   QRHGIPYSPDFNAGRLQGVGYMQTTTYQGQRCSAADAFLTPILDHPGLTLVTDAVVERV
FT                   LFEGDAAVGVEYRVKGKLGRARTLNEVVLCAGAFATPKLLMLSGIGPAAHLKEQGLKVR
FT                   VDSPGVGENLQDHNVAVVSMTTRGQYGYFGEDRGFRALRNALRYLAFRSGPIASNGAET
FT                   MAFVNLGDPAAEPDLQLYCVGVMWPDPQGPKPTFGMTLMANLVRPRSRGTVRLRSAVPS
FT                   DDAVVSPNWLHDVADRERLVQALRYLRRLASSEPLASIVHEEVGPGPHVQSDGELLEYL
FT                   KRTTDSNYHPVGTCRMGREDDSMSVLTPDLRVKGVSGLRVFDASMMPHIISSNTNATVM
FT                   AVADRAVDIMMANWNIPEERDKTKAEEHAQ"
FT   gene            complement(108869..110365)
FT                   /locus_tag="Bphy_3198"
FT   CDS_pept        complement(108869..110365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3198"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: xcv:XCV0917
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72358"
FT                   /db_xref="GOA:B2JRN1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN1"
FT                   /protein_id="ACC72358.1"
FT                   /translation="MTTSRFDPQAELSDDVRSRFYIGGHWVLPNSKETASLVSPTTEKS
FT                   FLSVPLADRRDVDDAVRAARKAFDTGPWPLMSAAERSDYLRRLSGAVASRMQLLSRLWT
FT                   AEVGAPVWFADLFTPTATAMLEYYAELSLSFPFKEHRQTRGGHARVLRQPVGVTALIAP
FT                   WNAQLPILAYKLSAALAAGCTVVVKAPPETPLDALVLAECAHEVDLPPGVLNVITADAD
FT                   RGAHLVANVAVDKVSFTGSTATGKVIAKTCADRLARVTLELGGKSAAIILEDAELEPTL
FT                   ASLSPYTMPFSGQICFAQTRILVPRNREQEIVEAYSAVIGGLNVGDPWDETTQIGPLAN
FT                   RRQFDRVLRYIDVGRSEGARLATGGKSCERFERGYFVEPTIFSGVTPDMTIAREEIFGP
FT                   VVTVTAYDDVDHAIALANDSDFGLSGTVFTTDVERGYDVARQLKTGNVSVNGLEMSPNV
FT                   PFGGFKQSGVGREGGPEGLSAFLEDQAIYLPSEAQPSKLA"
FT   gene            complement(110411..111595)
FT                   /locus_tag="Bphy_3199"
FT   CDS_pept        complement(110411..111595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3199"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: bur:Bcep18194_B3106 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72359"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN2"
FT                   /protein_id="ACC72359.1"
FT                   /translation="MSMQFGSQGCARALAAGVVIALYAGKALAVDGIALSGTGVKAAGM
FT                   AGTSIAFPQESSSAADNPAGMGLIGSRTDFGIQVLEPLTDFEYGSPSNTLHTGKVYPVP
FT                   DGGANWQINPRLTFGVSLFGTGVGTSYGRPALTVPGAGVAKSSLQTMIAAPTVTWRLTE
FT                   HNIIGIGLSLAYQRFSANGAIVPADDGTLQPLPSHGTANAFGYGIRVGYIWQPASTFTL
FT                   GASYASRIRMSKLSGYENDLLAAGGGRIDIGAQYGIGVAYKVIPSVTLAADWLHMEFSN
FT                   TIIGSAQGFGWQDQDFFRIGVSWDVNQRWTLRTGFSHGNHPIGPSVVAQNLLAAMPVST
FT                   SVAVGATYRIGERDGVSGIFEYGFPVTVKGEGASLGFNEQTKTEVFGVSYGHKF"
FT   sig_peptide     complement(111506..111595)
FT                   /locus_tag="Bphy_3199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.968 at
FT                   residue 30"
FT   gene            complement(111656..112618)
FT                   /locus_tag="Bphy_3200"
FT   CDS_pept        complement(111656..112618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3200"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mms:mma_1673 oxidoreductase/oxygenase, VanB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72360"
FT                   /db_xref="GOA:B2JRN3"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN3"
FT                   /protein_id="ACC72360.1"
FT                   /translation="MNTIPVRVAVADTIAQDIRLLKLEANDGSSLPGWKPGSHIDLHLG
FT                   QGITRQYSLCGPQGDTSAYQVAVKLEPQSRGGSKYVHESLKVGSELLISPPRNHFEMKA
FT                   DAGHTLLVAGGIGITPIISMARELAEKRQQFELLYFTRSEHHAAFREELEGGPLGESCK
FT                   LLCGLERDDVEEALEGALDDRYDGSQLYLCGPKPFMDTVRAVAVRCGWPDEAVHFEYFA
FT                   GAEPVGQGEQTSFDLKLARSGKTVTIPANKTIVDVLREEGVEVETSCEQGVCGTCVARV
FT                   LDGTPEHHDCFLTSQEQARGDCMAVCISRSKSRLLVLDL"
FT   gene            complement(112803..114113)
FT                   /locus_tag="Bphy_3201"
FT   CDS_pept        complement(112803..114113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3201"
FT                   /product="Phthalate 4,5-dioxygenase"
FT                   /EC_number="1.14.12.7"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   rpa:RPA0983 possible phthalate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72361"
FT                   /db_xref="GOA:B2JRN4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN4"
FT                   /protein_id="ACC72361.1"
FT                   /translation="MNVPTQPVVFKPNSRGADRYQYLTQTDAGTPTGELMRRYWQPVAL
FT                   IDSLPPGAAPQPIRILGEDLVLFRDDKDRVGLIDRKCAHRCTDLALGRVEDGGIRCPYH
FT                   GWLFDVEGRCLSQPAEASATAKDRIRMKSYPLHEAAGAFWAYMGPGEPPLFPNYPALAG
FT                   GAEHCYTTRWFGDCNWLQASEGNIDPVHTSYLHQLELSSEDMKARWGVFSNQSRPELAV
FT                   EDTRFGVRLYTLRKIDGTERSSIRITNFVMPNACAVGGFEGYLGEGGLTMLWDVPIDDQ
FT                   HHWRWEFIFHRSGKLNKASLEAQYQSEKEEGDRMRRKWEDLYSQDRESMKGKAYLGLGE
FT                   CFSVHDIAITQSQGTIHQQADEHLSSSDIAIVRARRMLDEAARVVAEGGDPRGVVRTDA
FT                   DNDFRDMVVVTGEIENGDSKEAYCARFTESPDLFRPQ"
FT   gene            114317..115318
FT                   /locus_tag="Bphy_3202"
FT   CDS_pept        114317..115318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3202"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pol:Bpro_4318 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72362"
FT                   /db_xref="GOA:B2JRN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN5"
FT                   /protein_id="ACC72362.1"
FT                   /translation="MEIKQLQHFSRIAEIGNLTRAASVLGVTQAALSRQVAQLEAELGT
FT                   ELFRRNGRGLVLTDAGRRLLDQVPMVLRQIAIAERAVKGTTGPVQGTFVLGLAPSLART
FT                   VVVPLIQAFREQLPEVTLRTVDGTSANLGELVGAGKLDCAVIYNPIASDAVDLRPLASE
FT                   SLYLVSGPQAAREGRVPASSVRLEAIPELPLVIAGKSNVVHGALAAALAERGLTAQVVH
FT                   EIENLTAILDLIRHGYGYSVIPLSGVQPCIGDPELRLHRINSPGLEVGLSIATPVRAGS
FT                   DTLISESTSLLREVVLKELQRYQIEVETAIDEQSVAPAGTRTTAKTGRGSRQ"
FT   gene            complement(115395..116342)
FT                   /locus_tag="Bphy_3203"
FT   CDS_pept        complement(115395..116342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3203"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: dac:Daci_4444 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72363"
FT                   /db_xref="GOA:B2JRN6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN6"
FT                   /protein_id="ACC72363.1"
FT                   /translation="MTKPLRIGLMGAGAIGIQHLEALSMLENVEVVSIAGKEAPRIEDL
FT                   ATRYGIGHVCSDLPEMLSLREVEAVILCTPTPMHSDQAVLCLESGRHVLVEIPLADSLL
FT                   GAQAVVQSQQRTGLVAMCAHTRRFNSGHRWLHERIERGAFVLRQLDVQTHFLRRSNLNA
FT                   LGQQRTWTDHLLWHHAAHTVDLFQYQTGEKVQVAHALQGPVHSELGVALDLSIQMKTGS
FT                   GALCTLSLSFNNQGPFGSTFRYIGDGETYVARYDSLIDGCGAKIELDDQLLSGIAAQDQ
FT                   EFIAAIRELREPNASLASVMPCYQLLQELESQLI"
FT   gene            complement(116339..117181)
FT                   /locus_tag="Bphy_3204"
FT   CDS_pept        complement(116339..117181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3204"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: pat:Patl_3885 protocatechuate
FT                   4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72364"
FT                   /db_xref="GOA:B2JRN7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR034937"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN7"
FT                   /protein_id="ACC72364.1"
FT                   /translation="MARIIGGVGTSHVPSIGAAIDHGKVDDPYWRPLFEGVQPARKWIE
FT                   KMKPDVAIVVYNDHASRFALDMTPTFAIGMGERFSPHDEGYGPRPVPVCQGDPALAWHL
FT                   AESLVLKDEFDIAMVSEMTVDHGLTVPLSLLFGQPEAWPCRIIPLCVNVIQYPQPTALR
FT                   CLRLGQALRRAIDAYEPDLKVAIFGTGGMSHQLQGERAGLINADYDKMWLDKMESDPQS
FT                   LARISHTELLREAGSEGLEIIMWLIMRGALDSSVRRIHRFYHVPASNTAYGMLIMENA"
FT   gene            complement(117174..117581)
FT                   /locus_tag="Bphy_3205"
FT   CDS_pept        complement(117174..117581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3205"
FT                   /product="protocatechuate 4,5-dioxygenase, alpha subunit"
FT                   /note="TIGRFAM: protocatechuate 4,5-dioxygenase, alpha
FT                   subunit; PFAM: Extradiol ring-cleavage dioxygenase LigAB
FT                   LigA subunit; KEGG: dac:Daci_3814 protocatechuate
FT                   4,5-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72365"
FT                   /db_xref="GOA:B2JRN8"
FT                   /db_xref="InterPro:IPR011986"
FT                   /db_xref="InterPro:IPR014159"
FT                   /db_xref="InterPro:IPR036622"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN8"
FT                   /protein_id="ACC72365.1"
FT                   /translation="MQSIHERDYDDIPGTYVFDGERCRKGFALNMFCKSLDLAANRESF
FT                   RQNPDAYLSRFALSVEQRNAVVARNWLEMLRLGGNIYYTFKLAIFDGLTMQHVGAAMSA
FT                   KPMSVDEFRTMMVSGGRPIAGNRSVKEQCNG"
FT   gene            complement(117581..118489)
FT                   /locus_tag="Bphy_3206"
FT   CDS_pept        complement(117581..118489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3206"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4447
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72366"
FT                   /db_xref="GOA:B2JRN9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN9"
FT                   /protein_id="ACC72366.1"
FT                   /translation="MEFQKSPGWLDWCPEPSVPVFQLPDGAIDAHCHVFGPGDTFPYAP
FT                   ERKYTPCDASKEQLFALRDRLGFARNIIVQATCHGTDNRALVDACLSSKGRARGVASVR
FT                   RSISDDELQDLHAAGIRGVRFNFVRRLVDFTPKDELQEIARRVAALGWHIVVYFESVDL
FT                   PELWSFFSGLPTTVVVDHMGRPDVTKPVDGKEFELFVRFMREHKNVWSKVSCPERLSVS
FT                   GPRAVKGQANPYRDVVPFAKRLVETFPDRVLWGTDWPHPNLKDHMPDDGILVDFISQIA
FT                   PTSELQRKLLVDNPMRLYWSD"
FT   gene            complement(118564..119268)
FT                   /locus_tag="Bphy_3207"
FT   CDS_pept        complement(118564..119268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3207"
FT                   /product="4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase/oxaloacetate decarboxylase"
FT                   /note="TIGRFAM: 4-carboxy-4-hydroxy-2-oxoadipate
FT                   aldolase/oxaloacetate decarboxylase; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: mag:amb0252
FT                   4-hydroxy-4-methyl-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72367"
FT                   /db_xref="GOA:B2JRP0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR014165"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP0"
FT                   /protein_id="ACC72367.1"
FT                   /translation="MSTNPVVGQIGVVKRNIARAEESAVRRLSEFGVATVHEAMGRTGL
FT                   MKNYMRPIYDGAHVCGTAVTVLLHPGDNWMLHVAAEQIRPGDIVVATVTADCTDGFFGD
FT                   LLATSFRARGAVGLVIEGGCRDIFDLTAMKFPVFSRAVSAKGTIKATVGSVNVPIVCAG
FT                   ALVNPGDVVIGDDDGVVVVPASVVHETADRAAARVANEEEKRRKLASGVLGLDMYNMRE
FT                   ALAEAGLTYVDD"
FT   gene            complement(119273..120301)
FT                   /locus_tag="Bphy_3208"
FT   CDS_pept        complement(119273..120301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3208"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: azo:azo2542 probable
FT                   4-oxalomesaconate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72368"
FT                   /db_xref="GOA:B2JRP1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP1"
FT                   /protein_id="ACC72368.1"
FT                   /translation="MIIDCHGHYTTAPKALELWRGRQIAGLTDPAQAPHVNELKISDDE
FT                   LRESISGNQLKKMLERGIDLTIFSPRASFMAHHIGNVETSSTWASICNELCYRVSQLFP
FT                   DNFIGAAMLPQSPGVDPATCIPELERCVNDYGFVAVNLNPDPSGGHWTSPPLSDRHWYP
FT                   LYEKMVEYDIPAMVHVSTSCNACFHTTGAHYLNADTTAFMQCLTSKLFQDFPTLRFVIP
FT                   HGGGAVPYHWGRFRGLAQELKLPPLKDHLLNNIFFDTCVYHQPGINLLTEVIPVENILF
FT                   ASEMIGAVRGIDPETGFQFDDTRRYIDAAETLSNEDRTKIYERNARRVYPRLDAALKRK
FT                   GS"
FT   gene            complement(120298..121407)
FT                   /locus_tag="Bphy_3209"
FT   CDS_pept        complement(120298..121407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3209"
FT                   /product="protein of unknown function DUF453"
FT                   /note="PFAM: protein of unknown function DUF453; KEGG:
FT                   rpb:RPB_0878 protein of unknown function DUF453"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72369"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP2"
FT                   /protein_id="ACC72369.1"
FT                   /translation="MQRPIPCLFMRGGTSRGPFFRAEDLPTDLSTRDRVLLDVMGSPDP
FT                   RQIDGLGGAHPLTSKVGIVRRGSRPDIDLEFLFAQLQPDADTVDTTPNCGNMLAAVVPF
FT                   ALEVGLLAPRGRQTTARVLTLNTGMSCDITVDTPEGRPEYDGSARIDGVPGTAAPVSIN
FT                   FLDTAGSVCSAMLPTGRVRDRIDLGDGRTLDVTCIDNGMPMVLVPAEALDRTGRESVAD
FT                   LNADIELKAELEALRRRCSEAMGLGDTSSKNYPKMCLVSRPVAGGALSTRCFIPHVCHD
FT                   AIGVLAAVTVATACVLDGSVAHDLASTSSGVVKQVSIEHPSGEFSVELEVDATNPHVVK
FT                   RAALLRTARLIMRGEVMVKEKAFELAETR"
FT   gene            121524..122444
FT                   /locus_tag="Bphy_3210"
FT   CDS_pept        121524..122444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3210"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pna:Pnap_2034 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72370"
FT                   /db_xref="GOA:B2JRP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP3"
FT                   /protein_id="ACC72370.1"
FT                   /translation="MELRQLEYFVHVAELGSFTRAANLLSIAQPVLSRQVRALELEFRQ
FT                   VLLERNGRGVTLTEPGRRLLEHSRSILSQVQRVHSDMEDERGEATGRLVVALPPSVSSV
FT                   LSAPLVRRFRECFPKATLCILEGLSAYALEWLTMGRADCAIVYTNSTSPSVELSPVLSE
FT                   QLYLVSSRSAPLSSEDLLAGKPVSLAEVAQKQLVMPSRPHSIRLLLEAAMAQASLKPCI
FT                   ALEIESIPAILNLVHDEELHAVLSLKAVHSDGQQQEFLVRPIEDPPLHITLWIATSAQR
FT                   PRGPLLELAIPVLRQLLCDLWRTRL"
FT   gene            complement(122966..124141)
FT                   /locus_tag="Bphy_3211"
FT   CDS_pept        complement(122966..124141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3211"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bvi:Bcep1808_0524 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72371"
FT                   /db_xref="GOA:B2JRP4"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP4"
FT                   /protein_id="ACC72371.1"
FT                   /translation="MKKSLLALAALGVFTGAHAQSSVTLYGVVDAGIAYTNNVGGQHNF
FT                   FTSSGNLQGSRWGLRGKEDLGSGLTALFVLENGFNVFNGTLGQGGDMFGRQAYVGLSSS
FT                   QFGTVTLGRQYDSVVDYTGPLEVGSQWGSYFAAHPADLDNMNNTNRVNNAIKFTSANYA
FT                   GFTFGGLYSLGGNAGQFNRNQIWSVGAGYANGPLQLGAGYLNVKDPNYSFWGNNANSRS
FT                   TTTTPSASNFPSSRVISGFASAHTLEVIAVAGAYTFGAATIGATYSNTQYKDVGTESGA
FT                   GLNPVGYKGGSGKFHNAELNFKYQLTPSLLLGAAYDYTKGYGLSDAKYHQAMLGADYFL
FT                   SKRTDVYVDGVYQHASGTDSTQHAAVANINQLSPSSTSNQVAAVVGIRHKF"
FT   sig_peptide     complement(124082..124141)
FT                   /locus_tag="Bphy_3211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(124510..125763)
FT                   /locus_tag="Bphy_3212"
FT   CDS_pept        complement(124510..125763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3212"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   swi:Swit_4805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72372"
FT                   /db_xref="GOA:B2JRP5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP5"
FT                   /protein_id="ACC72372.1"
FT                   /translation="MSDPAASNHQKIESALVDPPVERGWSRAGIVAALPILAIVLVGIA
FT                   GHATSSLKPLIIQAFVQSVGFDKATSGYLLTVEMISTSAGSIVATAFPFALRRRGYLFG
FT                   ALALMMVANLVSISFKSDPGTMLYALRCLSGFGAGFGLGRLGILIALSGRPGKTAALYS
FT                   TSTQLYGAAAAFAMPFIDRLCGANSIFVILAGTVPLALVLIGWVPESNAKVEKKKAIST
FT                   STPHALGLGEKLILAITFGVFYLGVGTFWPFISVLGETAAIGHTQMSSLLGWAAIASAV
FT                   GSGTAVFAGDRKASAPIITLFFIALCLSVVMQLAVPQSLFIFVTSVLLFAFAYWVINPM
FT                   ILGVMSKLDTTGQMNGVYYIVAVGGISLGPALAGWVLTHGSERSTSTEFLRAVSLALLG
FT                   VSSAVQIYYAFRARRLPD"
FT   gene            complement(126257..126565)
FT                   /locus_tag="Bphy_3213"
FT   CDS_pept        complement(126257..126565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72373"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP6"
FT                   /protein_id="ACC72373.1"
FT                   /translation="MMNFRDTSLRSLVEKWLGAESAACARVTHFSHTRSKPWRYVCIKA
FT                   IRASGTFAFVFFRHDDGSWCVFPPGPRRPTMNVSSMDRSGEIGSRCDNDVQPEMSVA"
FT   gene            complement(127285..127878)
FT                   /locus_tag="Bphy_3214"
FT   CDS_pept        complement(127285..127878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3214"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: rso:RS00897
FT                   putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72374"
FT                   /db_xref="GOA:B2JRP7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP7"
FT                   /protein_id="ACC72374.1"
FT                   /translation="MTQSLSINPTTSALLLMDFQGFVLNNFLTPTAAAEVVSGAAKLLD
FT                   AARASNMLTIHVTVDFRPGYPEISPRNKLFSYLKDNGVVVPGSEGMKIHPSLTPRDNEP
FT                   VVVKHRIGAFNGTDLDLLLRARGIETLIVAGITTGGVVLSTVRQAFDLDYDLVVVTDAC
FT                   TDPDEQAHALLIDKILSGQATMTLTDDIESVLQR"
FT   gene            complement(127913..129148)
FT                   /locus_tag="Bphy_3215"
FT   CDS_pept        complement(127913..129148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS00896 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72375"
FT                   /db_xref="GOA:B2JRP8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP8"
FT                   /protein_id="ACC72375.1"
FT                   /translation="MELHGHDYWQRNLAICLFGSFSTVFAMTLILPFLPIYVEQLGVRG
FT                   HKAVVQWAGIAYGANFLAAGLIAPLWGYLGDRFGRKPMLVRASFGMALTMPLMGLSTNI
FT                   WQFVGLRLLAGIAGGYSSGATILIAVQTPRDRLAWALGLLASGVMAGNLLGPLAGGALP
FT                   SLIGIRATFWAAGGLIFIAFVATAFFVREAPLRSEATRNSGEKGWSQLPNKGVVVIMLA
FT                   TGLLLMVANMSIEPIITVYVATLVNNADGVTSVSGPNSAHVTAVAGFVMAAAALGSIVS
FT                   ASQLGKIADRVGHSTVIIMALTTAGLLLIPQAFVTKEWELVLLRFLMGLALGGLLPCIT
FT                   AVIRHNVPDNLVGTVMGYSLSAQFAGQVAGPLIGGFIGGQIGIRAVFLGTCFVLLVGAV
FT                   WNWKTIGFSRRD"
FT   gene            129243..129896
FT                   /locus_tag="Bphy_3216"
FT   CDS_pept        129243..129896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3216"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: rso:RS00895 probable transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72376"
FT                   /db_xref="GOA:B2JRP9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP9"
FT                   /protein_id="ACC72376.1"
FT                   /translation="MMTQSQLVEDRLRRMILDMDLGPGERLTERSLEELLQTSRTSVRT
FT                   ALFRLEAEGLVSRNGRAWLVPPIDLEEVRQLFDYREILEVAAIQLGGPAATPSELAEMH
FT                   TILNSIDMNSTPEQRAEASRQFHLKIGGLAKNEFVTRSIADCMNRLLRVRWIEIDNADA
FT                   GWTEHRAVLQALQDGNVGHAIALTKNHIGAARERLTSALTARPRTLRARGIVVS"
FT   gene            130203..130655
FT                   /locus_tag="Bphy_3217"
FT   CDS_pept        130203..130655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3217"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sco:SCO7639
FT                   MarR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72377"
FT                   /db_xref="GOA:B2JRQ0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ0"
FT                   /protein_id="ACC72377.1"
FT                   /translation="MNVDRNPVAELTSVSELAFELRETLGRGARLIRVESGPPLSQLTV
FT                   LGHLQRKGAMSTNDLAAAERVRPQSMSLTVQALEKAGLVGRKPHPTDGRATLVQLTRKG
FT                   TKTLESIFATREDWLTSVIVEQLTDDERQELHRGLALIQRIIHNRE"
FT   gene            complement(130808..131311)
FT                   /locus_tag="Bphy_3218"
FT   CDS_pept        complement(130808..131311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3218"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bvi:Bcep1808_0541 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72378"
FT                   /db_xref="GOA:B2JRQ1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ1"
FT                   /protein_id="ACC72378.1"
FT                   /translation="MIKVGDTLPDVRLFEFIDEATEGCAVGPSAFSVRKRAAGKRVVIF
FT                   GLPGAFTPTCSARHLPGYIDAAADLFAVGVDEIWCVSVNDAFVMNAWGRQQATAGKIKM
FT                   IADGSAHFSHALGLEQDLTARGMGIRSHRYAMVVDDGVVATLNVEAPGEFQVSDAESIM
FT                   AVLR"
FT   gene            complement(131394..132350)
FT                   /locus_tag="Bphy_3219"
FT   CDS_pept        complement(131394..132350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO6501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72379"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ2"
FT                   /protein_id="ACC72379.1"
FT                   /translation="MSFEEVAGWGEDTWERDVTGVAVDSQDRVYVLRRGADAVTVMSPD
FT                   GAVLNRWGGGCFSPRPHLISIGEDDTVYVADDGGHQVFVFDRTGRLLDTIGTGTPSDTG
FT                   YDAKASSAEIAYDGMVGGPPFNRPTKVAPWRNGELFVSDGYRNCRVHRFSADRQLILSW
FT                   GGPGAGDGCFVIPHSVTVDAEGRVLVCDRENDRIQIFSCDGELLDVWNNVQRPTDVAFD
FT                   RHGNAYVTELPRGPADIKSWRLGRAAQELPGRVTIRSSEGSIIGQLHCPGLEFPAPHAV
FT                   AVDSKGAVYVSEVPESFAGYTGRPYSLHRCLRKFEPR"
FT   gene            complement(132359..133138)
FT                   /locus_tag="Bphy_3220"
FT   CDS_pept        complement(132359..133138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3220"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dac:Daci_0040
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72380"
FT                   /db_xref="GOA:B2JRQ3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ3"
FT                   /protein_id="ACC72380.1"
FT                   /translation="MAMLTQQGGSSDTDELPSHRRILQESGAASGRILGINHLVMFTRD
FT                   MNEGVRFYRDVLGMRVVRTQRFATTAKGLRSSAHHSSGSAAQDQVETSPIAVDITVRQV
FT                   FFEMGNGELFSLYEAPTVTERPPAPVSSVLWPAESKAQWSRPVEPQKLDHLSFDVASHA
FT                   EVVWFREHLMSQGVAVSEVSERRGANNKHRFISSIYFSDPSGNPLEISSFDAGDAAWQS
FT                   YDFSDWFIDEEPVSALLDGASDQRPSLVPHWVRTRAK"
FT   gene            complement(133275..134234)
FT                   /locus_tag="Bphy_3221"
FT   CDS_pept        complement(133275..134234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3221"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: sen:SACE_2819 phthalate 4,5-dioxygenase reductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72381"
FT                   /db_xref="GOA:B2JRQ4"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ4"
FT                   /protein_id="ACC72381.1"
FT                   /translation="MSERDFELVIARKEAVATGVVRLTFARKDGLQLPTWEPGAHIDVH
FT                   FASNGVDYVRQYSLCGKTADRRHWQVAVRRAVDGRGGSAHIHEVLAEGDTIRVSAPRNN
FT                   FPLVRAKRYLFVAGGIGITPILPMIAEVSAAGADWRLVYCGRIAESMAFIDEVRALGGD
FT                   KVSLHESELKGQLDLAALINEADSETVLYCCGPEPMLSSIDDICASWSAERVHYERFSP
FT                   RDDGSIEANGAFEVEFARSKLVLTVPPDRSILELAEEHGVDIDSSCQEGVCGSCETRVL
FT                   EGIPDHRDSVLSQKERAAGQKIMVCVSRSCSSRLVLDA"
FT   gene            complement(134321..134746)
FT                   /locus_tag="Bphy_3222"
FT   CDS_pept        complement(134321..134746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3222"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   msm:MSMEG_4809 Rieske [2Fe-2S] domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72382"
FT                   /db_xref="GOA:B2JRQ5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ5"
FT                   /protein_id="ACC72382.1"
FT                   /translation="MRYVVGAADDLPPGSSTIVYPEKVKSGIGVFNINGEFYALKNTCP
FT                   HMGGPLCKGHVRGTSTAALRTDGMPEMHWVRDGEIVSCPWHHWEFEIKTGRTIFKSKQK
FT                   VRSYPVTIESPEELERLKAGVETVPISVEGDAVVLEI"
FT   gene            complement(134775..135818)
FT                   /locus_tag="Bphy_3223"
FT   CDS_pept        complement(134775..135818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3223"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rha:RHA1_ro10287
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72383"
FT                   /db_xref="GOA:B2JRQ6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ6"
FT                   /protein_id="ACC72383.1"
FT                   /translation="MKIDCAIHPVLGSVEFNKAIGSPWNFLKLPPLFGEKYRSPFDQLS
FT                   VTPEQAMSPAAVEAYLRSTDVDYAVLSPTTRGYWPNPQQAAAVARAANTLLFKKWLESS
FT                   ESEGRFLGSIRLAMNDTDTALREIDRWADDDRFVQLVVPARSLATFGEQRFFPIWRAAA
FT                   ERGLVVYVHDDFSTLIEPPPSQVGFPSFFAEDHALRPMASIVQLTSFIIAGVFERLPEL
FT                   RVVFGDLSVHAARSLAIRTDKDWQSDRMEVPWVSDDPTTYLARHVRFVTQADDEISPHS
FT                   KAATGTIGGDNSSLVVYGSRHPYWDGAKAEDVFPTWSEKDRARCFADNAVEFYPRIASR
FT                   VSAELSS"
FT   gene            complement(135815..136975)
FT                   /locus_tag="Bphy_3224"
FT   CDS_pept        complement(135815..136975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3224"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rha:RHA1_ro10289
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72384"
FT                   /db_xref="GOA:B2JRQ7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ7"
FT                   /protein_id="ACC72384.1"
FT                   /translation="MTTATLERPEVRDNQLEHVDIKVIDTDVHVEPRSFEELIPYLEAP
FT                   WRDVPNLIASVPFSRPTYRTLEGGGRKDAYPKVGDIGSDPDMVGQQMFVDDPTDYAILL
FT                   PWSFRGFTVDPRLDTALASAVNAWLADTWLSKYNAENRYVGSISIGIDDPMAAAKEIDK
FT                   WGEHPGFRQVVIGHYGPRPFGHPIYDPIWEAAARHNLPIAMHFRGGATQPLGWTSTGPL
FT                   QYFVEYHSLIAPMAYGAHLASWICNGVFDRHPEMKVLFIEGGFLWYQPFIDRLERHWKR
FT                   TGQELGLKKTPHQYVRDHIRFATQPIEENTDPHKIATLYEEANARELVMFSSDYPHYDY
FT                   DPPSKALPRSLDAEMKTRIMYENARVIYDLPKTRPVDRFDLAGGAR"
FT   gene            complement(137999..139459)
FT                   /locus_tag="Bphy_3225"
FT   CDS_pept        complement(137999..139459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3225"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: bxe:Bxe_B0833 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72385"
FT                   /db_xref="GOA:B2JRQ8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ8"
FT                   /protein_id="ACC72385.1"
FT                   /translation="MSKLNLHEPLLLREQCYLNGEWCDADDSETFSVMNPATGAVIAHV
FT                   PRMGTPETRRAIMAAQEAWPAWRKLTAKARAAILRTWFELMLEHQDDLAKILTAEQGKP
FT                   LIEAMGEILYGASFIEWFAEEAKRAYGDIIPAVASDRRIMVVKGPVGVCAAITPWNFPA
FT                   AMITRKAGPALAAGCPIIVKPAESTPLTALALAVLAEWAGVPAGIFQVITGVPQQIGEE
FT                   MTSNPAVRKLSFTGSTAVGARLMAQCAPTIKKLSLELGGNAPFIVFDDADLDEAVAGAV
FT                   ASKYRNAGQTCVCTNRFYVHNDVYDSFVCKLADAVALLKVGPGTQEGVTQGPLINEDAV
FT                   KKVESHVKDAVLHGGRIVSGGKRHALGHSFFEPTIIADATPAMKVAREETFGPLAPVFR
FT                   FHSDEEVVYLANNTEFGLAAYFYSRDIGRIWRVAEALEYGMVGVNTGLISNEVAPFGGI
FT                   KQSGLGREGSHYGLDEYLETKYLCIGGI"
FT   gene            complement(140183..141604)
FT                   /locus_tag="Bphy_3226"
FT   CDS_pept        complement(140183..141604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3226"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bxe:Bxe_A1949 Mn2+/Fe2+ transporters, NRAMP family, MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72386"
FT                   /db_xref="GOA:B2JRQ9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ9"
FT                   /protein_id="ACC72386.1"
FT                   /translation="METNSKEVYGWGNGARYYDLVCIAAGSPDSVHAGSRDNAPHSTIA
FT                   GGIGCDHVGPLDRAPRVRGRWFSFVGAGAMVAVGYMDPGNWATALGSGAEYGYQLLSVV
FT                   LVASLMGLLLQWVASRVGVVTGLDLAQLCRERYSRRTTLFLWITCEIAIVACDVAEVVG
FT                   SAVALQLLLGVSLRVGVVMSAIGTFVMLALQSRGQRPLQVVIATLIFFVGFCFVVELAL
FT                   ANPSWRGVLAGFTPSPALLRDAGMIWFAAGILGATVMPHNLYLHSALVKDHAKGRDEQR
FT                   IADAMRGVNIDTFCSLSLAFTVNASLLIVAAAVFHANGHNDVSDLADAHRLIAPLVGSK
FT                   WASVIFAGALLACGLNATVTGTLAGQAVMEGFLQLKSVRWSRALLTRALAIGPALLAVG
FT                   AFGEHGSNQLLVASQVVLSVQLPLAVVPLVRFASDARLMGRFRVKRIPLLMAWLCAGII
FT                   VLLNVALLWQLMTGL"
FT   gene            complement(142181..143737)
FT                   /locus_tag="Bphy_3227"
FT   CDS_pept        complement(142181..143737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3227"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: bxe:Bxe_B2237 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72387"
FT                   /db_xref="GOA:B2JRR0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR0"
FT                   /protein_id="ACC72387.1"
FT                   /translation="MIRMTLNQKLSSMMAVLWMGLVLIAVAGVWQYRTALIQDRRDQLK
FT                   TVVQQGESVVKHYYALTQKNAMSDDEARRRTLEALSIMRYGKDGYLTVNDSRPVMLMHP
FT                   FAPDLVSKDQSGFADPTGKHLFQELVKVSNKDGGGFVDYVWYRPGGSRDTPVQKTSYAL
FT                   RFAPWDMIIVTGMYMDDVNAEFTSSLVRWVGLTGVLGLVASAVMFLVLRSVRRGLGGDL
FT                   EVAIETAHRISRGDLTTNVSTAERDTGSLMHALAIMQSGLTEAVERIRLGAENINVGAN
FT                   EIAAGNMDLSQRTEEQAAALVQTASSMDQMTANVRLNADSAEQASRLAGQAAEVAIRGS
FT                   SVVDDVVRTMGEITFSSQRIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVA
FT                   SEVRSLAQRSAMAAKEIKALIESSTSTVDEGAALVANAGETMGEIVRSVQRVSQILGEI
FT                   SHASQEQSSGIEQVNRAMAEMDKVTQQNAALVEEAAAAAQSLKDQAGALRDAISGFALP
FT                   A"
FT   sig_peptide     complement(143654..143737)
FT                   /locus_tag="Bphy_3227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.938 at
FT                   residue 28"
FT   gene            complement(143989..145335)
FT                   /locus_tag="Bphy_3228"
FT   CDS_pept        complement(143989..145335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3228"
FT                   /product="putative enzyme of poly-gamma-glutamate
FT                   biosynthesis (capsule formation)-like protein"
FT                   /note="KEGG: sit:TM1040_3117 putative enzyme of
FT                   poly-gamma-glutamate biosynthesis (capsule formation)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72388"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR1"
FT                   /protein_id="ACC72388.1"
FT                   /translation="MSRVSVLATGDAMLTQRISPNPDADFLALVEMLRKTDVTITNVEM
FT                   VFPGRGRMASTTMHGIPCGVEPELLSEFEWLGIDIYGMGHNHATDYGVSGLVASIEALE
FT                   ARGLTYAGVGRTLQEARAPRYFDAPGCRVAYIAAGSSNARLCLAADPSVGDVGRPGTAP
FT                   LRVQKTHYIRKERFDELREILAEAGVNVSATGTTAPGIHFPYPDKNIYDGPPPGGFAVE
FT                   GVNFAPGDDSRVQTDVLERDVDAIVASVKEASRQADLVFVGLHCHEGIQGRWNTEVPAE
FT                   FLQPLAHQLIDAGAHGVFAHGPHMLRGVEFYAGRPICYSLGNFIFNVETFSSFPLEVYE
FT                   QQGMPLSSTPADLFDVVTGYKNQPLFWESVVARFTFENGLLADSELHPITLGRDAPRSR
FT                   RGCPELASAEEGARILGRLNELSKPFGAALDIVRDGERCVGKIKFRVSD"
FT   gene            147323..148183
FT                   /pseudo
FT                   /locus_tag="Bphy_3229"
FT   gene            complement(148252..149355)
FT                   /locus_tag="Bphy_3230"
FT   CDS_pept        complement(148252..149355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3230"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   rme:Rmet_4228 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72389"
FT                   /db_xref="GOA:B2JRR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR2"
FT                   /protein_id="ACC72389.1"
FT                   /translation="MRGVDTFTENLFSVRKLDDFVPTSHPLRSIRVMANEALAKMDRIF
FT                   AGMYEADIKGGRPSIAPEKLLRAMLLQVLYSIRSERQLMEQTQYNLLFRWFIGLSMDDS
FT                   VWVPTVFTKNRERLIRHDAVVEFFNEVLSIAQKKNWLSGEHFSVDGTLIHAWAGHKSFV
FT                   RKDGEEDRDNDGGSGEGGFKGSKRSNETHESKTDPDARLYRKGKTASELRYMGHTLTDN
FT                   RHGLVVNARVSRADGHAEREAAKVMINDARQAANDAAAQITLGADKGYDAQEFIEACQQ
FT                   MKVTPHVAQNTSGRRSAVPDAIARSVGYAISQQKRKLIEQGFGWAKTVGRMRQVMVRGL
FT                   KKVDQMFVLNMAAYNLVRMRSLGQARP"
FT   gene            complement(149975..150721)
FT                   /locus_tag="Bphy_3231"
FT   CDS_pept        complement(149975..150721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3231"
FT                   /product="ISPsy22, transposase truncated"
FT                   /note="KEGG: psp:PSPPH_1446 ISPsy22, transposase truncated"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72390"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR3"
FT                   /protein_id="ACC72390.1"
FT                   /translation="MMGQQGGGQHKLFYSFNLDDHVPRTHLLRGIDRYFDLDGLREHLA
FT                   PHYSHTGRPSIDPELMIHMPIVGYCFGIRSERRLCEEVHLNLAYRWLCRLGLEDAVPDH
FT                   STFSKNRRGRFRDSEALRHVFESVLRRCMSEGLVEGEGFAVDASVVKADANRARGVPGT
FT                   EVIDWRQGDGPSRAVQEYLSALEEANPAPSDDVESTTPPKRISLTDPAARYTAAPGGPA
FT                   FFAYSTNYLIDLHAGIIVDVEATPQT"
FT   gene            complement(151122..152426)
FT                   /locus_tag="Bphy_3232"
FT   CDS_pept        complement(151122..152426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3232"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: dar:Daro_2336
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72391"
FT                   /db_xref="GOA:B2JRR4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR4"
FT                   /protein_id="ACC72391.1"
FT                   /translation="MLTDLELRALKPTGRIYKVTDQRGLYVAVTSSGAVSFRFDYRLNG
FT                   RRETLVIGRYDPGLPARGARAADELTFGMSMRLAEARLLLERARRQVEQGVSPSKSKVE
FT                   KRVEAADAMTFGKWVEKYFAEATLAESTRAMRKSVYDRNLAAEFGRLTLEEITPSRLLM
FT                   RCEKIKERGAAAPAVQARDIVLQVYRFVQARGLRVANPAEDIRPSAIATFKPRDRALTP
FT                   GEIHMFFKALERTPTLPTLRLAVKFMLLTMVRKSEFILATWDEVDFNAAIWTIPKDRMK
FT                   GGRPHNVYLSQQALDILVTFKTCFGASSYLHPGRYESELPISAATLNRVIDSAVRLIRE
FT                   SGAPDFESFSVHDLRRTASTQLHEAGFNSDWIEKCLAHEQRGVRAVYNKAEYAEQRRGM
FT                   LQTWAEMLDGWIMKDHEIDNGPRVRPTQSPLTSIA"
FT   gene            complement(153284..153865)
FT                   /locus_tag="Bphy_3233"
FT   CDS_pept        complement(153284..153865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3233"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr6905
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72392"
FT                   /db_xref="GOA:B2JS15"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS15"
FT                   /protein_id="ACC72392.1"
FT                   /translation="MRFEKGHKAVTRQHILEVASKCFRREGVSAAGISGIMGEAGLTNG
FT                   AFYLHFESKEALVREAVGSALAERQQNLEEKVQAGVDLEGVIRSYLNQAHCEDPACGCP
FT                   SAALLPEIARQSVPTRQTYEDGLQSFVSTLAALLPEADSAAAGRRATAIFALMVGTLQF
FT                   ARAVPDVARAEQILEGGVEAALLLARASPV"
FT   gene            complement(153893..154384)
FT                   /locus_tag="Bphy_3234"
FT   CDS_pept        complement(153893..154384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72393"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS16"
FT                   /protein_id="ACC72393.1"
FT                   /translation="MANALYSTRTILIEHVTIKSIKPFEEVRAKLVALAPRIDDGIFTL
FT                   LRYGESTRALRELEACPPLTIFGQRDHGALLAIAGLTRRSIQYDIGNPLTASKMTRHQL
FT                   SAVLYAPIRVLLREDGDGGVGFEYDRPASVFGQFGSEEVNTVAQQLDRDLQTLLEAAAN
FT                   "
FT   gene            complement(154448..155914)
FT                   /locus_tag="Bphy_3235"
FT   CDS_pept        complement(154448..155914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3235"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bja:bll6413 indole acetamide
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72394"
FT                   /db_xref="GOA:B2JS17"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS17"
FT                   /protein_id="ACC72394.1"
FT                   /translation="MNDTIASSSQTSAPEMQRFASLGLAAAADAIRGGEMTSEAYATAL
FT                   LRQARSHADLNAFITIDGDAVLEAAKNADKARSAGAEAPLLGVPIGVKDSYLTTGLPTS
FT                   IGLDRLAHFIPTEDADAVRAIKEAGALVFGKNNLVEMSYGLTGHNERYGQVKNPRAHDR
FT                   VTGGSSSGSAASVAAGIVPASLGGDTVGSIRVPASLCGVVGFKPTTGRWPRNGVAPISH
FT                   TLDTTGVFARSVEDCILLDQVVTGEQAAEPVERDSNLTGARLAFAPRQFLGLVDSEVEN
FT                   RFREVVRRLQDAGAEVFEIDLGEDFNALIQTTTWGIFAHETQGAISEFLRLHNIPTTFE
FT                   AIYEGLKPQLRQAWEHIVLPGGAGATSVEAYQTALNVSRPEIQRRLNRAFVTRGALAIL
FT                   QPTTPCTAPSIEEQGEFHIAGQEVSNLALANHTLSASSVGLPGISLPAGMSRAGLPIGL
FT                   ELDAPLASDRALLKLARQIEAVLGTQPPTL"
FT   gene            157195..158121
FT                   /locus_tag="Bphy_3236"
FT   CDS_pept        157195..158121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3236"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sma:SAV3810
FT                   epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72395"
FT                   /db_xref="GOA:B2JS18"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS18"
FT                   /protein_id="ACC72395.1"
FT                   /translation="MHYVDEGQGPLVILLHGFPYLWYMWRRQIPALAAAGYRVVVPDQR
FT                   GFGQSERPDAIEAYDISQSVGDMVGLMKVLGESSAVIIGHDLGAWVAQAAAMLRPDLFR
FT                   GLVMLNTPVPPRGSVKPTIALNEMARGKGYHHLYFQELGTPDREMSNDTRKTLRSIFYS
FT                   VSGSAVGAERWRIFFEPGQPLLDAFTDPKDFPSWLSSRALDYYVDEYSRTGFTGAINYY
FT                   RCRDRNWEITAFLDGAVVRQPSMFISGAADASLEPAPIRALYDQLEAYLPGLRKKVLLP
FT                   GVGHSAAEERVDQVNELLLDFLRGLSD"
FT   gene            complement(158691..159024)
FT                   /pseudo
FT                   /locus_tag="Bphy_3237"
FT   gene            complement(159118..159408)
FT                   /locus_tag="Bphy_3238"
FT   CDS_pept        complement(159118..159408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3238"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: regulatory protein MerR; Prophage CP4-57
FT                   regulatory; KEGG: azo:azo2049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72396"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS19"
FT                   /protein_id="ACC72396.1"
FT                   /translation="MLCSIVLTLWLCSQEATEANEGKVAMKICLSLKEVAQALSLSQST
FT                   VQQLVREKRFPEPRLLSGRRVGWLTHEVQNWANARPVAKLLPPENSSTKKR"
FT   gene            complement(159818..161092)
FT                   /locus_tag="Bphy_3239"
FT   CDS_pept        complement(159818..161092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3239"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bur:Bcep18194_B1028 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72397"
FT                   /db_xref="GOA:B2JS20"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS20"
FT                   /protein_id="ACC72397.1"
FT                   /translation="MRFDARAAAKLPSGAHMTFEGFPGLRLQASTSRKSWTYRYKSPVD
FT                   SRMRQVKLGEWPAMSFAGAIAAWEKSRVERDSGAELSALRRKPETGTTRPSPDTYSVRQ
FT                   LCRDYLQGYVEVNRKTKGAVEVARIFKAMLGPIADMRAASITRAQAFDLLESYRSTPML
FT                   AARLRMELGGAWHYALDAGRLPENTANWWKEVLRGRLKSKGRKVEGQYTGTQKRVLSVD
FT                   ELGTLIRWLPNFSLTVADALTLYLWTGTRGGEIVAMESTEIADESDGLWWTIPKRKTKG
FT                   LHNEKATDLRVPLVGRAEVIVRRRLDQAKGTVLFPSSRGEAMDQTVVQHGVYYHQPYCK
FT                   IAPNHDRPRLPVTHWSAHDLRRTTRTLLAALGCPNEIAEAVLGHVLPGIIGVYNRHTYD
FT                   RERRQWLTQLSHRLEDIAATYPPKK"
FT   gene            complement(161313..161960)
FT                   /locus_tag="Bphy_3240"
FT   CDS_pept        complement(161313..161960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3240"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: bxe:Bxe_B1675 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72398"
FT                   /db_xref="GOA:B2JS21"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS21"
FT                   /protein_id="ACC72398.1"
FT                   /translation="MPMSHDPSQADGAITAECVTLDATAMLPTRYGTFKSYVFRVNDSG
FT                   AEHFALVMGDVESQQSVLTRLHSECLTGDVLGSYRCDCGEQLDLALRYIAAEGCGVLLY
FT                   LRGHEGRGIGLSNKIRAYALQEQGRDTVEANLDLGLPDDSREYDSAAAILRLLKVTSVR
FT                   LMSNNPKKFDSLSKHGIPVCERVALAIPMREENERYIRTKQVKFGHYFEENE"
FT   gene            162301..162735
FT                   /locus_tag="Bphy_3241"
FT   CDS_pept        162301..162735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3241"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bxe:Bxe_B1676 signal-transduction protein containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72399"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS22"
FT                   /protein_id="ACC72399.1"
FT                   /translation="MTSVAQVLKSKPTQEVYTIEATDSVYNAIKLMADKQIGALIVKEN
FT                   GAIAGIVTERDYARKIVLMDRSSKTTPVRDIMSSAVRFVRPEQTTDECMALMTERRMRH
FT                   LPVMENDRLIGMVSIGDLVKNIIAEQQFTIQQLEHYIHGA"
FT   gene            complement(162993..163319)
FT                   /locus_tag="Bphy_3242"
FT   CDS_pept        complement(162993..163319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72400"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS23"
FT                   /protein_id="ACC72400.1"
FT                   /translation="MKSLIKAVALAAVLAVPAVSFAQSNQPVTRAQVRAELVQLEKAGY
FT                   NPATAVDSTYPADIQAAESRVSAQNGAVAQAPVADTGYGSSTNGSSQAGAKSLNPAQDV
FT                   YFGH"
FT   sig_peptide     complement(163251..163319)
FT                   /locus_tag="Bphy_3242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 23"
FT   gene            complement(163550..164188)
FT                   /locus_tag="Bphy_3243"
FT   CDS_pept        complement(163550..164188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3243"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase; PFAM:
FT                   methylpurine-DNA glycosylase (MPG); KEGG: bxe:Bxe_B1678
FT                   methylpurine-DNA glycosylase (MPG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72401"
FT                   /db_xref="GOA:B2JS24"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JS24"
FT                   /protein_id="ACC72401.1"
FT                   /translation="MANTMLSLVPLHRNDLPVDTVDLARFLLGKYLVHDLPEGRVAGRI
FT                   VETEAYPVGDSTNHAYPGRRACNGSMFLEHGHAYVRLTYGIYHVINVVSEPEGTGAAVL
FT                   IRALEPVAGMEWMQARRPGTTPGDLTRGPGRLALALGVGPGFDGADLCTGRGLWLGAAG
FT                   RARTPPPFAVTTRIGIARETHRLLRFYVPGSPFVSGPRKLLTGEAPRPG"
FT   gene            164516..164872
FT                   /locus_tag="Bphy_3244"
FT   CDS_pept        164516..164872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3244"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   bxe:Bxe_B1679 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3244"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72402"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS25"
FT                   /protein_id="ACC72402.1"
FT                   /translation="MKAIQAMKMAGAALVVLASVNAYAQASDADMTAQPSAKQTAKAAK
FT                   SADRALAKKVRGALAKSKDISVSNITVRAKGGAVTLQGSVPEQPQVDKATQVAQGVQGV
FT                   TSVKNALTIRPVGQ"
FT   sig_peptide     164516..164590
FT                   /locus_tag="Bphy_3244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.782 at
FT                   residue 25"
FT   gene            165045..166193
FT                   /locus_tag="Bphy_3245"
FT   CDS_pept        165045..166193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3245"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: bxe:Bxe_B1680 Ca2+/H+ antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72403"
FT                   /db_xref="GOA:B2JS26"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS26"
FT                   /protein_id="ACC72403.1"
FT                   /translation="MHRRPLMNRLTNNSKRTEHMASTSPVLPRWTIAAPIIAWLVLGAA
FT                   YALPGNGLLTALAALALAGSVFAGVHHAEVVAHRVGEPFGTLVLAVAVTVIEVALIVSV
FT                   MLSAGPEKAGLARDTVFAAVMIVCNGIVGICLLVGGLRHREQDFQIRGASAALAVLASL
FT                   SVLTMVMPNYTSVALGPALSDTQLAFAGVSSLVLYGVFVFVQTVRHRDYFLADASHGAG
FT                   EDAHAQPPGTRVALTSAALLVVSLVAVVLLAKVLSPVVERAVLEAGAPAAVVGIVIAAL
FT                   VLLPEGLAAVRAARADRLQTSLNLALGSALASIGLTIPTVALVFIWTGRPLVLGIDGKD
FT                   TVLLTLTLLISTLTLGTGRTTILQGAVHLSLFAAYLFLSFAP"
FT   sig_peptide     165045..165188
FT                   /locus_tag="Bphy_3245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.874 at
FT                   residue 48"
FT   gene            complement(166232..167134)
FT                   /locus_tag="Bphy_3246"
FT   CDS_pept        complement(166232..167134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3246"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1681 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3246"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72404"
FT                   /db_xref="GOA:B2JS27"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS27"
FT                   /protein_id="ACC72404.1"
FT                   /translation="MNFPDTTTTMRRLPPLNALQIFETVARHRSFTRAAEHLCLTQGAV
FT                   SRQILALEDYYQFPLFRRHAKGLTLTAEGELLLPAVKESFARIEEISLRLTRQRTDLAL
FT                   KVPTCVMRWMLPKIMQFQADYPDLHVQITTTWQHDVDFQVEPFDAAIVYGTSAGADVQA
FT                   VPLFEERLTPVCAPQLLQSKPLAKTADLARHTLLHPTRDHRDWKMWLDHVEARNIDANL
FT                   GPSFDTLDLATNAALQGFGIAISDLALIEEDVAAQRLVRPFDAVLTTGARYYFVYPDSV
FT                   AHQQKVNLFRDWIDAHWAQ"
FT   gene            167368..168177
FT                   /locus_tag="Bphy_3247"
FT   CDS_pept        167368..168177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3247"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bxe:Bxe_B1686 ABC amino acid transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72405"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS28"
FT                   /protein_id="ACC72405.1"
FT                   /translation="MITAALSRRRFTRAFAALAFAGAALASFAPLAHADALDTITKAGV
FT                   VRVGVFMDYPPFGSIGPDMKPQGYDIEVANLIGKSLGVKVELVAVTGDNRMAYLADHKA
FT                   DMLLSVGQTPEREKVIDFSQPYAPYYLAVFGPKSLKVKDANDLAGKSISVARGTLEDLS
FT                   VTKIAPPSANIKRFDDPNGAISAFLSGQVQLMVVGNDVGATILARHPANDPEQKFSLFS
FT                   SPDHVGLNKNEPRLLKKVDDTIARARKDGTMNAISQKWLRAPLPETL"
FT   sig_peptide     167368..167472
FT                   /locus_tag="Bphy_3247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 35"
FT   gene            168221..168967
FT                   /locus_tag="Bphy_3248"
FT   CDS_pept        168221..168967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3248"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1687 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72406"
FT                   /db_xref="GOA:B2JS29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS29"
FT                   /protein_id="ACC72406.1"
FT                   /translation="MSYTFDFSSFDLYAGMLVRGVGVTLGLTAISTVLGGLVGMAGAVV
FT                   AASGPKWARWLIAGYVEAIRNTPFLVQLFFVFFGLPSLGIHIDEIQAAILAMTVNLGAY
FT                   AIEIVRAGIDSIPRGQVQAAQALGLQGRQVFRHVVLPQAIANVFPALLSQVLIVMLGSA
FT                   VVSQISVPDLTYAANYIQSRNFRSFEAYVIITATYLALSIVLRQLLNRLGKGLFAGRAA
FT                   RSTDASPRRVFSLRGARAASTTERSS"
FT   gene            168964..169620
FT                   /locus_tag="Bphy_3249"
FT   CDS_pept        168964..169620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3249"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1688 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72407"
FT                   /db_xref="GOA:B2JS30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS30"
FT                   /protein_id="ACC72407.1"
FT                   /translation="MIEFTLWDIARNLLLAARWTVLLSLIAFVGGGVVGLLLLAMRVSP
FT                   FPWLRRIVVLYVELFQGTPLLMQLFLAFFGLPLMGVDVSPWVAATVTLTLYTSAYLVDI
FT                   WRGCVEAVPRGQWAAGASLGMTFAQQLRYVVWPQALKIAVAPTVGFLVQVVKSTALTSI
FT                   IGFTELTKTGTMITNAAFRPFPIYGMVAVLYFAMCFPLTWWARLLERKQKATQQR"
FT   gene            complement(170191..171459)
FT                   /locus_tag="Bphy_3250"
FT   CDS_pept        complement(170191..171459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3250"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_B1689
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72408"
FT                   /db_xref="GOA:B2JS31"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS31"
FT                   /protein_id="ACC72408.1"
FT                   /translation="MKTTLKALALSAALALPVLANAADDALVKRGEYLSKAGDCIACHS
FT                   APRGKPFAGGLPMMTPMGAIYSTNITPDQQTGIGQYSEDDFKRAMREGVAKDGHNLYPA
FT                   MPYPSYAKIDDDDMHALYAYFMNGVTPVKQANREPDIKWPLNMRWPLKVWNMVFLDKGV
FT                   YRDKPGKDVAWNRGAYLIQGLGHCGSCHTPRGVAFQEKALDESGSAYLTGGLLDNWFAS
FT                   NLTGEHNVGLGRWSEADVAQFLKTGANQHASAFGAMTSVINNSTQAMTDGDVAAMSRYL
FT                   KSLPAAGGSGGPAYVYDAATTKVSLTRPANDAGARVYTAYCMHCHGADGRGFAPMLAPL
FT                   AGNPNVLEKDASSLINVTLNGTEDLVIGGVPAPYPMPRYADVLNDQQIADVLTFVRGGW
FT                   RNGAASVGASDVAKVRKATQASR"
FT   sig_peptide     complement(171391..171459)
FT                   /locus_tag="Bphy_3250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 23"
FT   gene            complement(171471..173711)
FT                   /locus_tag="Bphy_3251"
FT   CDS_pept        complement(171471..173711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3251"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bxe:Bxe_B1690 isoquinoline
FT                   1-oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72409"
FT                   /db_xref="GOA:B2JS32"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS32"
FT                   /protein_id="ACC72409.1"
FT                   /translation="MSQGLLDAQNGKPRDDGHAAVSRRTFLKFSASVAAVAGGGLLLGF
FT                   SVPAQSQGDVRKSVIGGDGVETPQSGVFAPNAFVQIDTAGKVTLIIPKVEMGQGVYTSI
FT                   PMLIAEDLEVPLDSVTVDHAPPDEKLFTDPLLGGQLTGGSTSIRFAWEPMRRAGATARM
FT                   LLISAAAQQWQVEPASCHAERGQVIHAGTKRSIAYGQLVEAAVKLPVPQNVPLKNPKDF
FT                   KLIGTQAKRLDSPEKVDGSAMFGLDVRLPDMVYAAIVNCPVFGGTLAGVDDTAAKTIPG
FT                   VRQIVKFDNGVAVIGDHTWAAKRGAAALKVTWNEGAGASVSTKTIFDDLSKAASQGNGA
FT                   VARKDGDVNNAFSQAKTRVDAVYQQPFLAHATMEPVNCTVHVKPDSCEIWVGTQVPTRA
FT                   RDAGAKVTGLPADKIVVHNFLLGGGFGRRLEFDMVTQAVKVAKALNVPVKVVWTREEDI
FT                   QHDMYRPAYYDRISAGLDANGKPIAWQHRIVGSSILARFAPPAVKNGVDPDAVEVAADL
FT                   PYDLPNQLVDYVRQEPRDIPTAFWRGVGPTRGTWVVESFIDELAAQAQIDPVKYRQDLL
FT                   GKSPRALNVLNVATQAAGWGRAVPKGQGRGVSVMHAFGSFFSMVADVSVEQGEVRVSRV
FT                   VCAVDCGMVVNPNTVDAQIQGGIIFAITAALYGEITIDRGRVQQSNFTDYRILRIHETP
FT                   PIEVHIVKSSEAPGGIGEPGTAAAIPAVANAIYAATGKRLRQLPVGNQLMSA"
FT   gene            complement(173713..174168)
FT                   /locus_tag="Bphy_3252"
FT   CDS_pept        complement(173713..174168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3252"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bxe:Bxe_B1691 putative oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72410"
FT                   /db_xref="GOA:B2JS33"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS33"
FT                   /protein_id="ACC72410.1"
FT                   /translation="MATLNINGHSHTIDAPPDMPVLWVLRDIVGLTGTKFGCGIAQCGA
FT                   CTVHLDGVAVRSCVLPIAAVGDKKITTIEAVGDTPAGKKVQAAWRQIDVVQCGYCQSGQ
FT                   VMQAASLLAQNPNPSDADIDAAMAGNICRCGTYNRIRAAVKQAAKEA"
FT   gene            complement(174462..179090)
FT                   /locus_tag="Bphy_3253"
FT   CDS_pept        complement(174462..179090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3253"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; cellulose
FT                   synthase operon C domain protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: bxe:Bxe_B2043 putative cellulose synthase operon
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72411"
FT                   /db_xref="GOA:B2JS34"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS34"
FT                   /protein_id="ACC72411.1"
FT                   /translation="MPIRQRALVIGIALTLGAGAAASAFAQGQPNDPMNVLIDQGKYWQ
FT                   AHQRGDLAEQAWLKVLRIDPKQPDALYGMGIVMSDRKDGAGAQQYLARLRQAAPNYPNM
FT                   DELARRLGQSSPTDQAVNDARRLAQSGQQASAAQAYRQALGTKPANPQLALEYYQALGS
FT                   SPQGWEEARRGLEQLAREHRDDPRFALAYARHLTYREANRREGIEQLAQLSKDSIVGAQ
FT                   AKAAWRQALLWLGVRASDAPLFQAYLSVAPDDAAVKARADSISEQDRRASERAQQNAGA
FT                   DARGRTVAEGFAALDRGDLVTAKARFSSVLASSPNDGDALGGMGVALLKQEQFAQAREY
FT                   LLRASQQGGAARWREALNSATYWMYTSEGLGEQSNGNLAHAKALFEKAIAVSPGDVTAQ
FT                   TALGDLLMQSGDPRGAEAAFRMALRRQADNPDAIRGLVGALAAQGRGDDALSFANQLTE
FT                   AQRKKVGGADRLRGEAQAAQARAAEARGDLGNARSLFEDALLSNPDDPWLRLDLARIYA
FT                   KQGAYANAKSIMDGLIALHPDMPDAFYASALLAADMQDWRYGLSQLERIPVNKRTDAMA
FT                   LLQHRLWVHQQCDEAVALAKSGRVAQARGVLNNAEPVAGNHAELIGAIASAYVNTGDTA
FT                   RALMMVRGAVARSPNDAGLLLTDAGILLNAGQDAELGEVMRRLASMQLTGQQRSDFEKI
FT                   NVAIVVRRTDALRQANDLASAFDVLSPWLAARPNDPDILAALARLYTANNDNANALATY
FT                   RLALAQNPNDLGLLLNAAGAATQIRKFDFAESSLRHALRIAPNNADALAAMGRMYRAQG
FT                   RNSLAAQYFQRALIAQNAPLARQGTQPAGVNGTPVPSGWDVPLPPRGPIPLPGTNPFAN
FT                   RTSADASNSVPFPAQNTQPYLMPMPAYTPPTQPAPYIAPQTQPASQIDSLGVLAPQAAS
FT                   NGREAPDVDGYGPDQYGSSQSGGGLAPGQAYPGQGYAQPQSYQQPYPQQAYQQPVYVQP
FT                   NDAAVSTPWPMSPQAQAAAQAQATQGMNQQPTSASKKRAAKNARATNSSAASAQQQGYA
FT                   QPYPQQQAYPPPYPQQPAYAQQPYPQQRAYAQQAYPQQGYQPQPYQQQAYPQQAYPQNY
FT                   TNQGYGLVPYIPQPPAPYPARNAQLQDEQNRQYRQPAQPQPLTVEEELAQINREQTSTV
FT                   SGGIVFRNRDGENGLSNLTDIEAPVQGRIRAGDGHVIVEVTPVTLDAGTASNNTNTLAR
FT                   FGSSQAFGTSTVLPGSQTASGVGADVGYEWRGLKADVGATPWGFREQNIVGGVQYRGNI
FT                   TDKVSYKLTAGRRGVTDSLLSYAGAHDSAMNLQWGGVTSNGLRGDAGWDDGTNGLYVNA
FT                   SWAYLMGHNVASNNAVKGGGGVYTRLVKDTDQTLTVGVNTTLMHYDKNLSYFTFGQGGY
FT                   FSPQQYAILNLPIEYTGRNGPFTYDLKASIGVQHYRQDESDYFPTNSTYQSKAASASNV
FT                   PDPGAVYPSQSKTGVSYSIDAVGEYQLAPQLAVGAAASFGNAYQYREFVAAVYVRYAFT
FT                   KQSGSSTFPPSPVRSYYLPVNE"
FT   sig_peptide     complement(179010..179090)
FT                   /locus_tag="Bphy_3253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 27"
FT   gene            complement(179063..180295)
FT                   /locus_tag="Bphy_3254"
FT   CDS_pept        complement(179063..180295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3254"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   bxe:Bxe_B2042 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72412"
FT                   /db_xref="GOA:B2JS35"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS35"
FT                   /protein_id="ACC72412.1"
FT                   /translation="MREAFIFSSWRFRLRAPLARPLVCAGLVGSLVASMTGHAQAATCD
FT                   DWPAYRAFVSRFVQQDGRVVDFSTPTQQTTSEGQSYGMFFALVANDRATFERLLRWTRA
FT                   NLSAGRFDGGDVKLPAWQWGKKPDGAYGVIDPNSAADSDLWIAYDLFEAGRLWREPAYT
FT                   QLAYALVTQVEKQEVADLRGLGPMLLPGSQGFRNGATTRLNPSYLPLPLIRALAAQSPN
FT                   GPWSRIADNAFKLVKTTAPLGFAPDWAAYRDGQFVVDPQTGDAGSYDAIRVYLWAGLAA
FT                   SADPLAKPWLAALHGMRDRIAQTGVPPEKVATTTGNAAGEGPIGFWGALLPYFRALGDT
FT                   RAAGLAQTHLASLATPAPGAAQAARNQPVYYDEVLMLFGTASADGRYRFDENGRLVPRW
FT                   ENTCQSANARL"
FT   sig_peptide     complement(180170..180295)
FT                   /locus_tag="Bphy_3254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.614 at
FT                   residue 42"
FT   gene            complement(180297..182861)
FT                   /locus_tag="Bphy_3255"
FT   CDS_pept        complement(180297..182861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3255"
FT                   /product="cellulose synthase subunit B"
FT                   /note="PFAM: cellulose synthase subunit B; KEGG:
FT                   bxe:Bxe_B2041 cellulose synthase regulatory subunit, cyclic
FT                   di-GMP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72413"
FT                   /db_xref="GOA:B2JS36"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS36"
FT                   /protein_id="ACC72413.1"
FT                   /translation="MRILRYDAAVAAAMRTGVRLLACSACRLPLRATVGALLFAATLPA
FT                   VQAASASPPGASPGAVPATKAQLAATPGTTPANQPLVAQSTAPAPAGNGLPPLPSAKPV
FT                   DARAAQQPSFAEPAPQTFAAVRSGRDTMPTTADNGTAVSGGRRQTFTFAQLGALDPLQL
FT                   RGVDGQNGVPFSVRADEVVTGANLHLIYSYSPSLLSNLSHLKVLVNGEVAATLPLPREQ
FT                   AGTLLARDIPLEPRLVTEFNHLNIQLIGHYTQGCEDPASSALWATVSNASTLDLTFASL
FT                   ATKPDLGALPLPFFDRRDVRRLELPFVFAAKPSSQALEAAGAVASWFGSLAGYRGALFP
FT                   AQLDNAPLSGNAVVFATNDERPAGVTLPAINGPVLAIVDREAPARGKLLLVMGRDAREL
FT                   KIAANALSLGEAALSGTMQTITHVDAPRARQPYDAPGWLPTDRAVRFGELTVPKDLSVR
FT                   GYNPDVVRVDLRIAPDLFTWRTKGVPVDLRYRYTVRPAPDRSTLNISVNNNFVQALRIP
FT                   AESSSMLDLGRYLNRMLPDHTAPASKEIFIPPHLLASQAQLRFHFYYDMPKTGECQGQV
FT                   LDNVRGEIDPDSTIDLSSFPHYMALPDLAAFANSGWPFTKLADLSQTAVILPANANPSD
FT                   YSLYLMVMGRMGASTAYPVTGVTVATAGDVQRLADKDLLVIGAPGQQPLLSAWEKDMPF
FT                   SAADDTRRMQFSNVSFRIANWWHGNRGGVRTAGRADLSLVNSSGDAIVTGFRSPLEKGR
FT                   SVVALISAPGQSEADLTNAMLDPDLVQSIQGGLTVVRGRTLEVVSNGDVYYVGHLSPVE
FT                   YMRWALSVHPLLLVSGGLLAALIIAAVFYRLLRAVAARRLKD"
FT   gene            complement(182865..185096)
FT                   /locus_tag="Bphy_3256"
FT   CDS_pept        complement(182865..185096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3256"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="KEGG: bxe:Bxe_B2040 cellulose synthase
FT                   (UDP-forming); TIGRFAM: cellulose synthase catalytic
FT                   subunit (UDP-forming); PFAM: glycosyl transferase family 2;
FT                   type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72414"
FT                   /db_xref="GOA:B2JS37"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS37"
FT                   /protein_id="ACC72414.1"
FT                   /translation="MSTAPEDILDAVDAEPPRRSRFDRLASHLIDGRILGSKPVTILLV
FT                   LFALASLFFVFTVPLAFGEQLTFALCCFVCAMLFRRAKGHYATLVMIMLSVIATGRYMY
FT                   WRLTETTYWERPLDAAWGLLLVSAEVYAALVLMLGYFQTAWPLKRKPLPLPADRSEWPT
FT                   VDIFIPTYNEPLSVVKPTVYAAIALDYPKDKLSIHVLDDGRRPEFKAFCEEVGVAWTIR
FT                   SHNRHAKAGNINEALKITDGEYFAIFDCDHIPTRSFLQVGLGWFLRDKKLSMLQTPHHF
FT                   FSADPFEKNLGTFRKVPNEGELFYGLVQDGNDLWNATFFCGSCALLRRTMVEEIGGIAI
FT                   ETVTEDAHTALKLHRRGYTTAYLAIPQAAGLATESLGGHIGQRIRWARGMTQIFRIDNP
FT                   LTGRGLTFGQRLCYLNAMMHFFYGIPRLVFLTAPLSFLFFNAHIIQAAAGTIAIFALPH
FT                   MFHANVTNSRMQQKFRHSFWSEVYESVLASYITAPTLLALINPKLGKFNVTAKGGRIEE
FT                   QYFDWAISRPYLILLALNLIGFIVGCVHIALNASLHSEVQTTVLNLAWTGYNMLILGAS
FT                   VAAAREQRQVRATHRVAMRIPASLRFSTGRTLTCETVDYAEGGLALQLPAAIQVPLHEQ
FT                   VVVSLFRGQDEFVFPADVTYAVPGRVGLKFGAMTREQELDFVQSTFARADAWTGWAEGR
FT                   EVDTPLKSFSHVMRVGVGGIGGLFEHLYADLRTLRSRRKAAANDTKNGK"
FT   gene            complement(185093..185881)
FT                   /locus_tag="Bphy_3257"
FT   CDS_pept        complement(185093..185881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3257"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjQ;
FT                   PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bxe:Bxe_B2039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72415"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS38"
FT                   /protein_id="ACC72415.1"
FT                   /translation="MRVVSVVSAKGGVGKTTLAANLASVLGSNGRRVIAVDFDPQNALR
FT                   LHFGIPVDNYDGVARATLSGASWRTVMFDGIDGITALPHGALNEDDRRVFEARLDSDPY
FT                   LIRESLDALALDADDIVLIDTPPGATVYTRAALLAADFVLNVVIADAASYAAIPQMERL
FT                   IQAYALPRQDFIGYGYVINQVDQGRSLTKDVVKVLRDALAGHLFPGVIHLDQGVSESLA
FT                   YDTTVIHYDPHSQAAADLRACGEWLGACLNGQARLPRSVA"
FT   gene            complement(185878..186762)
FT                   /locus_tag="Bphy_3258"
FT   CDS_pept        complement(185878..186762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72416"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS39"
FT                   /protein_id="ACC72416.1"
FT                   /translation="MRRTSRGNIMSVSDDVGNLFRRFGGDAGQYQEVARDDEAKQAALR
FT                   WPLLNALDIAHVGPVPDAGRPGPAAAPGCRPEPAVASPAGRREQPVRATATSTSESTGA
FT                   ARLPLFARGHRHATMPPPVTPARTGANRFSAPPAVAAAPDPAPAAERKKAAANAVRMAA
FT                   APVAAPAAPPVAAAPAAARPVPPVTPAFRVSALHHVAQSDPGPSCSGRRQSFGPAPFTG
FT                   PVPEGTRDTAWQQGGSILSGLFGGKAAPSGALAAAPSKDLSTLFARLSRGPAAPARSLR
FT                   DTLRTRFKADGEA"
FT   gene            complement(186860..187315)
FT                   /locus_tag="Bphy_3259"
FT   CDS_pept        complement(186860..187315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72417"
FT                   /db_xref="InterPro:IPR022798"
FT                   /db_xref="InterPro:IPR038470"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS40"
FT                   /protein_id="ACC72417.1"
FT                   /translation="MQDEHTAPLLDYYTRHQTSVQWRGFLSALAEEFETQLDTSQLRTL
FT                   MARIGVRFAARYPATGCTTLDDLASFLNGIWSELDWGFVRVVERDDYLSIEHSCAPLAA
FT                   FGERAAPWASAFLEGAYQHWLRELGAGSLALQEHPSANAHAYEFRLS"
FT   gene            187645..188052
FT                   /locus_tag="Bphy_3260"
FT   CDS_pept        187645..188052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72418"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS41"
FT                   /protein_id="ACC72418.1"
FT                   /translation="MKINDERAIQFLGAIRKPLLVLHKAILDHERALYEKEFGPVTPAA
FT                   FLQVLINGTGFRWLTPLSTVIANVDEILDDEKATSADRVAAIEAVAGLFSDDLPGNIFL
FT                   PRYRQILQASPEILHAHGQVAPLLKSLETGD"
FT   gene            188143..188961
FT                   /locus_tag="Bphy_3261"
FT   CDS_pept        188143..188961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3261"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_B1693
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72419"
FT                   /db_xref="GOA:B2JS42"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS42"
FT                   /protein_id="ACC72419.1"
FT                   /translation="MTQWILDQELTYCGQAVRYRTFGEGPPVVLIHGTPFSSFVWHRIA
FT                   PHLARDRKVHVYDLLGYGQSERRDGQDVSLGVQNGLLAALLDHWQLDAPDVIAHDFGGA
FT                   TALRAHLIDGCDYASLTLIDPVAVAPWGSPFVRHVREHAAAFEGLPAYIHEAVVNAYIR
FT                   GSIARTIAAHELAPYVSPWLGEVGQPAFYRQIAQMDQRYTDEIEARYPQVRCRTQILWG
FT                   ENDQWIPIERGRHLAGVIPDARFEPVPNAGHLVQEDAPEAVVAAVLRWIG"
FT   gene            complement(189081..190076)
FT                   /locus_tag="Bphy_3262"
FT   CDS_pept        complement(189081..190076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3262"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: bxe:Bxe_B1694 putative lipoprotein NlpD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72420"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS43"
FT                   /protein_id="ACC72420.1"
FT                   /translation="MSKNGFDRTWAGFASFTLALMVGACAHVGEQDAKNSNAASTAQTA
FT                   TDPAAAAPAPQMVAQSVPPVIYKVRRGDSLARIARSHNVTVKQIVAWNHLKSSARLHIG
FT                   QPLKVSSPDAVKMVAVPAGPAGGQSPGKASNANGTAAAASGASNATVSGGAASASNNPG
FT                   TTNAPNNAPNSTPDKAAAAAPAPGAPAPSAAEAREVNAEVARHAKGVTLIWPAQGNVVE
FT                   GFQPGETRGIEIGGKAGDPIRAAADGKVMYAGTGLNEYGSLIIVQHNKDFLTAYAHNRR
FT                   LLVKTGDIVRKGQQIAEMGNENNSRVSVLFELRHDGKPIDPMPYLPHQRS"
FT   sig_peptide     complement(189996..190076)
FT                   /locus_tag="Bphy_3262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.657 at
FT                   residue 27"
FT   gene            190482..190889
FT                   /locus_tag="Bphy_3263"
FT   CDS_pept        190482..190889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72421"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS44"
FT                   /protein_id="ACC72421.1"
FT                   /translation="MTAVPESRTISVAIARDWREVYSFMEHPLSFAQWASGLGKPLRGA
FT                   GEEWTFENTDGHPVTVYFTPRNPYGVLDHRVITARGDEIYVPMRVIPNGSGAEVLLTLL
FT                   RTASMSDAQFAADAQWLERDLAELKRFLEQR"
FT   gene            complement(190913..191668)
FT                   /locus_tag="Bphy_3264"
FT   CDS_pept        complement(190913..191668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3264"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein GntR HTH; regulatory
FT                   protein DeoR; Helix-turn-helix type 11 domain protein;
FT                   KEGG: spe:Spro_2259 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72422"
FT                   /db_xref="GOA:B2JS45"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS45"
FT                   /protein_id="ACC72422.1"
FT                   /translation="MLTSQRKKLILDALKRDGQVLAKALSDTFGVSEDTVRRDLRELAA
FT                   EGKLQRVHGGALAASPAVANLAGRRAIGSKAKAAIGRAAAQMIAPGQIAFVDGGTTAIQ
FT                   LVRHLPIDLRATIVTHSPSVAVELAEHEALEVIVIGGRLFRHSMVTVGAAAIEALGHIR
FT                   ADLYFMGVTGVHREAGLSTGDLEEAYVKRALVARAAETVVLASSEKLNAASAYMIAGID
FT                   AASAILVEKDTPESTTAPFEASGVTILRA"
FT   gene            191830..192417
FT                   /locus_tag="Bphy_3265"
FT   CDS_pept        191830..192417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3265"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aav:Aave_3332 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72423"
FT                   /db_xref="GOA:B2JS46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS46"
FT                   /protein_id="ACC72423.1"
FT                   /translation="MSEKADRVRIVDAQVLSDDWYVLKKTTFDYRRADGSWQRQSRETY
FT                   DRGNGATLLLYDRRRRTVVLIRQFRLPAFVNGHEGMLIEAPAGLLEAASPEARIRAEVE
FT                   EETGYRVESVRKVFEAFMSPGSVTEKLYFFVAEYDAAARVSRGGGVADEGEDIEVLEFA
FT                   IDDALTMIARGEIMDGKTIMLLQYAALHLFLQ"
FT   gene            192872..193870
FT                   /locus_tag="Bphy_3266"
FT   CDS_pept        192872..193870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3266"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_C1098 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72424"
FT                   /db_xref="GOA:B2JS47"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS47"
FT                   /protein_id="ACC72424.1"
FT                   /translation="MITTQYNALRTSGHGVSARDVTHQMHSIGILIFDGFSMLPVAEVI
FT                   DVFDKANRILAAGPGGLPCYRTAFVSRHGGCVSSSAELAVMTQRPEQLPSVRTLFVACG
FT                   GEVPAKVAADLQFRNWLCETACRADEVFAIGNGDSLLSAISAPAGRTDLKRQNVVPGDS
FT                   SLAGPTRFGTRSAVRQALELVRQDFGIAFLRRVLELIPDTGMPEFNAMTSDSAKSIRDK
FT                   IHESAQWIARNCNRAISVTVAAQTAGMSERSYLRHFRAEMGVKPSEYLRRSRVELAAAI
FT                   LESSDLPVDKIARRCGLTSGECLARLFRQILDVSPTEYRSRMRSANERRGT"
FT   gene            complement(193938..194230)
FT                   /pseudo
FT                   /locus_tag="Bphy_3267"
FT   gene            complement(194288..194416)
FT                   /pseudo
FT                   /locus_tag="Bphy_3268"
FT   gene            complement(194427..195551)
FT                   /locus_tag="Bphy_3269"
FT   CDS_pept        complement(194427..195551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3269"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bam:Bamb_6180 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72425"
FT                   /db_xref="GOA:B2JS48"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS48"
FT                   /protein_id="ACC72425.1"
FT                   /translation="MRIVQVLESSATGTLSMVCLIANRLAKEGHEVHVVYSLRDETPRG
FT                   LRMMFDDRVTLKHIQMKGAGLIFAIKRLRTALKEIQPDVIHLHSSVAGFLGRLAALFSF
FT                   ERMIVLYSPHCISFMRQDISRMTRFAYIALERLAAVRKTLYVACSESERHAVWAHLRQR
FT                   AVVVENAVPEIGEPENHGSGRPCTTASEHRYIVTVGGIRRQKNPELFARIASALGDSKL
FT                   IFVWVGDGEERLRQKLVDAGVRVTGWMTREEVVKNIKQASIYLSTASWEGMPVSVIEAM
FT                   FAGLPVIVSACAGNVDIVRSGVTGVVFNNEAEAVQAIRHVADNETSRESLAARGAREAR
FT                   RRFSQERFFNRLLPLYLDGFLAPRDEEAVSSRFR"
FT   gene            complement(195548..196534)
FT                   /locus_tag="Bphy_3270"
FT   CDS_pept        complement(195548..196534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_3266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72426"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS49"
FT                   /protein_id="ACC72426.1"
FT                   /translation="MKVFILHSGNANYPEINAYSDFLSKLGIQVFSGDSNTYSRFPFKG
FT                   ECVLWCIMGFYRVHENARFIIHDYRSLSVRPLAACKDWIKQVMNAKPNLRAFQNERMRD
FT                   VMNFRDAIPSVLLPMGVPDWIFDAADGDRCDSAHPTKGGRFCYIGEMSRERGFDKVLAA
FT                   WRASPWKRENKFVLVGRPETSLYREFRNTEGLNFVGRVSQKDALDIVRRSEYAVCYFPY
FT                   HRPHCFQTPTKMLEYAALGKKIICNDSPSNLAASRELGIHAFVAGRSIFDSLPFDGREL
FT                   SVKKNEPDKLRRLAWTSVIEGAGILAFVRDAMDIAVPRRLQHVGNAL"
FT   gene            complement(196534..197058)
FT                   /locus_tag="Bphy_3271"
FT   CDS_pept        complement(196534..197058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3271"
FT                   /product="satase isoform II"
FT                   /note="KEGG: bte:BTH_I1357 satase isoform II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72427"
FT                   /db_xref="GOA:B2JS50"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS50"
FT                   /protein_id="ACC72427.1"
FT                   /translation="MSVTIKSTSRAIVEDFRCNAFFKAKFVILLFRIANYLARRSNVTL
FT                   ILGLPFIAFYILISDWVMGIEIPVKTNIGKGLTIYHGFGLVINGFSVIGDYCVLRHGVT
FT                   IGNITRADGTLTGAPIVGNRVEFGANSIALGEIRIGDGARIGAGAVLLSSLAPHAVAVG
FT                   VPARALEKDKT"
FT   gene            complement(197055..198257)
FT                   /locus_tag="Bphy_3272"
FT   CDS_pept        complement(197055..198257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3272"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: bps:BPSL2776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72428"
FT                   /db_xref="GOA:B2JS51"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS51"
FT                   /protein_id="ACC72428.1"
FT                   /translation="MTIAVVIDSLERFYFVRRLVKALDKEGDFVFMTSEPLAHLFFRLE
FT                   GRHSIYLRRAKNNSSGLAYGSSLFDRSIEVMNGTIDAHVARQDWMATFTAALDVFNRLA
FT                   ITVCVMWNGQQLICRAVGHACSTYGVRVRFLELSNLPEKLFADDEGVNALSTVARDPSI
FT                   IDRFSMPDLSEHERWLRRYEEYKRRPLPQSQTSIRRKGLSLLNYAVKVLTQGVGRKRLD
FT                   RSRASNGVRLPAIASSIGEDALISRRYVFLPLQVSGDTQIKLHSDVDNLEAIRIALELA
FT                   ESEGMDLIVKLHPAENDRAVIDEIARLQTIHQFQIVTTAAVDLIKHAAMVVTINSTVGL
FT                   EAMLYGKKVVALGRCLYREFDRDRLMKYIHGFLVDGIDYFGNGPIDPRAARRVFSNDGR
FT                   I"
FT   gene            complement(198284..199540)
FT                   /locus_tag="Bphy_3273"
FT   CDS_pept        complement(198284..199540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3273"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bte:BTH_I1355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72429"
FT                   /db_xref="GOA:B2JS52"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS52"
FT                   /protein_id="ACC72429.1"
FT                   /translation="MTCSEFKKMTMLKDSVISMMGVVAGQISLFFCVSLIGRFQGPAVL
FT                   GHFNYLLACGTFVGTLLAFRYELACVSDSPRYSFNAFIHVTLLSVVVVIVAVCVTLAMS
FT                   HVEVLAVEACAFAYFTQQAAGAYLSSLRRYDIIAASRLAINGVFLLSLLAEECFGTLDR
FT                   TDAFGMYCVINVMVASALLVGILLHGRHRDYRAQVAFSFFSENSRFAAFILPSTLCGSV
FT                   MTYSLAITIPHWFGAESAGYFAAAYRLGFFPVSLTAQSVGSVFRRDLIGALARENAATL
FT                   LHQVFMTYARYLAVIALVYAAGGALLFAPLVRIFLGARWHGASAFFYEMIPLFAVQLMY
FT                   MPLSQVFLATRGQRIDFLFQLGCGVVLSATLFTVHLMRLSVLPSIRAFSVAGVTMMLVG
FT                   LMLTVQVVKRAAAPSPVSA"
FT   gene            complement(199683..200294)
FT                   /locus_tag="Bphy_3274"
FT   CDS_pept        complement(199683..200294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3274"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: bur:Bcep18194_C7401
FT                   undecaprenyl-phosphate galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72430"
FT                   /db_xref="GOA:B2JS53"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS53"
FT                   /protein_id="ACC72430.1"
FT                   /translation="MLRSIAKRSFDIVVASVLIVLLSPLLVVIGVVVRRDGGPAMYGHV
FT                   RIGCGAVPFNCLKFRSMVTNADAVLRELLDRDPLARAEWEREFKLKDDTRITAIGRLLR
FT                   KTSLDELPQLFNVLKGDMSLVGPRPIVSEELLRYGDNASYYLMAKPGMTGLWQVSGRND
FT                   VDYSTRVLLDVTYVKKLSLRTDIWILLRTVSVVLRGSGAY"
FT   gene            complement(200998..202092)
FT                   /locus_tag="Bphy_3275"
FT   CDS_pept        complement(200998..202092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgl:SG0984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72431"
FT                   /db_xref="GOA:B2JS54"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS54"
FT                   /protein_id="ACC72431.1"
FT                   /translation="MIAPPRIALPARSGSSRTLGSHDSAVVLLLVSIMMLVLALTKEKL
FT                   LPAYFFTDSKVIQSFIIAGANLTPGDSFQSTAAVFRFLGAERDSIALPLLTWIVVAGSM
FT                   VGSIWGGRTSEIRLREILLFSMLSLMATIYMSTLSKDILVLGLLIIRKIARWMFGRAGT
FT                   YLWCIIMAAYAYYFRGYWFLILAVYPFLIFVLSKIRRMWLMGLVVIGAIFVVTIVLYLK
FT                   FGITADSFRNAVNEIRIDKGDVNARTMITPFMPGGGFLLGFINVCLTFATFIIPFPLLL
FT                   KVSPYYWIIFLVIVSTQFAFWRKLRGDLHSNLFGKQTLDTSSLIIAVLIVQSFFEPDYG
FT                   SYVRHLSPFYGLIFECILNRTNKT"
FT   gene            complement(202127..204337)
FT                   /locus_tag="Bphy_3276"
FT   CDS_pept        complement(202127..204337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3276"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: psa:PST_2493 tyrosine-protein kinase; TIGRFAM:
FT                   capsular exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72432"
FT                   /db_xref="GOA:B2JS55"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS55"
FT                   /protein_id="ACC72432.1"
FT                   /translation="MSSETKLKRDDEIDFRNILGALIDHKRLILIITGTFVTLSVLYSI
FT                   LTAPVYEADAMLQVEHRLPTGGTMMAGMDQLLNTANAEAVTEIALITSRSVVGKAVNAL
FT                   KLYVDARPRTFPLIGSLINRHFVSSDAVSVAKPLLGLRRYGWGGEELKFDQLDVPDSLL
FT                   GENLTLEAEGGGSFIMNDSHGDIILHGKVGKPVHAGGVSVLISRLKANPGTLFDVQRNS
FT                   SLSVVERLQLDVVALEQGKDSGIVSISYQNEDPTLATRTLQEITQEYVRQNVARNSEEA
FT                   AKSLQFVRDQLPKVRGELEKAQTALKDFELSSHSVDIGLETKALLDQVVSVETNIQQVR
FT                   MQQVDAQQRFQAGQPTLRVLDDQLAQLNSKKASLKAQISNLPDTQRHLLQLTRDVEVSS
FT                   RTYTDLLTQAQQLDVARAGTVGNVRVVDVPEVDTTAPVRPRRSMIILCGLFAGLAVSML
FT                   TVYIKRTFNLGIVDPSELEAIGIAVSTSIPFSEEMKNVDEPTSANNGTRPTKPRLLALD
FT                   KPNAVAIEALRGLQTSLHFDGFNLPNKVLMVTGISQSVGKTFVACNLATVFAQSGRRVL
FT                   LVDGDMRRGIGHANFGVSAGVGLSDLLDGSRGFDEVVHKQQGHTGLDFVSRGTIPQNPT
FT                   ELLMSGKLGRFLDEVKGRYDLIIVDTPPILAVTDAAIIGNHADASLMVVRCGVSEVREV
FT                   QIATDRLRQAGIEIKGVVFNAVEPRTFGYMKYSQYKYESDSE"
FT   gene            complement(204356..204793)
FT                   /locus_tag="Bphy_3277"
FT   CDS_pept        complement(204356..204793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3277"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: pfo:Pfl_3845 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72433"
FT                   /db_xref="GOA:B2JS56"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS56"
FT                   /protein_id="ACC72433.1"
FT                   /translation="MVINDILVTCTGNICRSPTAEIILRHRLAARSISVTSAGISALVG
FT                   RPICDKAAEILAENGHSSVTHRAKQVTPTMLRQSDLILTMSHRQRNHICSMMPEVRGKV
FT                   FLLGKWDAGIEIPDPYRRDRRRYEHIYGLIEKTVESWLMHL"
FT   gene            complement(204855..206027)
FT                   /locus_tag="Bphy_3278"
FT   CDS_pept        complement(204855..206027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3278"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bvi:Bcep1808_6526 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72434"
FT                   /db_xref="GOA:B2JS57"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS57"
FT                   /protein_id="ACC72434.1"
FT                   /translation="MRVSGKIAVRRINQLLYGLLRRASLCVVVPLALTACVMAPGMQMG
FT                   SNPTLPVSVGNATTPASDVKVPIRDIDISLIEEQRIARSASVDSAVRQLVGESHKYTIG
FT                   PGDVLQITVWDHPELAAAAGQQILGSRPSDPGVGFVVDQRGNIQFPYVGKLHVADLAPD
FT                   EAQDRLLKELSKAYRDPQVTLRVASFRSKAVYVEGEVKAAGLQPLNDVPMTLLEAVNRA
FT                   GGFTADADQGNLTLLRDGILYHISLSEMLDKSINPSDIHLRAGDLLRVAARSDSGIFVM
FT                   GEVNKPAFALPMKTGRLTLGEALAQAGSINLNSADAQQMYVVRGAATNHPEVFHLNAES
FT                   PVAMTLANEFQLEPKDVVYVDGNGLVRFSRVLSLLLPSYNAGMAAAYLAR"
FT   sig_peptide     complement(205890..206027)
FT                   /locus_tag="Bphy_3278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.664 at
FT                   residue 46"
FT   gene            206229..207485
FT                   /locus_tag="Bphy_3279"
FT   CDS_pept        206229..207485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72435"
FT                   /db_xref="GOA:B2JS58"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS58"
FT                   /protein_id="ACC72435.1"
FT                   /translation="MVTPCAISNTHTGSNRTTAPHSRLTETALRAARAPSRRGVLLKKQ
FT                   KKAEKRMQIPKNRLIELDFFRGLVLLFIVVDHIGGSILSRATLHAYALCDAAEVFVFLG
FT                   GFATATAYASLAKRHTEADARNRFFKRSLELYRAFLVTAVLMLVVSAVMSAFSIDAPNM
FT                   ATTDLDDMMDTPTAVLRDILLFRRQPYLASVLPMYAFFAFAVPVILPLARSKPWLLLAG
FT                   SLAVWGIAPSILPHLPVAENAQWDFNPFAWQLMFVLGVIAQTQPVYQRTSAHRYGWLVT
FT                   ALACGIVAAAAWFKLFVEVTPLDSSLKQNLSWLRAMNFLAIAWLVANMVRLGWARTIAQ
FT                   RLPWVGLVGRKGLLCFVAGTVISLVVDSLLYTATDGYLNLPLGLLADAVAIGSLFAVAK
FT                   ASVPISRVLTPRLHGSGPA"
FT   gene            complement(207559..208644)
FT                   /locus_tag="Bphy_3280"
FT   CDS_pept        complement(207559..208644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3280"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bxe:Bxe_B1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72436"
FT                   /db_xref="GOA:B2JS59"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS59"
FT                   /protein_id="ACC72436.1"
FT                   /translation="MNQRPPDVPSEADMPNRRKMQRIASAALYAAMVVLALWVIRDFVP
FT                   AIAWACVIAIALWPAFHRIEEHKFFKGRSTLIATVLTIAIGLLFLLPVGIGIAQAASEA
FT                   HDVIEWARGVQENGIPVPDFVQHLPFGAAQIGSWWQDNLSQPLRDSPAMKGLHGGAVVT
FT                   FGRHFGARAAHALMLFAFMLVTLFVIFQAGPKLSCELMKGVRRAFGYDGMHLFERMAAA
FT                   VRGTVSGLVVVGIGEGALLLVAYMLTGVPHAALLGFVTAIAAMLPFCAPVVFCGAALWI
FT                   FVEQGALIPAIGLAVFGFVVVFVAEHFVRPVLIGSSARLPFLLVLFGILGGAETFGLLG
FT                   LFVGPALMTVLMVLWTEWIER"
FT   gene            209021..209308
FT                   /locus_tag="Bphy_3281"
FT   CDS_pept        209021..209308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72437"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS60"
FT                   /protein_id="ACC72437.1"
FT                   /translation="MTTLDCLPLIGANGLRIEILEHSDTTLVIRWVEPGRCHYGEQRWR
FT                   RRSAHTSGTCAVSRRKIRRGDAVFKPAERPAPANASAMIAAEVLEHALAA"
FT   gene            complement(209356..210291)
FT                   /locus_tag="Bphy_3282"
FT   CDS_pept        complement(209356..210291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3282"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0824 putative lipase (esterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72438"
FT                   /db_xref="GOA:B2JS61"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS61"
FT                   /protein_id="ACC72438.1"
FT                   /translation="MLEPEIVEFVERTKRLYPADRSASTPAEQRAMYERLAAAFTPPLP
FT                   DGVTTQDALFMPPASGQSFMLRLYVPTDRARASGTVLYFHGGGFVVGSLASHELITARI
FT                   AADTGLCVVAVDYRLAPEHPAPAAHDDCLAVTRAALDGSLPFSALPRSLQLAGDSAGGT
FT                   LAASVALRLRDEGVPGVRGLALVYPMLGIEPQLPARDTEADAPMLTLADVRRYGELYWR
FT                   GRPVDTWTVPLEASRYDGLPPTLAIGVEHDPLRDDARVFAERIVAARGRVDAPIGRGLV
FT                   HGAWRALATSPGVQWMHREVCRFLSAHAAD"
FT   gene            complement(210346..210837)
FT                   /locus_tag="Bphy_3283"
FT   CDS_pept        complement(210346..210837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72439"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS62"
FT                   /protein_id="ACC72439.1"
FT                   /translation="MPRHAQLPVYHDVVRAEWVDYNGHLRDAFYMLIFSFATDALIDQI
FT                   GLDDAVRKARGRSIYTLEAHINYLHEIKEGTKVRTEMRVLAHDAKRMHLYLEMFAGDGE
FT                   EPVAAGEQMLLHVDTSGPRSAAFDADVEARVRALVDAQATLPAARYAGRVIGLPGQTRQ
FT                   "
FT   gene            complement(210924..211889)
FT                   /locus_tag="Bphy_3284"
FT   CDS_pept        complement(210924..211889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3284"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_B0826 putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72440"
FT                   /db_xref="GOA:B2JS63"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS63"
FT                   /protein_id="ACC72440.1"
FT                   /translation="MAVITDIKTFAAIGAGVIGSGWVARALAHGLDVVAWDPAPGAEKQ
FT                   LRDNVANAWPALERVGLAPGASQARLRFVKTIEECVAQADFIQESAPEREELKLALHDQ
FT                   ISRAAKPNAIIASSTSGLLPTDFYARALHPERCIVGHPFNPVYLLPLVEVLGGERTAAS
FT                   TVDAAMQIYRTLGMRPLHVRKEVPGFIADRLLEALWREALHLVDEGVATTGEIDDAIRF
FT                   GAGIRWSFMGTFLTYTLAGGDAGMRHFMQQFGPALELPWTKLVAPKLTDKLIDRVVDGT
FT                   AEQVGPRSIKQLERYRDECITNVLSVIAETKARHGLRADE"
FT   sig_peptide     complement(211803..211889)
FT                   /locus_tag="Bphy_3284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.873 at
FT                   residue 29"
FT   gene            complement(211939..212868)
FT                   /locus_tag="Bphy_3285"
FT   CDS_pept        complement(211939..212868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3285"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bch:Bcen2424_5051 protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72441"
FT                   /db_xref="GOA:B2JS64"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS64"
FT                   /protein_id="ACC72441.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVAKHPAIPVTPKQIADAAIEAAKAGATV
FT                   AHCHVRDPRTGRGSRDPNLYREVVDRIRSADTDVIINLTAGMGGDLEIGPGEDPMRFGA
FT                   NTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYVYVSTPAQLRAGAKRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDAPPLFQLCLGIPWGAPADTATMKAMVDNLPPGAHWA
FT                   GFGIGRMQMPMLAQAMLLGGHVRVGLEDNIWLDKGVPASNGSLVARAVEIIERLGGRAL
FT                   TPAEGRKKLGLPARGERPLEKRAVEQLA"
FT   gene            complement(212955..213905)
FT                   /locus_tag="Bphy_3286"
FT   CDS_pept        complement(212955..213905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3286"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bxe:Bxe_B0828 ABC
FT                   glycine betaine transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72442"
FT                   /db_xref="GOA:B2JS65"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS65"
FT                   /protein_id="ACC72442.1"
FT                   /translation="MKWINQAVSACLASLLAALSLPALAQDPPTCRAVHFADIGWTDIT
FT                   STTALASTVFEGLGYQPVTTVASVPISFAGLKSKQLDVSLGYWWPVQEKAIAPFVEAKS
FT                   INVLQPPNLTGAKATFAVPTYEYDAGLKTFADIAKHRAELDGKIYGIEPGSSANAAIQK
FT                   MIATNQFGLGGFKLIESSEAGMLVTVDRAVREKKWVVFLGWQPHPMNIQIDMKYLSGSE
FT                   GVFGPNDGEARVYTLTSPDFLTRCPNAGKLVSNLRFTTQLENVVMQSVMNKEKPSEAAK
FT                   AYLKKNPQVLDEWLAGVKTYDGKDGLPAVKAYLGL"
FT   sig_peptide     complement(213828..213905)
FT                   /locus_tag="Bphy_3286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            214220..215215
FT                   /locus_tag="Bphy_3287"
FT   CDS_pept        214220..215215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3287"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B0829
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72443"
FT                   /db_xref="GOA:B2JS66"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS66"
FT                   /protein_id="ACC72443.1"
FT                   /translation="MPEDISFLLLPGFSAIGFMSAIEPLRVANRFREDLYRWHILSVDG
FT                   APVSASNGISLNAEAAFGDVHHASTVFVVAGFEPLACYSRALADWLKRMDRAQATLGGI
FT                   DTGAFILAEAGLVRATDSVTLHWEALAAFRERYPSMQASDELFEIGERRITCAGGTASI
FT                   DMMLDLISRNHGAALASAISEQFVVSRIRQRSDHQRMEIAARYGVHNRKLIQVIGVMEQ
FT                   NMEEPLAPADLAQEIGVTRRQLERLFCSSLKDTPTHFYLQLRLDRARELLRQTDMSITA
FT                   ICVACGFESPSHFSRTYRARFGTSPRSDRSPPHHGAGGRTTHSTREAAIP"
FT   gene            complement(215287..216429)
FT                   /locus_tag="Bphy_3288"
FT   CDS_pept        complement(215287..216429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3288"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bte:BTH_II1853
FT                   outer membrane porin OpcP"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72444"
FT                   /db_xref="GOA:B2JS67"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS67"
FT                   /protein_id="ACC72444.1"
FT                   /translation="MKKLNAAALTGVALALAGVSNASHAQSSVTLYGILDAGITWVNNT
FT                   GGSHVVKFDDGISYGNRFGIKGTEDLGGGLEAVFVLESGFHLGNGQLGFGSTLFGRQAY
FT                   VGLKNQWGTLSFGNQLDMTEEMVYLYNVSAWASGYAIHQGDFDRFNGDRLPNSVKFLSN
FT                   EFAGFMFGGMYSFGNVAGDFHQDSAWSVGAHYANGPFTAGAAYTQLNNPHGIYAFDPYA
FT                   MLGVHTFLGQQTVTVDPATGARTDLFSSNPFPVDKQGTFGIGSSYAIGDVTLMGNFTYT
FT                   TIKGLGVTSHMKVGEGGASWQVTPAFSVIGGYQYTNFEGHHWNQGSLGAHYLLSKRTDV
FT                   YISGDYLKASSGVDAVIGYSFTPSTTTTQADVRIGMRHSF"
FT   sig_peptide     complement(216352..216429)
FT                   /locus_tag="Bphy_3288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 26"
FT   gene            complement(216671..217636)
FT                   /locus_tag="Bphy_3289"
FT   CDS_pept        complement(216671..217636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3289"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bxe:Bxe_B1572 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72445"
FT                   /db_xref="GOA:B2JS68"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS68"
FT                   /protein_id="ACC72445.1"
FT                   /translation="MNTRWRSSLAKAALIFSAFGMAVTGSSHAAEPQSCTQVRMADPGW
FT                   TDIDATNAVAGVLLKALGYQQNVSNLSVPITYQGLKKGQIDVFLGNWMPAQGPLVKPFV
FT                   DEHSIDVLHANLTNAKFTLAVPDYVAAAGVHSFADLVKHADQFNGKIYGIEPGAPANQN
FT                   IKKMIADKAFGLGDWKVVESSETGMLTQVERAVRDKQWIVFLAWEPHLMNTKFHLTYLS
FT                   GGDAYFGPNYGGATVNTVTRPGFAGQCTNLAKLFQQMTFNVDMENQIIANVLQNKVDIN
FT                   TAALTALKGNPALLNTWLKGVTTTNGADGLQAVQTQLGIH"
FT   sig_peptide     complement(217547..217636)
FT                   /locus_tag="Bphy_3289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(217678..219219)
FT                   /locus_tag="Bphy_3290"
FT   CDS_pept        complement(217678..219219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3290"
FT                   /product="choline-sulfatase"
FT                   /note="TIGRFAM: choline-sulfatase; PFAM: sulfatase; KEGG:
FT                   bpd:BURPS668_A0841 sulfatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72446"
FT                   /db_xref="GOA:B2JS69"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS69"
FT                   /protein_id="ACC72446.1"
FT                   /translation="MSLNTKQNILILMADQMTPFALRAYGNQVSLTPRIDALAKEGVVF
FT                   DSAYCASPLCAPARFSMMAGKRPAAIGAYDNAAELPAQTLTFAHYLRAAGYRTILSGKM
FT                   HFCGPDQLHGFEERLTTDIYPADFGWVPDWDRPDVRPSWYHNMSSVLDAGPCVRTNQLD
FT                   FDDEVTYTTRQKLYDIVRERAAGGDARPFCVVASLTHPHDPYAIPQQYWDMYRDEEIDM
FT                   PCVTLTRDESDPHSKRLRDVYEADLTPPTAQQIRDARHAYYGALSYVDAQFGAILDTLK
FT                   ATGLADDTIVIVTSDHGEMLGERGLWYKMTCFEGGVRVPLIVHAPKQFRAHRVAASVSH
FT                   VDLLPTLLEMATGARRAEWPDTIDGRSLVPHLRNDGGHDEAIVEYFAEGAIAPMVMIRR
FT                   GQYKFIHTPVDPDQLYDLASDPRERANLAQDPAAATLVEAFRKEVTQRWDIPALHQAVL
FT                   ASQRRRRFHFEATTQGAIRSWDWQPFNDASQRYMRNHIELDTLEAMARYPRVVSR"
FT   gene            219364..220290
FT                   /locus_tag="Bphy_3291"
FT   CDS_pept        219364..220290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3291"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II1856 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72447"
FT                   /db_xref="GOA:B2JS70"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS70"
FT                   /protein_id="ACC72447.1"
FT                   /translation="MSGPDRLPPMQTLSAFESAARLASFTAAARELGSTQPAVSQRIVQ
FT                   LEEDLGAPLFERGHRGVTLTPEGALLYEAVRSGLDTIRVATSDIRARRATGALTILTDA
FT                   GFATYWLMPRLARLKASMPGVNVKIVTSQLGYDPHRDHADIAIAFGDGHWPPCTSTRLF
FT                   AEAVTAVCSPAFRHLHPAVHTAADLAELPLLHVQPTEPERWLAWNSWFAAHGLAAPGES
FT                   QGMMFNSYSLVVQAALMGQGVALGWTPLTDELVATGQLVRLLDTPVTTERGYYLVCPPA
FT                   RPAPAAVPLFRRWLFNELVDVSEHAHA"
FT   gene            220438..221316
FT                   /locus_tag="Bphy_3292"
FT   CDS_pept        220438..221316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3292"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; KEGG: bxe:Bxe_B1575
FT                   formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72448"
FT                   /db_xref="GOA:B2JS71"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS71"
FT                   /protein_id="ACC72448.1"
FT                   /translation="MPATDRHPQFALTLSCPSAAGQVAAIVGFLDRHHCYIDELTVFDD
FT                   DISERFFVRCVFHGVGSAPDAALHIDTLRHEFRPIAADFDMTWAMHDLEMRPKVLIMVS
FT                   KLEHCLADLLFRWRMGELKMDIAGIASNHPDFQPLAAQHGLPFHHFPLTPDTKAQQEAQ
FT                   ILDLFDKSGAELMILARYMQILSDETSRKLSGRAINIHHSFLPGFKGARPYHQAHARGV
FT                   KLIGATAHFVTDDLDEGPIIEQEVQRVDHSYGPERMLAVGRDVECITLARAVKAFVERR
FT                   VFINGDRTVVL"
FT   gene            complement(221371..223038)
FT                   /locus_tag="Bphy_3293"
FT   CDS_pept        complement(221371..223038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3293"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bam:Bamb_4487 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72449"
FT                   /db_xref="GOA:B2JS72"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS72"
FT                   /protein_id="ACC72449.1"
FT                   /translation="MDQSGLRTRSIEGASKGTNEGAAHEGHALQRGLTWKDAFWVTSGV
FT                   PGGVLFTIGGVSATIGQPAWSIWVAAILMGLIQSATYAEISGLFPHKSGGASVYGAMAW
FT                   VRYSKTIAPVSVWCNWLAWSPMLALGTGLAANYALSSLYAPDAAINTWRLTLLDLGFIK
FT                   QGLSLRINATFIIAAIFLLITFKLQHSGASKAARTQRILGIASLAPLLIVGIVPFVTGD
FT                   VPAAHLWPLLPLGHDAQGNVTAATFGSWNGAGITMAFGAMFMAGWAAYGFETAVCYTRE
FT                   FRNPRTDTAKAIFWSGMACLLVMTLVPLAFQGVLGTKGMLDPKIADGTGVAAAMAHMVG
FT                   GGAIVFDVVVVMLILTILLIVMTSMMGSSRTLYQASVDGWLPKYLSHVNEHGAPTRAMW
FT                   TDLGFNLVLLLMSDYMTVLSISNVCYMIFVFLNLQSGWIHRLDRADADRPFRCPTWLLA
FT                   AGALCGYLDLAFIGAGADMQGVGTMRNGLIAMLLIVPVFMFRHYWQDRGRFPARMQQDM
FT                   EWKGGARPAGLRGVLPYGALLFAVFVVWFSHHLAKPFL"
FT   gene            complement(223175..224038)
FT                   /locus_tag="Bphy_3294"
FT   CDS_pept        complement(223175..224038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3294"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bch:Bcen2424_5076
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72450"
FT                   /db_xref="GOA:B2JS73"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS73"
FT                   /protein_id="ACC72450.1"
FT                   /translation="MKHLKKLMLCGALIATMTAIGTAAADTKPTIKIGYVEGWDDSVAT
FT                   SNVAAQIIEKRLGYPVQLVPVAAGIMWQGVARGDLDATLSAWLPVTHGAYWDQFKGKVQ
FT                   DLGANYTDAKIGLIVPADVPEKSISDLQAHKADFSGRIVGIDAGAGVMKKTSEAIKAYN
FT                   LDYQLMPSSGSAMTAELARSMNANKPVIVTGWVPHWMFAKWKLKFLEDPKKVYGESEHV
FT                   DSVVNPGLDAKAPQVVAFLKKFQWKPGEIDSVMLATENGAKPADAAGSWIAAHGDRVNS
FT                   WVGGAQ"
FT   sig_peptide     complement(223961..224038)
FT                   /locus_tag="Bphy_3294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 26"
FT   gene            complement(224237..225394)
FT                   /locus_tag="Bphy_3295"
FT   CDS_pept        complement(224237..225394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3295"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bam:Bamb_4489 oxidoreductase FAD-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72451"
FT                   /db_xref="GOA:B2JS74"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS74"
FT                   /protein_id="ACC72451.1"
FT                   /translation="MMRDGAPFEPVESRVTKPEFWSALPARWTSDVEETLVCCQVRQET
FT                   HDVKSFFFRSPEGRAFVFEPGQFITLELDIEGETINRCYTISSPPTRPHTISITVKRVP
FT                   GGKVSNWLHDNLQAGARVRVLGPAGEFTCARHPARKYLFLSAGSGITPLMSMSRAHHEL
FT                   SEDRDIVFVHSARTPDDIIFPRELDLIASNQANFRTSFVCERVGARTSWPGITGFLTLP
FT                   LLKLIAPDFMEREVFTCGPAPYMKAVRDLLDEAGFDRKQYHEESFSFETLIEAEPQVAA
FT                   EVLEAEQKSHADGANGAQTFSVSFARSNRSIECGSTQHVLDAARQAGVRLPASCTQGMC
FT                   GTCKVKLVSGQVDMKHNGGIRQREIDQGMVLLCCSKPLSDLVVDK"
FT   gene            complement(225447..226727)
FT                   /locus_tag="Bphy_3296"
FT   CDS_pept        complement(225447..226727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3296"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   reu:Reut_B4815 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72452"
FT                   /db_xref="GOA:B2JS75"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS75"
FT                   /protein_id="ACC72452.1"
FT                   /translation="MKVSADIQALVDRRKQGYSLEAPFYLSEEIFRLDMDAIFRQHWIQ
FT                   VAVEPDVPEPGDYVTVELGSDSILIVRDDDMQVRAFHNVCRHRGARLCNEDKGTVGNIV
FT                   CPYHSWTYNLSGDLMFAEHMGEQFDRCKHSLKSVHVENLAGLIFVCLAENPPVDFAVMR
FT                   AAMEPYLLPHDLPNCKIAAQIDIIEKGNWKLTMENNRECYHCVANHPELTISLYEYGFG
FT                   YQRSPANAEGMDAFERTCIERARQWEEMNLPSVEIDRLSDVTGFRTQRLPLDRSGESQT
FT                   LDAKVASKKLLGEFRQADLGGLSFWTQPNSWHHFMSDHIVTFSVIPLSAGETLVRTKWL
FT                   VHKDAQEGVDYDVSNLTAVWNATNDQDRALVEYSQRGASSSAYEPGPYSPFTEGLVEKF
FT                   SDWYVRRLASHIDSSASEPRTINIKAV"
FT   gene            complement(226769..227548)
FT                   /locus_tag="Bphy_3297"
FT   CDS_pept        complement(226769..227548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3297"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="KEGG: bch:Bcen2424_5079 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72453"
FT                   /db_xref="GOA:B2JS76"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS76"
FT                   /protein_id="ACC72453.1"
FT                   /translation="MNGKLEKIAVLVSVGKHPVSGVARYSRNDAAALEIGRQLSTQHAA
FT                   RLDVLHAGDPGNPALEDYLALGAEHVEVLTCGVNDDAVTLLAARLKGYDLVLTGTCAEG
FT                   AFDSGMLPYRLADALSVPLAGTAVDVTVAGGRATVRQFLPKGVRRRVEVALPAVVAVHP
FT                   LAGVTPRYAYARLRAGSIRPQHTEAVADAEAAQWQVAPVTRKPVRLAAAEKRSGHARML
FT                   SATTTESRGGSVVNEGTSVEKAQVILAYLREHQLIDY"
FT   gene            complement(227545..228723)
FT                   /locus_tag="Bphy_3298"
FT   CDS_pept        complement(227545..228723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3298"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: bam:Bamb_4492 electron transfer
FT                   flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72454"
FT                   /db_xref="GOA:B2JS77"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS77"
FT                   /protein_id="ACC72454.1"
FT                   /translation="MNTTIKRIDPRRPFVITAAGLKRITLGAEHVAGASYDHALQAGAH
FT                   GHAAAKTLRTTQAPQRTLLVVAHSDRGALDDHTRQALAAAALIADATTQVALLVLGELK
FT                   DDAAALGADKVIELPSFDRRTFAPEREVQAVAACVAQLAPAHIFMPDNATGDGDLGRRY
FT                   AALAGASIATHVVQIDGKGVSTYAQAKKAYATRALPDVILLAAGAVDTRLPFVGAGERL
FT                   DVPALAQTADASTGGYRDLGIEEIDAAQVALEEADFIVSAGNGVTDVAAFEKLASTFGA
FT                   AIGASRVAVDNGMFTRDKQIGATGKTVEASVYIAFGISGAVQHLQGIKDCRHVIAVNLD
FT                   GSAPIVKRANLTIIGDTQATIASLIDEIDRARSGRGGAAAPVANRIVEGVAA"
FT   gene            complement(228727..230646)
FT                   /locus_tag="Bphy_3299"
FT   CDS_pept        complement(228727..230646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3299"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: bte:BTH_II1864 iron-sulfur
FT                   cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72455"
FT                   /db_xref="GOA:B2JS78"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS78"
FT                   /protein_id="ACC72455.1"
FT                   /translation="MSPAFLITALLWVSVAGLAFAVAKRAAYWRLGRATAAGAFGWTNL
FT                   LTIPKRYFVDLHHVVARDPYIAKTHVATAGGAIAAFALVFINYGLAIYSPWLDRLIFLA
FT                   ALIMLVGAVFVWRRRHAKDVPARLSRGPWNTLPWLLGSFALGLLLYTLLPASAMSGGLA
FT                   ILFAVLIGVGAFTMTFGAARGGPMKHALAGLLHLAFHPRQERFAAQGDVRKEQAIPPTA
FT                   LKAPVLEQNEYGVGKPVEFRWNQLLSFDACVQCGKCEAACPAFAAGQPLNPKKLIQDLV
FT                   TGMVGGNDAAYAGSPTPGIKVGQHGGEPQRPIISSLIEADTVWSCTTCRACVHECPMLI
FT                   EHVDAIVDMRRNQTLVHGTVPGKGPEVLANLRETGTMGGYDKAARYDWSVDLSSPVAQP
FT                   GQAVDVLLVAGEGAFDMRYQRTLRSLVKVLNKAGVKYAVLGSQETDTGDVARRLGDEAT
FT                   FQRMAKQMMGTLSALNFKRIVTADPHVMHSLRNEYRALGGRYEVLHHTTFLAELVASGK
FT                   LSPKAVAAFNDKKITYHDPCYLGRYNGETEAPRQLLKTIGIKVVEMERHGKRGRCCGGG
FT                   GGAPLTDIPGKQRIPDIRINDARSIGADVVAVGCPNCTAMLEGVVGPRPEVLDVAELVA
FT                   AALE"
FT   sig_peptide     complement(230581..230646)
FT                   /locus_tag="Bphy_3299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.935 at
FT                   residue 22"
FT   gene            complement(230649..232712)
FT                   /locus_tag="Bphy_3300"
FT   CDS_pept        complement(230649..232712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3300"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B1582 NADH-flavin
FT                   oxidoreductase / NADH oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72456"
FT                   /db_xref="GOA:B2JS79"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS79"
FT                   /protein_id="ACC72456.1"
FT                   /translation="MRYPNLFKPLTLNQLTLRNRIVSTAHAEVYAEPGGLPGDRYIRYY
FT                   EEKAKGGVGLAVCGGSSPVSIDSPQGWWKSVNLSTDKIIDPLSRLAEAMHRHGAKIMIQ
FT                   ATHMGRRSAFHGEHWPHLMTPSGVREPVHRGNAKIIEVEEIRRIIGDFAAAAKRVKDAG
FT                   MDGIEISAAHQHLIDQFWSPRTNFRTDEWGGSLQNRLRFGVEVLQAVREAVGKDFCVGL
FT                   RMCGDEFHEDGLDHTQLKEIAQAMAETGLIDYIGVIGSGADTHNTLANCMPPMALPPEP
FT                   FVHLAAGIKSVVKLPIMHAQSIRDAGQAERLLANGMVDLVGMTRAQIADPHMVIKIRDG
FT                   REDEIKQCVGANYCIDRQYNGLDVLCVQNAATSREATMPHVIEKTRGPRRKVVVVGAGP
FT                   AGLEAARVARSRGHDVVLFEKGDAVGGQIMLAAKAPQREQMAGIVRWFDMETKRLGVDR
FT                   RMGVEADEKMILAEKPDIIVLATGGSAFTQQVPAWGVAEGLAVSSWDILSGKVEPGQNV
FT                   LVYDGVSTHAGAGVADFISSRGSKVEIVTPDVKVADDVGGTTFPIFYRRLYAQGVIHTP
FT                   NYWLDRVYEEDGKKIAVIRNEYTEEREERAVDQVVIENGSTPNDGLYWKLKNESVNRGQ
FT                   VDVHKLFASEPQPSLSEELGNGRFLLFRVGDCISMHNIHGAIYDALRLCKDF"
FT   gene            complement(232766..233299)
FT                   /locus_tag="Bphy_3301"
FT   CDS_pept        complement(232766..233299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3301"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="PFAM: 4-vinyl reductase 4VR; KEGG:
FT                   bur:Bcep18194_B0573 4-vinyl reductase, 4VR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72457"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS80"
FT                   /protein_id="ACC72457.1"
FT                   /translation="MQPQLPIDVDPNTGVWTTDALPMLYVPRHFFTNNHTAVEEALGLE
FT                   AYAEILYKAGYKSAYHWCDKEAKQHGLSGMAVFEHYLNRLSQRGWGLFKIVEADPSTAR
FT                   AKIQLQHSSFVLAQPGKEGKLCYMFAGWFAGAMDWVNDTTDGGKSAPRAQSKEVQCAAE
FT                   HHDHCVFEVSPIAH"
FT   gene            complement(233333..234304)
FT                   /locus_tag="Bphy_3302"
FT   CDS_pept        complement(233333..234304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3302"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   bxe:Bxe_B1584 membrane dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72458"
FT                   /db_xref="GOA:B2JS81"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS81"
FT                   /protein_id="ACC72458.1"
FT                   /translation="MSNLHDSSIIIDGLNISKFERSVFEDMRKGGVTAVNCTVSVWEDF
FT                   QKTIDNIAEMKQQIREHSEILTLVRTTDDILRAKKENKTGIIFGFQNSYAFEDNLGYIE
FT                   VFKELGVNVVQLCYNTQNLVGTGCYEADGGLSGYGREVIQEMNRVGILVDLSHVGAKTS
FT                   SDAIACSKKPVTYSHCCPSGLKDHPRNKTDEQLREIADANGFVGVTMFSPFLKKGPDAT
FT                   VDDYLEAIEYVIDVIGEDKVGIGTDFTQGYSTEFFDWITHDKGRYRRLTNFGKVVNPEG
FT                   IRTIGEFPNLTAAMERAGWGESRIKKVMGENWMRFFGEVWNV"
FT   gene            complement(234348..235622)
FT                   /locus_tag="Bphy_3303"
FT   CDS_pept        complement(234348..235622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3303"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   bam:Bamb_4497 glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72459"
FT                   /db_xref="GOA:B2JS82"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS82"
FT                   /protein_id="ACC72459.1"
FT                   /translation="MSNANPFFSQSLAERDAAVRKSVLKELERQQSQVELIASENIVSR
FT                   AVLEAQGSVLTNKYAEGYPGKRYYGGCEFVDEVEALAIERIKKLFNAGFANVQPHSGAQ
FT                   ANGSVMLALAKPGDTILGMSLDAGGHLTHGAKPALSGKWFNAVQYGVNRETMRVDYDQI
FT                   EKLAHEHKPSMLIAGFSAYPRELDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPV
FT                   EHAHVVTSTTHKTLRGPRGGFVLTNDEEVAKKINSAVFPGLQGGPLMHVIAGKAVAFGE
FT                   ALEDSFKTYIDNVLANAQALGEVLKEGGVDLVTGGTDNHLLLVDLRPKGLKGTQVEQAL
FT                   ERAGITCNKNGIPFDTEKPTVTSGIRLGTPAGTTRGFGVAEFRDVGRMILEVFDALRSH
FT                   PDGDAATEQRVRREIFALCERFPIY"
FT   gene            236125..237141
FT                   /locus_tag="Bphy_3304"
FT   CDS_pept        236125..237141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3304"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bvi:Bcep1808_3424 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72460"
FT                   /db_xref="GOA:B2JS83"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS83"
FT                   /protein_id="ACC72460.1"
FT                   /translation="MSPDRTASLSHFAFMPLPNFTMIAFTNAIEVLRMANYLSGQPLYR
FT                   WSIISPGGGSVTASNGLSVDTGPAECVGTPDIVFVCGGIDVQRETTPEHLSTLRRFARA
FT                   GVALGSLCTGTYALAKSGLLAGYACAIHWENMSALKEEFPDTRFLKELFVIDRDRVTCT
FT                   GGVAPLDMMLNLIAARVGTPRVTQIAEQFIVEHVRDTSAQQRMPLVARLGSANKSLFEV
FT                   IALMENNIEEPLSREELARLANMSQRQLQRLFREHLGMTPTHYYLTLRLRRARELLLQT
FT                   DMSIMHITMACGFQSACHFSKSYRDAFGTAPTRERRKQVAPLAHPVMGVLAGSPLHA"
FT   gene            237827..240382
FT                   /locus_tag="Bphy_3305"
FT   CDS_pept        237827..240382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3305"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; KEGG: bxe:Bxe_B1704 putative ribonucleotide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72461"
FT                   /db_xref="GOA:B2JS84"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS84"
FT                   /protein_id="ACC72461.1"
FT                   /translation="MRDLMADTDNDLSQLNSTTIAPQQFSLDVLMEKYAKGDERTADDV
FT                   YRRVARGVALAEPEALRPAIEARFVENLQNGALGAGRIMSAAGAGIQATLINCFVQPVG
FT                   DSIQGVDDQGLPGIYVALLQAAETMRRGGGVGYNFSAIRPRGARVKTTGSSASGPCSYI
FT                   DVFDASCRTVESAGSRRGAQMAVLDCTHPDLLEFIDAKHSKGRWNNFNVSVAVTDEFMQ
FT                   AVENDAMWQLVHRAEPTPALRAANDVRQRDDGMWVYSERRAKEIFDRIMRSTYDIAEPG
FT                   IVFISRMNDDNNLRAVESIRATNPCGEQPLPPYGCCNLGPLNLTRFVLDPFAQRHGGKP
FT                   SFDWDALAQRTRTQVRFLDDVLDVTLWPLEQQYDESRAKRRIGVGFTGLGDTLVMMGLR
FT                   YNSQEGRDFAVRIAKLMRDEAYRASVELARERGAFPLFNAKQYLQDGTFASRLPDDVKE
FT                   AIRTHGIRNSHLLSIAPTGTVSLAFADNASNGIEPAFSWTYTRTKVMANGSREQFAVED
FT                   HAYRLYRELGGDVGHLPDYFVSALEMSARDHLDMMAAVQPYIDTSISKTVNVPADYPFD
FT                   AFENLYFDAWKGGLKGLATYRPNETLGAVLSVTPQAAPTADDALAEVDLDPLRIAIDHR
FT                   PKGQLPAIIEKVEYLTAAGKKSLYLAVSFIEVTGRVGGEEVTIERPIEFFIPAGQRDES
FT                   QQWITATMRSLSLAARGGFVARNLQDLRKVSWDRGQVRLGDVQRLDGHRSPRWHDSEVA
FT                   ALAYALQQILHRRGFLDAEGNQVPSRLLARAPRDDANLNASSADNALSIAEGSAEEARS
FT                   AQELRTMHGRKCGHCGANAVIRKDGCDFCTACGEIGACG"
FT   gene            240484..241029
FT                   /locus_tag="Bphy_3306"
FT   CDS_pept        240484..241029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72462"
FT                   /db_xref="GOA:B2JS85"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS85"
FT                   /protein_id="ACC72462.1"
FT                   /translation="MAGRVIDYIAGRIGLIARRNPVLWVAGALLLLHGAMSFARRPFHA
FT                   PAQRHDSALILFYSYPVAASPAYAPFHHVRRYAVQTTMQWSAVAYGLPDSHNIAQGRQR
FT                   FRHGSAPGNPYLAPLEGAQAAQSSALPSYGFGLPSDAQSVPPTAASNNDDWSFRANPLL
FT                   NLNHAHERGATFSIRHDF"
FT   gene            complement(241177..242376)
FT                   /locus_tag="Bphy_3307"
FT   CDS_pept        complement(241177..242376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3307"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-independent"
FT                   /note="TIGRFAM: formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KEGG: bxe:Bxe_B1589 glutathione-independent
FT                   formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72463"
FT                   /db_xref="GOA:B2JS86"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS86"
FT                   /protein_id="ACC72463.1"
FT                   /translation="MSSNRGVVYLGQGKVEVRPIDYPKMVDPRGRAIGHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAEIGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGRCQTC
FT                   KEQHTGVCLNVNPSRAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMEKIR
FT                   DLTCLSDILPTGYHGAVMAGVKPGSTVYIAGAGPVGMAAAASARILGAACTIIGDMNEE
FT                   RLAHARAVGFETVNLSKDATLGEQIAQILGKPEVDCAVDCVGFEAHGHGSSGAREEAPA
FT                   TVLNSLMDITKPAGAIGIPGLYVTDDPGAVDSAAKKGSLSIRFGLGWAKSHSFHTGQTP
FT                   VMKYNRNLMQAILWDRLPIADIVNVTVISLDSAPDGYRQFDGGAPRKFVLDPHGLLKAA
FT                   "
FT   gene            242573..243163
FT                   /locus_tag="Bphy_3308"
FT   CDS_pept        242573..243163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3308"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="TIGRFAM: transcriptional repressor BetI; PFAM:
FT                   regulatory protein TetR; KEGG: bxe:Bxe_B1590
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72464"
FT                   /db_xref="GOA:B2JS87"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JS87"
FT                   /protein_id="ACC72464.1"
FT                   /translation="MPKVGMREVRRAQLIDATLLTIDQSGLSGTTLASVAQRANISTGI
FT                   VSHYFGDKDGLLEATMRHILRDLWAATTRRRIAAKAQPRARLRAIVAANFDVSQVSGPV
FT                   MKTWLAFWSESMHEPALRRLQHVNTRRLYSNLCAEFAKELPRACARRAASGLAAMIDGL
FT                   WLRGALSGDPFDTKAALRLANDYIDLLLAQSAA"
FT   gene            243216..244685
FT                   /locus_tag="Bphy_3309"
FT   CDS_pept        243216..244685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3309"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: bte:BTH_II1073 betaine
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72465"
FT                   /db_xref="GOA:B2JS88"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JS88"
FT                   /protein_id="ACC72465.1"
FT                   /translation="MSAYGLQRLYIGGDYVDATSGVTFDTFDPATGELLATVQQASEAD
FT                   IERAVQSAREGQRAWAAMTAMQRSRILRRAVDLLRERNDELAELEMRDTGKPIAETRAV
FT                   DIVTGADVIEYYAGLATAIEGQQIPLRAESFVYTRREPLGVTAGIGAWNYPIQIACWKS
FT                   APALAAGNAMIFKPSEVTPLSASKLAEIYLEAGVPAGVFNVVQGDGRVGAMLSAHPGIA
FT                   KISFTGGVETGKKVMSMAGGSSLKEVTMELGGKSPLVVFEDADLDRAADIAVTANFFSA
FT                   GQVCTNGTRVFVHQSVQPAFEARVIERVKRIRVGKPSDPSTNFGPLASAAQLDKVLGFI
FT                   ESGKREGARLVAGGARIVEGDYARGQYVQPTVFSDCRDDMKIVREEIFGPVMSILSFVD
FT                   EDDVIERANDTIYGLAAGVVTENLARAHRAIHRLEAGICWINTWGESPAEMPVGGYKQS
FT                   GVGRENGITTLEHYTRIKSVQVELGKYQPVF"
FT   gene            244697..246415
FT                   /locus_tag="Bphy_3310"
FT   CDS_pept        244697..246415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3310"
FT                   /product="choline dehydrogenase"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bte:BTH_II1072 choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72466"
FT                   /db_xref="GOA:B2JS89"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JS89"
FT                   /protein_id="ACC72466.1"
FT                   /translation="MAAKEYDYIIIGAGSAGNVLATRLTEDRDVTVLLLEAGGPDYRFD
FT                   FRTQMPAALAYPLQGRRYNWAYETDPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNA
FT                   LDYDGWAERKGLENWTYLDCLPYFRKAETRDAGANDYHGGDGPVHVTTSKRGVNPLFEA
FT                   MVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTANGRRASTARGYLDQARPRPNLTIVTY
FT                   ATTDRILFSGKRAQGVVYLDGQAQITAHARREVLLCSGAIASPQILQRSGVGPGGWLRD
FT                   LDIPVVLDLPGVGQNLQDHLEMYMQYECKEPVSLYPALLLRNQPAIGIEWMLKGTGIGA
FT                   SNHFEAGGFIRTRDDDPWPNIQYHFLPVAINYNGTNAIKMHGFQAHVGSMRSPSRGRVK
FT                   LRSRDPREHPSILFNYMAEALDWREFRDAIRITREIIAQPALDRFRGRELSPGAELQSD
FT                   AQIDAFVRARAETAYHPSCSCAMGYDDMAVVDGEGRVHGLEGLRVVDASIMPRITTGNL
FT                   NAPTIMLAEKIADRIRGRAPLARSTAPYYVANGAPARGAKHVEHAPAPSVAAHTH"
FT   gene            246561..247985
FT                   /locus_tag="Bphy_3311"
FT   CDS_pept        246561..247985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3311"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bpd:BURPS668_A1931
FT                   permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72467"
FT                   /db_xref="GOA:B2JS90"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS90"
FT                   /protein_id="ACC72467.1"
FT                   /translation="MPTTASAKRASAAARLERLPFSGYHRTIFIIIAIAFFFDSVDLGT
FT                   MTFVLGSIKTEFGLSSATAGLVASASFFGMVLGAAVAGLFADRFGRRPVFQWSMVLWGV
FT                   ASYLCSTAQSVDALIVYRVLLGIGMGMEFPIAQTLLSEFVPTASRGRLVALMDGFWPLG
FT                   FITAGCVSYFVLPHFGWRTVFALLAIPAVFVLIVRRIVPESPRWLEHRGRLAQADAVLD
FT                   TVEAKVMKSKGLRSLPAASLLAEPAAPSQHGALREIWSAAYRQRTVMVWALWFFALLGF
FT                   YGLTSWLGALMQQAGFAVTKSVLYTVLISLGGVPGFLCAAWLVERWGRKPTCIASLVGG
FT                   GVMAYAYGQTALHADSVTLLICTGLAMQFFLFGMWAVLYTYTPELYGTGARATGSGFAS
FT                   AIGRIGSLIGPYAVGVVLPIFGQGGVFTLGALSFGVAAFAVWVLGIETKGLSLETLVSH
FT                   VDDDASAWRVAADDAR"
FT   gene            complement(248282..249457)
FT                   /locus_tag="Bphy_3312"
FT   CDS_pept        complement(248282..249457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3312"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bbr:BB3098
FT                   serine/threonine protein phosphatase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72468"
FT                   /db_xref="GOA:B2JS91"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS91"
FT                   /protein_id="ACC72468.1"
FT                   /translation="MREPYRAVHRYSRNESGRDFVVGDIHGCFAQLRAELQARNFDPQR
FT                   DRLFAVGDLVDRGPQSDTLLETVEQYGIRSVKGNHEDVIVRWHAGDEQAFSLLSNGGNW
FT                   LLDRADDREWVNAIAAYMASLPYLIEIETEHGLVGIVHADSPVSDWNRLVVDIEREKAD
FT                   GKLRRKAIWSRTRWKTYQPHPAPSRNTLRNLLDRATHSVRSQMHAPGRIENVAAVIVGH
FT                   TPVSGVTAKDNVINIDTGAVYGGKLTIIDLADLPKWIDVYAGAPGDAAERARLEPAMAA
FT                   HIGEPAFSDGVFGVEVPVLAESVANAELPVTADEAVVDYPALMDIPVNAMGVDMDGSGP
FT                   RFAPEAKPARPPLRTSTPNTMHITVRMSMFNLVSERQQGAASHSAARPRRR"
FT   gene            complement(249700..251040)
FT                   /locus_tag="Bphy_3313"
FT   CDS_pept        complement(249700..251040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3313"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; KEGG: bpd:BURPS668_0636 sigma-54 dependent
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72469"
FT                   /db_xref="GOA:B2JS92"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS92"
FT                   /protein_id="ACC72469.1"
FT                   /translation="MNLNLKRLYHVCNPERASLHGNLPSLQWRIRSIDIRARQGAALLA
FT                   SHRAAGLIEFSSLNIPADLHEVDELTRSSGEISWVAVVTNAHLNDPEIGRIVRTRCVSY
FT                   IRLPAAAETIAQELDRAYEMSAVDVIEHKNASGGALAMIGACAAMGDVRAAIRTASEHE
FT                   RPVTIIGESGSGKALTASSIHQGSSRREGPFVSIDCAAYPPERVEAELFGVGETKAETG
FT                   NQHSRLNMAEGGSLYIDGVCELPLAAQERLADLVGSGARNVRIICSTHIGLQRAADEHR
FT                   LHARLFASLSAATITIPPLRERGPDIRLLAAHLLKSFRSDSRHNVRGFSVCAWEAFDTH
FT                   TWPGNVREMINRIRHAIVASSGHLITARDLGFEHVASMPIIRRASADESDAIPEWDAIE
FT                   LAVARNQGRLDAAATELHISKVLLARMLASNARRAAGAPGALRMDSA"
FT   gene            complement(251800..252279)
FT                   /locus_tag="Bphy_3314"
FT   CDS_pept        complement(251800..252279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3314"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bte:BTH_II1006
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72470"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS93"
FT                   /protein_id="ACC72470.1"
FT                   /translation="MARHTALIEWSSNGSKFTDNRYSRAHQWTFDGGAVVPASSSPHVV
FT                   RVPFSDPAGVDPEEAYIAALSSCHMLWFLSIAVEQGYVVTSYRDAAEGTMAKNDEGKEV
FT                   IARVVLKPAVAFAGAKAPSDEALAHLHHLAHDACFLANSVKTVIDVEGSWSFREP"
FT   gene            complement(252311..253243)
FT                   /locus_tag="Bphy_3315"
FT   CDS_pept        complement(252311..253243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3315"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bxe:Bxe_B1744 putative
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72471"
FT                   /db_xref="GOA:B2JS94"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS94"
FT                   /protein_id="ACC72471.1"
FT                   /translation="MKPSLLVLIPLGDDSRARIAASFDLHYAPTHEARTAAVGTHGAAI
FT                   RAVLTNGTTGLTSAEIDAMPALEFVSALGAGYENIAVDHARARGIVLANGAGTNDDCVA
FT                   DHAMALLLAVVRDVPQRDRATREGIWRDALPMRPSVSGKRLGVIGLGNIGRKVARRAEG
FT                   FDIEIGYHNRNARDGVAWRYFDDVREIARWSDYLVVATPGGPSTHHLIDRDVLEALGRQ
FT                   GFLVNVSRGSVVDTDALAHALGNGVIAGAGLDVYEGEPRPPQALLHLPNVVLTPHVAGT
FT                   SPEAIGASVDNFITNATRHFAGEDVLTPI"
FT   gene            complement(253337..253849)
FT                   /locus_tag="Bphy_3316"
FT   CDS_pept        complement(253337..253849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3316"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="PFAM: protein of unknown function DUF1697; KEGG:
FT                   bja:bll4334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72472"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS95"
FT                   /protein_id="ACC72472.1"
FT                   /translation="MTTYVALLRAVNVGGTGKLPMTELRSVCAAAGFTNVRTYIASGNV
FT                   VFDSTLAKRAVQQALESRLEAYAGKAVGVLIRTGKEIAAVLQANPFSNEAANRTVAIFL
FT                   DDAPPADTLEHITGRRNEQVALGKHEIYVHYGDGMAKTKLRIPAAKNGTARNINTIAKL
FT                   AQWAAQS"
FT   gene            complement(253962..254978)
FT                   /locus_tag="Bphy_3317"
FT   CDS_pept        complement(253962..254978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3317"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: smd:Smed_1260
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72473"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS96"
FT                   /protein_id="ACC72473.1"
FT                   /translation="MKQLQLGKTGPASSAIGLGCMGMSGMYGPADRAESIATIHAALEA
FT                   GVTLFDTGDFYGSGHNEMLLGEALRLAPASRRDNALVSVKFGALRDPSGGWAGYDARPA
FT                   AVKNFLAYSLERLGVDHIDIYRPARLDPNVPIEDTVGAIAEMVRAGHVRHVGLSEVGSA
FT                   TIRKAASVTPICDLQIEYSLISRGIEDDILPTLRELGIGVTAYGVLSRGLISGHWQKDA
FT                   AGKGDFRAMSPRFQGENVERNLALVEALRKIADAKGVSVAQIAIAWVAAQGEDIVPLVG
FT                   ARRRDRLTEALGALGVKLDAGELAAIEQAVPKGAAAGERYAAAQMAHLDSEKGAAHH"
FT   gene            255079..255990
FT                   /locus_tag="Bphy_3318"
FT   CDS_pept        255079..255990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rru:Rru_A2875 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72474"
FT                   /db_xref="GOA:B2JS97"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS97"
FT                   /protein_id="ACC72474.1"
FT                   /translation="MVEPDLADLKAFVSVAAARGFRNAASRGGVSASSLSEAIRRLEQQ
FT                   LGVRLLNRTTRSVTPTEAGQRLFERLAPAFGEISTALDAINLFRDSPTGTLRLNVPSIA
FT                   AREILPALLSRFLAGHPGITVEVTSNDTFIDILAAGFDAGIRYDERLERDMIAVPIGPP
FT                   MQRMIAAASPAYLQQHGEPRHPDELVWHACIGHRFESGVLAVWEFTRGDDTVRIVPNGP
FT                   IVASVIDIQLRAAVDGLGIVYSFDEFLRPALDDGTLVPILRDWWQSFTGPRLYYASREH
FT                   MPAPLRAFVDFVLRDNRSRDAG"
FT   gene            complement(256007..256270)
FT                   /locus_tag="Bphy_3319"
FT   CDS_pept        complement(256007..256270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72475"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS98"
FT                   /protein_id="ACC72475.1"
FT                   /translation="MAIELDKDVRNEAIASLQRYFAENMDEPIGNIQAGALLAFFVEEI
FT                   GPVIYNLAVQDAQQRMHARVAELDIECHEDSFGYWKKYGKRR"
FT   gene            complement(256390..257211)
FT                   /locus_tag="Bphy_3320"
FT   CDS_pept        complement(256390..257211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3320"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: reh:H16_B1943
FT                   putative non-heme chloroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72476"
FT                   /db_xref="GOA:B2JS99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS99"
FT                   /protein_id="ACC72476.1"
FT                   /translation="MSTITTKDGTQIFYKDWGTGRPVVFSHGWPLDADAWDAQMLFLLR
FT                   NGFRVIAHDRRGHGRSDQPATGNDMDTYADDLAALLDALDIQGATLVGHSTGGGEVAHY
FT                   IGRHGTKRVAKAVLIGAVPPLMLKTEANPGGLPMDVFDGIRKGVADNRSQFYKDLAVPF
FT                   FGFNRQGSKVSQGTIDAFWAQGMAGGIHGQFLCIREFSEVDYTEDLKKIDVPTLILHGD
FT                   DDQIVPIDAAGKLSAKIVKNATFKIYEGGAHGMCVTEADKVNADLLAFINS"
FT   gene            257813..259000
FT                   /locus_tag="Bphy_3321"
FT   CDS_pept        257813..259000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA5327 hypothetical protein, INTERPRO
FT                   prediction: regulator of chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72477"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA0"
FT                   /protein_id="ACC72477.1"
FT                   /translation="MTARPLPVVLFGAFDRHNFGDMLFAHVAARLLTDRSVRFAGLAAR
FT                   DLRAQGGHCVDTLRPWHESAVDLLHVGGEILACDAWEAAVMLQAPEDAQRLIALQRHDR
FT                   FGWAQRVLGTRERAPYVVSKHELPCAAHVLFNAVGGVALDVRDAALRDEVLAKLARADD
FT                   VSVRDLHTQTVLANSGINARLAPDCAVLAAELFGDTIRAHANAAALARLREAAPNGYLA
FT                   VQLSADFGDDATLARVATQLDRAADAHRLAVVLFRAGAAPWHDDLACLERMAARMRTRH
FT                   VHVFDSLNIWDICALIAHSRGFIGSSLHGRIVAMAHALPRINVLHDEDFSRPCKQVAFA
FT                   QTWEDAGTPVAMRVSEIADGIDVALWAAPERLKQTATRLVTLCRAAFQTTLSRLR"
FT   gene            complement(259036..259350)
FT                   /locus_tag="Bphy_3322"
FT   CDS_pept        complement(259036..259350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72478"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA1"
FT                   /protein_id="ACC72478.1"
FT                   /translation="MKRFHIALAVANLDVSIDDYSRRLGQPPSAVVPGQYAMWRTDLLN
FT                   FSINEKPEQAGQLRHVGFEDDFVDGYSSSVDVNGLEWELFSAAEQDRRIVGTYGVPVKR
FT                   "
FT   gene            259497..259889
FT                   /locus_tag="Bphy_3323"
FT   CDS_pept        259497..259889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3323"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rme:Rmet_4639
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72479"
FT                   /db_xref="GOA:B2JSA2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA2"
FT                   /protein_id="ACC72479.1"
FT                   /translation="MLSHVFIGVNDFERAFDFYSTVLGELGLALKFREDDRPWAGWMKP
FT                   GVARPLFLVGKPFDGQPAEPGNGAMVALLAADRLTVKRVHATALAQGATCEGPPGLRPE
FT                   YHANYYGAYFRDPDGNKLCVCCHGPA"
FT   gene            complement(259923..260909)
FT                   /locus_tag="Bphy_3324"
FT   CDS_pept        complement(259923..260909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3324"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC-type transcriptional regulator domain
FT                   protein; KEGG: bxe:Bxe_B1753 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72480"
FT                   /db_xref="GOA:B2JSA3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA3"
FT                   /protein_id="ACC72480.1"
FT                   /translation="MSDTKLSHDAPLTAGTPQQRMVELLRTLAPAEGMTDAPLEGVKFL
FT                   RANHPMPRRPVMYEPSIVIVCQGRKRGYLGEQSYIYDAQQYLVLSVPLPFECETEASID
FT                   EPFLGISIRVDLTMVAELLMLLNETHGAVDSEPRGIYSTPLDQPLGDAVLRLLEALVSP
FT                   FDARILAPSIVREICYRVLTGVQGDAIRAALTHQHHFGRIAKALRRIHTEYDGDLDVET
FT                   LARESGMSLAVFHAQFKNVTSTSPMQYVKTTRLHHARLLMVQDGLNASAAAARVGYESA
FT                   SQFSREFKRLFGLSPVDEVKRMRGTLDPVVPPSQRPVTAARKYVTTN"
FT   gene            261296..262348
FT                   /locus_tag="Bphy_3325"
FT   CDS_pept        261296..262348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3325"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bxe:Bxe_B1754 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72481"
FT                   /db_xref="GOA:B2JSA4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA4"
FT                   /protein_id="ACC72481.1"
FT                   /translation="MTTTYAYAATDAQSKLAPFEFQRRDLREHDVQMEVLFCGVCHSDL
FT                   HQARNEWKNTIFPVVPGHEIVGRVTNVGSQVTKYKVGQLVGVGCLVDSCRTCPSCQEGL
FT                   EQYCENGFVGTYNGNDRQTGAVTYGGYSTQLVVDEDFVLRVPENLDPAGVAPLLCAGIT
FT                   LYSPLRTWGAGPGKKVGIVGLGGLGHMGVKLAHAMGAHVVLFTTSVSKIEDAKRLGADE
FT                   VVISKNPAEMEAHVNSFDLIVNTVAAQHDLNPFINLLKRDGTLTLVGAPEHDHPSPQVF
FT                   NLIMKRRRLAGSLIGGIAETQEMLDFCGKHGITSDIEMIQMQQINEAYERMLKSDVKYR
FT                   FVIDLDSLRK"
FT   gene            262534..263493
FT                   /locus_tag="Bphy_3326"
FT   CDS_pept        262534..263493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3326"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1755 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72482"
FT                   /db_xref="GOA:B2JSA5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA5"
FT                   /protein_id="ACC72482.1"
FT                   /translation="MIDRIQAMRTFMRIVDTNSFTRAAESLEIPRATATTIVQNLEALL
FT                   GTTLLVRTTRRLSLTPEGAAYYERCAQILADIDEMEATLRQTLDNPSGRLRVEMPGAVA
FT                   TSIVLPALDDFHERYPSIDLAIGVSHRNVDLVGEAVDCSIQLGELPDSGLAAKRLGTLE
FT                   HVTCASPAYLERYGMPESLDDLSEHVAVNCMSALTGRAVDFDFDVGGSPLTVKVNGFIK
FT                   VSDEHAYLTCGLQGLGLIQPARIAAQALLDKGLLREVLPQWKPVPMPVSVAYVKGRRVA
FT                   PRVRAFVDWLAELFEHQGHVEADLSRVRMLLQGRLHAV"
FT   gene            complement(263456..263881)
FT                   /locus_tag="Bphy_3327"
FT   CDS_pept        complement(263456..263881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3327"
FT                   /product="polymorphic membrane protein, filamentous
FT                   haemagglutinin/adhesin"
FT                   /note="KEGG: bxe:Bxe_A2858 polymorphic membrane protein,
FT                   filamentous haemagglutinin/adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72483"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA6"
FT                   /protein_id="ACC72483.1"
FT                   /translation="MAVEETATAAGKSAGETRATGRASTKPAHSPLRNLIALMLAIAPP
FT                   LAFAQIVPGGAHAPNVITTQNGVPQVNITQPSSGSRVSVNTYGQFDISKSGAILNNSPT
FT                   IVNAQLAGYINGNPNFGPNDAAQQSIKPHASDPAATS"
FT   gene            complement(264451..264717)
FT                   /locus_tag="Bphy_3328"
FT   CDS_pept        complement(264451..264717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72484"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA7"
FT                   /protein_id="ACC72484.1"
FT                   /translation="MSRAQTSELLRRAYESGDGRAAVALLDQSIALGHRKIALIRYLQA
FT                   QHLDAPLDARHHDYVRDVAARMSPATLARVVGEARARAGRRDG"
FT   gene            complement(264726..265139)
FT                   /locus_tag="Bphy_3329"
FT   CDS_pept        complement(264726..265139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3329"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bps:BPSS1365
FT                   putative dihydroneopterin aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72485"
FT                   /db_xref="GOA:B2JSA8"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA8"
FT                   /protein_id="ACC72485.1"
FT                   /translation="MPPPVRGKGWRVFVDELVVSTRIGIHAHEHLAPQPVVIDASLAYR
FT                   CEPSEEGTHAMIDYERYCNRVSEFLSTKTHTRMLETLAVEIAQLSFDEWPALDALTLSL
FT                   YKPKIREGTRRIGVELDWTRADYDVHRTSDVAG"
FT   gene            complement(265169..265819)
FT                   /locus_tag="Bphy_3330"
FT   CDS_pept        complement(265169..265819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3330"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   bam:Bamb_4543 sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72486"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSA9"
FT                   /protein_id="ACC72486.1"
FT                   /translation="MWNETRNNAPGATSAVAQRMAGQAWPESPLVGVGDLVKKHAVVPS
FT                   RKFHLREKAFCDLVNLRGDVRDAAFVNAVASVTGCEPPAKPNTVARGNGYDVLWLGPDE
FT                   WLVRSQQAQAPVAEEKLVEALQGQFASAVDIGSGWTVLEVSGEKVRDVIARGCPLDLHP
FT                   RVLAPGQCAQSHYFKASIVLVPVANDVYEIVVRRSFADYFVRIMLDAAEPLMS"
FT   gene            complement(265809..268808)
FT                   /locus_tag="Bphy_3331"
FT   CDS_pept        complement(265809..268808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3331"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: FAD dependent oxidoreductase; glycine cleavage T
FT                   protein (aminomethyl transferase); FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; Glycine cleavage
FT                   T-protein barrel; KEGG: bch:Bcen2424_5149 sarcosine
FT                   oxidase, alpha subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72487"
FT                   /db_xref="GOA:B2JSB0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB0"
FT                   /protein_id="ACC72487.1"
FT                   /translation="MSQKNRLGAGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGV
FT                   HFVARSFKYHRPRGIVTADVAEPNAVVQLERGAYTVPNARATEIELYQGLVATSVNAEP
FT                   NLEHDRMAINQKFARFMPAGFYYKTFMWPAKWWPKYEEKIREAAGLGKAPEVLDADRYD
FT                   KCYAHCDVLVVGGGPTGLAAAHAAASSGARVILVDDQRELGGSLLSCKTEIDGHAALSW
FT                   VEKIEAELSRMPDVKILSRSTAFGYQDHNLVTVTQRLTDHQPVSMRKGTRELLWKIRAK
FT                   RVILATGAHERPIVFGNNDLPGVMLASAVSTYIHRFGVMPGRNAVVFTNNDAGYRCALD
FT                   MKACGASVTVVDPRAQGNGALQAAARRHGVKIMNNAAVMTAHGKQRVTSVEVVAYANGK
FT                   TGAKQADLQCDLVAMSGGFSPVLHLFAQSGGKAHWNDTKACFVPGKGMQPETSVGAAAG
FT                   EFSLARGLRLAVDAGVEAVKSIGYAVTRPQVPQVAEVVESPLQPLWLVGSRAEAARGPK
FT                   QFVDFQNDVSAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILADALGKT
FT                   IPETGTTTFRPNYTPVTFGTFAGRELGDLLDPIRKTAVHEWHVENGAMFEDVGNWKRPW
FT                   YFPLKGEDLHAAVKRECLAVRNSVGILDASTLGKIDIQGPDAAKLLNWMYTNPWSKLEV
FT                   GKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWMERWLQTEWPDMKVR
FT                   LASVTDHWATFAVVGPKSRKVVQKVCSDIDFANEAFPFMSYRNGTVAGVKARVMRISFS
FT                   GELAYEVNVPANMGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSVT
FT                   PHDLGMGGLVAKTKDFLGRRSLARSDTTKDNRKQFVGLLSDDPQFVIPEGSQIVARPFQ
FT                   GDTAPMLGHVTSSYYSPILNRSIALAVVKGGLNKMGQSVTIPLSSGKQIAAKIASPVFY
FT                   DTEGVRQHVE"
FT   gene            complement(268805..269104)
FT                   /locus_tag="Bphy_3332"
FT   CDS_pept        complement(268805..269104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3332"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: bxe:Bxe_B1599 SoxD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72488"
FT                   /db_xref="GOA:B2JSB1"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB1"
FT                   /protein_id="ACC72488.1"
FT                   /translation="MLMIECPWCGPRAESEFSCGGEADIARPLDTDKLTDREWGDYLFM
FT                   RKNPRGVHREQWMHTQGCRRWFMATRDTVSYNIQGYDTFKTGNTSADSQGGNKQ"
FT   gene            complement(269183..270427)
FT                   /locus_tag="Bphy_3333"
FT   CDS_pept        complement(269183..270427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3333"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: bvi:Bcep1808_3459
FT                   sarcosine oxidase, beta subunit family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72489"
FT                   /db_xref="GOA:B2JSB2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB2"
FT                   /protein_id="ACC72489.1"
FT                   /translation="MSRYSIFSLFRNGLSYHENWERQWRSPEPKKEYDVVIVGGGGHGL
FT                   ATAYYLAKEHGVKNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLS
FT                   QDLNYNVMFSQRGVMNLAHTLQDVRDTERRVNANRLNGVDAEFLTPAQIKEIEPTINLN
FT                   SRYPVLGASIQRRAGVARHDAVAWGFARGADQAGVDIIQNCQVTGIRRDGGRVTGVDTV
FT                   KGFIKAKKVAVVAAGNTTTLADMAGIRLPIESHPLQALVSEPIKPVVNSVIMSNAVHAY
FT                   ISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDV
FT                   SPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIANDEPHPLNAPFSLDRFY
FT                   TGHLIDEHGAAAVAH"
FT   gene            complement(270462..271850)
FT                   /locus_tag="Bphy_3334"
FT   CDS_pept        complement(270462..271850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3334"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: reu:Reut_B4831 iron-sulfur-dependent L-serine
FT                   dehydratase single chain form; TIGRFAM: L-serine
FT                   dehydratase 1; PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72490"
FT                   /db_xref="GOA:B2JSB3"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B2JSB3"
FT                   /protein_id="ACC72490.1"
FT                   /translation="MNVSVFDLFKIGIGPSSSHTVGPMIAACRFASHIEDANLLAFVRR
FT                   VKVELYGSLGATGKGHGTDKAVLLGLEGHLPDTIDPDLIEPRLAQIRKGKQLSLLGKHE
FT                   IAFDEKEHIAFFRRLMSGTGSIVHPNGMRFQAFDENGQLLVEKEYYSVGGGFVVNREGD
FT                   RVNGVRAGGEVPYPFRTGDDLMRVCRESGLSVAQVTFANECASRSPDEVREGLLAIWRT
FT                   MAACVERGCKMHGELPGPMKVKRRAADLTVQLRSRSEESLRDPLSMLDWVNLYAMAVNE
FT                   ENAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGSNENGIVDFLLTAAAIGIIYKETASI
FT                   SGAEVGCQGEVGVACSMAAAALAAVMGGTPTQVENAAEIGMEHNLGMTCDPVGGLVQIP
FT                   CIERNAMGAIKALNASRMALKGDGQHYVTLDNVIKTMRETGADMKTKYKETSRGGLAVN
FT                   VIEC"
FT   gene            272194..273279
FT                   /locus_tag="Bphy_3335"
FT   CDS_pept        272194..273279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3335"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B1602
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72491"
FT                   /db_xref="GOA:B2JKW2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW2"
FT                   /protein_id="ACC72491.1"
FT                   /translation="MTIVDSLPLTSIDALPKERIRFGIILLPNFTLTAFSGFVDMLRLS
FT                   ADEGDYSKPVRCSWSVIGDTLAPVRASCGIQITPWETFADAEPFDYVVVVGGLLHSGPQ
FT                   ASDETLQFIRDAARKNATLVGICTGVFALMRAGVLDAHRICVSWFHYWDFVERFPAVNS
FT                   DSLVADRLFVIDRRRITCSGGRASIDVAAAILLRHFETATVQKALRILLVGEMQKGNAP
FT                   QPHPPGLEPATHPKVKRAILLMEQHVGRTLPLEELACKLDLSPRQLERLFKAETGKSPQ
FT                   AFAKQVRLRTAAWLLTSSDRTVADIASSCGFSDASHLGREFRKEFGMPPVMFREQRGGT
FT                   PVEGDAAAAYDETFPGRVDVF"
FT   gene            complement(273398..274375)
FT                   /locus_tag="Bphy_3336"
FT   CDS_pept        complement(273398..274375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3336"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_A3027 putative 10 TMS
FT                   drug/metabolite exporter, DME family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72492"
FT                   /db_xref="GOA:B2JKW3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW3"
FT                   /protein_id="ACC72492.1"
FT                   /translation="MLDHSDCTKRKREFAVSNQKRVLWISDLMLLAVAMVWGTSYGVVK
FT                   IALAFYPVLGLLALRFGLTFIVLSPALRSLRHVKASALVGTVGASVLLLGIFLAETFGI
FT                   SLTRASNAAFLISLCVVLTPLVEWALLRRRPLPVEWIAVGLSLAGAALVSGGVFIPTAG
FT                   DALILLAALLRALMVCVTKRVMRDPALAPLSVTAVQAGTVALGSLVVALMLPSGQWRAL
FT                   PSLAEHGVFWMSIGYLVIACTLFAFFAQNFAVKRSSPTRVALLMGSEPAFGALFAYASL
FT                   GEHLSMSGWMGGGLMVLASVLATAPSQKSADAATGVRVSVGSDA"
FT   gene            274459..275385
FT                   /locus_tag="Bphy_3337"
FT   CDS_pept        274459..275385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3337"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3026 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72493"
FT                   /db_xref="GOA:B2JKW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW4"
FT                   /protein_id="ACC72493.1"
FT                   /translation="MNPTELFALLPDMATFARVVDAGNFSEAARQLGSTPSTVSRQIKR
FT                   LEESLGTRLLERSTRRIRVTDAGAQVYRYCRDIVGAASGAVDVAGQSVGEPRGKVSISA
FT                   PIAFARSVIHPLIPEFLRSWPDVDVQLVFADREVDPLRDDVDIVIRLTRSPPLGLAARR
FT                   LGTVRWLLCASPAYLDAHGTPAEPRDLARHECLYLGETVDDNRWHFRRGTQTQSLEVRG
FT                   RYIANHAGARLDAALQHFGIASLPDFVAAQWLRQGDLVQVLAAWEFEARSYMGPVWLLY
FT                   PPNRFLPSKARALIDYLADHLYVAADE"
FT   gene            complement(275484..275615)
FT                   /pseudo
FT                   /locus_tag="Bphy_3338"
FT   gene            275782..276228
FT                   /locus_tag="Bphy_3339"
FT   CDS_pept        275782..276228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_1530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72494"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW5"
FT                   /protein_id="ACC72494.1"
FT                   /translation="MSTLHCEGIGDFAAFSGNDGWTKNNPAAAAIPKAGPLPPGRYYIV
FT                   DRGSGGFFTHIKDFILDLWSNTERGTWFALYRDDGEIDDWTFVEGVRRGNFRLHPHGRL
FT                   NLSEGCITLADPVGFFRLRDHLIHTARMAIPGGKGFAYGTVDVR"
FT   gene            276225..276464
FT                   /locus_tag="Bphy_3340"
FT   CDS_pept        276225..276464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72495"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW6"
FT                   /protein_id="ACC72495.1"
FT                   /translation="MSIRKISANAAAAVGVFLLLSFPISRIVFTDGFNSFLNHTLLMLG
FT                   ITYEREPGDSLVDAFLILSLLSLQPQPCGYATPS"
FT   sig_peptide     276225..276317
FT                   /locus_tag="Bphy_3340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.972 at
FT                   residue 31"
FT   gene            276474..276956
FT                   /locus_tag="Bphy_3341"
FT   CDS_pept        276474..276956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3341"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bxe:Bxe_A2091 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72496"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW7"
FT                   /protein_id="ACC72496.1"
FT                   /translation="MEKAQMSNDTFIKIDGIAGESEDVIHSDEIQVTNWGGKMSQQSSM
FT                   LSGSGGGAAKATVEDLVFFHEVDRASPNLMSYCLTGKHIAKVVLTMRKAGGIPLDFLRI
FT                   TISDVVITGVEMSASYEQVRLSFASVRQEYLLQNAQGGSRGVITGTFDLKQNAPGR"
FT   gene            complement(277017..278456)
FT                   /locus_tag="Bphy_3342"
FT   CDS_pept        complement(277017..278456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3342"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: bch:Bcen2424_5407 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72497"
FT                   /db_xref="GOA:B2JKW8"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW8"
FT                   /protein_id="ACC72497.1"
FT                   /translation="MIIFGGAGDLSARKLLPALYMAHTHGNLPAETRILAIGRREWQRD
FT                   DYLKWMEEQSRPFIESSAFDSSAWDRFLSLFEYVRVDVDQPEAYQRLAEASRQNALRVF
FT                   YLSTSPELFTTICDNLSSHGLLDEYSRVVLEKPLGHNLESAKAINDSVGKHFAEHQIYR
FT                   IDHYLGKETVQNLMVLRFGNAIFGPLWQAPYIRSVQITVAESVGVGTRAGFYDHTGAMR
FT                   DMVQNHLLQLLCIVAMEPPVSLDADAVRDEKLKVLRSLRPMTAEDIARDTVRGQYTAGA
FT                   VGGEPVKGYLEEANVPPDSRAETFVALRAHINNWRWANVPFYLRTGKRMAKKLSEIVIE
FT                   FADLPFSIMPNSPCGPRNCGNRLVIQLQPNESIQLQMLAKEPGSGMRTLPVNLNLDLEQ
FT                   AFTSRRAEAYERLLIDVVRGRLTHFMRRDELEAAWTWVDPIIEAWKRNGDKPRAYTAGT
FT                   FGPGASTAMMARDNMVWSEES"
FT   gene            complement(278728..279645)
FT                   /locus_tag="Bphy_3343"
FT   CDS_pept        complement(278728..279645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3343"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bxe:Bxe_B1765 ornithine cyclodeaminase/Mu-crystallin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72498"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKW9"
FT                   /protein_id="ACC72498.1"
FT                   /translation="MSTTPIFDAAGTARLIPFRPLVDALKTAAADYAAGRVASPERLVV
FT                   PLNDNGIMLSMPASAADLAIHKLVNVCPRNGERALPTIHGQVMTFDPDTGKTLFILDGP
FT                   TVTGRRTAAMTMLGIETLVHAAPKDILLIGAGTQAASHVQAIGELYPQARVRVRGTSPA
FT                   RAQAFCDAHQGNVRALEPLSDSTIPDSVDTVIALTTSRQAVYDETPRAGRIVIGVGAFT
FT                   PQMCEIGARTLAGSALYVDDLAGAKHEAGDFIQAGINWSTVTGINDALANRPAANLPIV
FT                   FKTVGCAAWDLAAGRVARAALSAG"
FT   gene            complement(279669..280676)
FT                   /locus_tag="Bphy_3344"
FT   CDS_pept        complement(279669..280676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3344"
FT                   /product="proline racemase"
FT                   /note="PFAM: proline racemase; KEGG: bxe:Bxe_B1024 putative
FT                   proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72499"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX0"
FT                   /protein_id="ACC72499.1"
FT                   /translation="MKLNRVISTVEVHTGGEPFRIVTSGLPRIPGKTIVERRAWLKQHA
FT                   DYLRRALMLEPRGHADMYGGYLTDPVSEGADFGIIFVHNEGYSDHCGHGVIALATTAVA
FT                   LGWVERTEPETRVGIDAPCGFIEAFVKWDGNHAGSVRFVNVPSFIWQRDVSVETPGFGT
FT                   VLGDIAFGGAFYFYTSGAPFGLDVREPQVDRLIQFGAEVKRAANAAFEVRHPLIPEIDH
FT                   IYGTIIDNAPRHPGSTQANCCVFADREVDRSPTGSGTAGRVAQLYLRGQLGKDETLVNE
FT                   SIIGTVFRGRVLSETKLDRFDAVIPEIEGDAHICGFANWIVDERDPLTYGFLVR"
FT   gene            complement(280799..281449)
FT                   /locus_tag="Bphy_3345"
FT   CDS_pept        complement(280799..281449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72500"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX1"
FT                   /protein_id="ACC72500.1"
FT                   /translation="MSEALPHDEAAFRHRNVPYYTQWGSREWVLPIVEHDADPCEDPDW
FT                   QRCGFDDPERYRFWASRLCGLTCLESALDFWRIAHPTRAALLDAALAHGVYRMRDDGGV
FT                   DGLIYRPFADWVQRTFAIDVDVLPDAPLRDLAGSIGEDAMTIVSVSPEIRYPERPNNAR
FT                   GGHLILLHGRNDDGVWFHNPSGVAPHQADVYLPFDTMERFYARRGMVLKRRPA"
FT   gene            complement(281446..282786)
FT                   /locus_tag="Bphy_3346"
FT   CDS_pept        complement(281446..282786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3346"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72501"
FT                   /db_xref="GOA:B2JKX2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX2"
FT                   /protein_id="ACC72501.1"
FT                   /translation="MTTTYPLHAHLSPADTPFPDKADVVIAGAGIMGCAAAYYLARRGV
FT                   KAVVLDKSRIAGQQSTRAWGFVRQQGREAAEVPLMMAGMRIWEQLERELDFDLEWRQGG
FT                   CLYVADNDADWASFQQWLDVAKQYGLDTRVLDRAQIDQHVRGMQGNALGGLYTPSDGQA
FT                   EPRRAAAAFAARAVEAGAQFFEGCGVVGIERAAGAVTAVVTERGAIRTRRVICAAGASS
FT                   WRLLATLGIALPQQAVRGTCMRTNPLPAITASTFWGHGLGIRQRANGAINLADDMQVDV
FT                   DMTFGHLRALKWFLPELWAQREKFSFHLNGAFVRDLCDRLPGVVPAGERVLHPRDPNPQ
FT                   PNRGHAPRALQKLRALFPALKDARIVESWAGLIDVLPDGIPVLDAPSQMSGLLIATGFC
FT                   GHGFAMGPIAGRLMAEWIDEGQPSMDLSAFRLQRFFDGTMQRPRSML"
FT   gene            283241..284095
FT                   /locus_tag="Bphy_3347"
FT   CDS_pept        283241..284095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3347"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; BetR domain
FT                   protein; KEGG: bxe:Bxe_B1770 response regulator receiver
FT                   domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72502"
FT                   /db_xref="GOA:B2JKX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX3"
FT                   /protein_id="ACC72502.1"
FT                   /translation="MSNEATSPDSLAVAERVRELMSRHGIGKRQQTSELCRILDLSFSQ
FT                   GHRKLRGNSPWTLSQIKKVAEVFGEPAAQLFGAQSLDPGMVGATAQEAVFAIGSIELAC
FT                   TAWIGAPIEAGSRPEFIAWSKHDQWRVVRYDGALYQNAYEVHKIEIYPRRAETDKPLIA
FT                   VVDDDQASADNLRDYLERSGFAAVAIYGLTAFAETLQTQVFDGVVIDWLFGPQTSAEAI
FT                   RTVRASENPDAPIFVLTGELLTGKASESEISDIVRNYDVACYEKPARMAILVADLSKRL
FT                   SRA"
FT   gene            complement(284134..285960)
FT                   /locus_tag="Bphy_3348"
FT   CDS_pept        complement(284134..285960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3348"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bxe:Bxe_B1771 periplasmic sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72503"
FT                   /db_xref="GOA:B2JKX4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX4"
FT                   /protein_id="ACC72503.1"
FT                   /translation="MTRRPLRRVVLVVIWIAALAAPTAAISYLLYSTLLNPRATQQLTG
FT                   TYDGFYWDAAQLQIAYARLESQLLLYETGVDSDYPRLALHFQVLQSKLHVMAGSTQRLA
FT                   AQAEAVQRQQQEIAGLSAMLVALQPSLDALPNSPALASQMVEELRKHWKEVNDLALSRR
FT                   NVDLQGREAMNSDFIAKRRMLFAGGLVLLLLSAAATALLVMNGRRRTKLILQQHAALDA
FT                   EHQASRAAREASLAKDAFLGMISHELRTPLHAIVSSIELLGMTFHSEADRKVLHRLETA
FT                   ARHLEAQMKDLTDYARLGAGKLELRNEHFDPRELLVSIVDENEPAARAKGLTFEGVASG
FT                   RVGLVDSDPHRIRQIVNNLVTNGIRYTERGMVTLRFEQRDDALAVVVADTGAGVPDKQI
FT                   PLIFKEFTQLDSSRTRRFEGAGMGLAIVQGLVDLFGGTISVDSEVGKGTRFTVTIPVKP
FT                   VAAPAGVSAAPQAAHGEWRPQVLIVDDNQLMRESLCEMLAHMGCDAAAVANADDAHAWL
FT                   AARRCDLVLLDLHMPDKDGYAFMAEYQENVSGQPADTRTPVIAVSAYAPDGAARAEADL
FT                   FFDSLTKPVHYEVLRAAVQRALAARHGASVAG"
FT   sig_peptide     complement(285877..285960)
FT                   /locus_tag="Bphy_3348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.388 at
FT                   residue 28"
FT   gene            complement(285957..286478)
FT                   /locus_tag="Bphy_3349"
FT   CDS_pept        complement(285957..286478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3349"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   bxe:Bxe_B1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72504"
FT                   /db_xref="GOA:B2JKX5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX5"
FT                   /protein_id="ACC72504.1"
FT                   /translation="MNYKNGWLRVLALMSVLALAFASFEAAAAPLTAALALDVKGKIAK
FT                   TNDADHTAFHFSEAQLLALPAHSISTSTTWTAKSTFTGPLLADILKTVGAYGDEIEIHT
FT                   LDDYTYTVPVSDSSRYGVIVAYSMNGKRLQVSDFGPLFLIYPRDQFPGELAGASADAKF
FT                   VWQIKALIVK"
FT   sig_peptide     complement(286392..286478)
FT                   /locus_tag="Bphy_3349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 29"
FT   gene            286677..287624
FT                   /locus_tag="Bphy_3350"
FT   CDS_pept        286677..287624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3350"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: bxe:Bxe_B1773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72505"
FT                   /db_xref="GOA:B2JKX6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX6"
FT                   /protein_id="ACC72505.1"
FT                   /translation="MKKPVLPLTYEQLDHWIDSLQPALLEERFAAAVGILRGGAPLALM
FT                   ASHAVGVPVAFLSYDRRARHVTWDSAQPLPPPGSKVLLCEDIAGRGFTLVDCIAFLEQH
FT                   GLIVKTLTGAFDEISRIRPDYANDASGFFALFPWERQAYTDDYREDWLKVESGSAAKMA
FT                   EDHEYATYAIDLDGILLPDVPLSRYDEDLAAALNERDALLPFDVLPHVDLQKVRAVITG
FT                   RPHADLTRTRAWLERHGFGHLELVMRMPDSHDETPEGAAAHKAAAALRCGVTHFVESDP
FT                   VQALYIAKLAPLLRVIWWDAAKHKGTLIAASAWR"
FT   gene            complement(287700..289373)
FT                   /locus_tag="Bphy_3351"
FT   CDS_pept        complement(287700..289373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3351"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: bxe:Bxe_B1774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72506"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX7"
FT                   /protein_id="ACC72506.1"
FT                   /translation="MARIVPDDWKSLATTGAAARERETLALLEEALPRDYTVYHGVHWT
FT                   RLHEGFSVFGEADFVIVSPSGRVMIVEQKTGFLRETPKGLVKVYMQTERNVAIALARTI
FT                   EGLHRRFTAAFGAGTYFIEELLYCPDHVVRDAAIAGVNPARIVDATRKDSLIETIRTAL
FT                   PGDEPRLACASKIHHFLADELALSPDASALVGQAGTLVTRLAGGLATWARRLEFSPFRL
FT                   RVIGTAGSGKTQLAVQVMKDAVARGERPLYVCFNRPLADHIARVAPPQAKIANYHQLCD
FT                   WIVRESGRAPDFQSNDVFDQLESAFAATPIDTGWQYDVLIVDEGQDFQQPWVPALERLL
FT                   KPGGAWWWLEDPLQNLYMREPVALPGWTVLRESTNYRSPRDILGYLRNVVGATVPLAGS
FT                   LTAGGPFDGSDISLSTYDETQTPESCIDATKRAITQALALGFRKQDIAVLSFRGREGSV
FT                   LWPLDHLGPHRLRSFTGKYDLFGNPAYREGDVLLDSIYRFKGQSAPCVILSEVDFDAFD
FT                   ERNARKLFVGATRATMKLIVVASQRAARHLQLGEAKEQVA"
FT   gene            289532..290158
FT                   /locus_tag="Bphy_3352"
FT   CDS_pept        289532..290158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3352"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bxe:Bxe_B1775 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72507"
FT                   /db_xref="GOA:B2JKX8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX8"
FT                   /protein_id="ACC72507.1"
FT                   /translation="MITVWGRANSVNVQKVLWVCDELVLPYHRIDAGLQFGRNDEPRYL
FT                   AMNPTGKVPTLVDGDYVLWESNSILRYLVMQYGASSLLYPEEAKTRASIDRWLDWALST
FT                   LQPAERPVFWAIVRTPAEQRDNAKLAADIDNVSKLWQMLDAQLQGRFFMEGENFTLADV
FT                   VLGAYAKRWFGLPGVERPSLPNLERWYLRLATRSGFKRYVDFDLT"
FT   gene            290163..290789
FT                   /locus_tag="Bphy_3353"
FT   CDS_pept        290163..290789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3353"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bja:bll8133 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72508"
FT                   /db_xref="GOA:B2JKX9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKX9"
FT                   /protein_id="ACC72508.1"
FT                   /translation="MTISLYAWGTPNGRKISVALEEMELPYVVRPVNITKDEQFDPDFL
FT                   AISPNNKIPAIVDPAGPDGQPISVFESGAILLYLGEKTGKFLPASLRDRVPVLEWLMWQ
FT                   MGGFGPMPGQVHHFAALASEDDKRYGLKRFSTETRRLYSVLDARLGKTEYVAGKLSIAD
FT                   FAILGWAWRHERHKVDLAEYPNVKRWYDMLFERPGVKRGFDAKLD"
FT   gene            290876..291469
FT                   /locus_tag="Bphy_3354"
FT   CDS_pept        290876..291469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3354"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bxe:Bxe_B1776
FT                   ferric uptake regulator (FUR) family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72509"
FT                   /db_xref="GOA:B2JKY0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY0"
FT                   /protein_id="ACC72509.1"
FT                   /translation="MKNAKPNAAAARDHSHDAHAAGHAHAHEGDLHHEQAGHARSTPAS
FT                   AEAALALAEEYCRERGEKLTPIRRKVLELLLTSGRATKAYSLLDDMRQIHPGSAPPTVY
FT                   RALDFLLSAGLVHKIESINAFAVCHDLTQCQHGILVVCQQCGNVTELHQPALREALVAQ
FT                   IENAGYRLAGDGIELKGLCSACQAAQAAGRGIHP"
FT   gene            complement(291489..291965)
FT                   /locus_tag="Bphy_3355"
FT   CDS_pept        complement(291489..291965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3355"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B1777 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72510"
FT                   /db_xref="GOA:B2JKY1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY1"
FT                   /protein_id="ACC72510.1"
FT                   /translation="MRYIMATSECITRFSSHNIKMNGVLRLDQATIVLVEDDPQNRESL
FT                   KILLESEGANVIAVADAEEGVEAAVRALPDAVVCDLDLPAMDGFYLIQRVRDHEIRGDH
FT                   SPSVAVALTGHTDEAYRLRSIGEGFQHFMTKPAPPEALVTLLHDAIGARAAGLT"
FT   gene            complement(292338..293081)
FT                   /locus_tag="Bphy_3356"
FT   CDS_pept        complement(292338..293081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3356"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1778
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72511"
FT                   /db_xref="GOA:B2JKY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY2"
FT                   /protein_id="ACC72511.1"
FT                   /translation="MARQAQTGSKAGSKAGSDRTDQPGGVEEAGARARPEPAARRPGRP
FT                   SGSGRGPEQRARLLDAALALFARQGIVDTTLGQVAREAGFTPAMMHYYFKTRDQLLDVL
FT                   IDERFLPLRARLGGSFQAHPDDPVAAITLLAQRLVEVAGHYPWFPPLWIREVISEGGLL
FT                   KLRMHERFGDANQKNGIAYIEKWQRDGKINAALEPSLVFLSVIGLTILPLATSSMWRND
FT                   PARRKLTADDIARHAVALLTQGVAR"
FT   gene            293171..294688
FT                   /locus_tag="Bphy_3357"
FT   CDS_pept        293171..294688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3357"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B1779 major facilitator superfamily (MFS) multidrug
FT                   efflux pump, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72512"
FT                   /db_xref="GOA:B2JKY3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY3"
FT                   /protein_id="ACC72512.1"
FT                   /translation="MESPTSTANMADAMPATIERPSLRVLFPALLLVMLLAALDQTIVS
FT                   TALPTIVGELGGLDSLSWVVTAYLLTSTIVVPLYGKFGDLFGRKIVLQTAIVLFLIGSA
FT                   LCGVAQNMTQLILLRALQGLGGGGLLVITMAAIGDVIPPAERGRYQGVFGGVFGLATVI
FT                   GPMMGGFIVDHLSWRWIFYINVPLGIAALLVIGAVFKPRVQQVKHTIDYMGAAFLAGAL
FT                   TCVILFTSQGGTVLAWTSPQLWGTLLLAFICIGGFVYEERLAAEPIMPLELFRDRTFLL
FT                   SSAIGFIVGVSLFGSVTFLPMYLQVVKNSTPSQAGMQMLPMMGGVMLMSIVTGRLISRI
FT                   GKYRMFPIMGTFLVGIAMLLLTTLKLTTSVQVMYAYMAVLGCGLGMVMQVLILAVQNAV
FT                   PFKHLGTATSGATLFRSIGGSVGVAAFGAIFSNGLSARLQALIPPDTELPHALGPAAIH
FT                   HLPAMLRDDYLQAFAGALHTVYIVAACVVVLAFALAWLLRDHPLRHH"
FT   gene            295124..296236
FT                   /locus_tag="Bphy_3358"
FT   CDS_pept        295124..296236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72513"
FT                   /db_xref="GOA:B2JKY4"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY4"
FT                   /protein_id="ACC72513.1"
FT                   /translation="MSAETSPAQGFPTPCTRCGGVLYQHADFCPYCGADHPLEPNQRKR
FT                   AGTQLRAVDTRPPLASVAADGTSISPHLASDVPLAPLDVPQPLRQTAGRWILTKGAVLL
FT                   LFVVALGYAGYLLLGDHRQDTGSDEPTNSASTSGGSISPYTPPQTARNAPSANVTNAPA
FT                   SKTAAASVAVVSPGVPTAPPRRAVQHYGNVPDALRAARTSLAHNSLADAKAALSDAHAL
FT                   EPDNTEAMQMQSDLKDRENRRDAALGVANTCAKDKLWNCVRERASQALAIDTSSADAQT
FT                   LLEHVILSTGWKPLSGDAKAAPALPPLRPAIPASSAATANTAANTTASATANAPATGSN
FT                   AASAVSSIDAQMRAIRESGWKQHPASANKP"
FT   gene            296356..297456
FT                   /locus_tag="Bphy_3359"
FT   CDS_pept        296356..297456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3359"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: bxe:Bxe_B1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72514"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY5"
FT                   /protein_id="ACC72514.1"
FT                   /translation="MLKTILTGLTGVLSLLIASLAVAAGVSAHYKIVTGQERGTYIQIG
FT                   ADLAKYVAQPAGIDLEVMPSKGSAENVQRMRFEPGVKLALVQSDVYQAYLDMANSGNAD
FT                   AGTTIRPLRLIMPLYNEEIYFVVRNDSPMTTINEIKDKVISIGPIGSGTAQSATTLYRL
FT                   MFNQAIPEQNVQSLSNEDAIAALVVKKIDVAVIVAGQPAKLFTDMNPDLLSQIRILRVD
FT                   PGAAETTRAKETYFPATIRQSSYPNWLKEDVPTLTVKAFLVTYDYGLRDTVSNLNRFAD
FT                   SLCENFDVLQEKGHPKWKQVKLELPPLTKGWQYYPPIERHLRSCIARRASMPAGGTSAS
FT                   VQQQPAAPKTKRPCSDQERLLLLCGK"
FT   sig_peptide     296356..296427
FT                   /locus_tag="Bphy_3359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 24"
FT   gene            complement(297548..299032)
FT                   /locus_tag="Bphy_3360"
FT   CDS_pept        complement(297548..299032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3360"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rme:Rmet_5590 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72515"
FT                   /db_xref="GOA:B2JKY6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY6"
FT                   /protein_id="ACC72515.1"
FT                   /translation="MKLFDLGGAARRRRSHVGAMLAPVPAAVTVLLAGCTVGPDYKGAP
FT                   ATTHVSSFKRAPDGVVQTAPGVAAWWLALGDPQLTALIDAGIANSPDLRAAQARVRQAR
FT                   AGLSQQQSNELPKVGASAAYLRTREPDLSSLSGGSSSSGGRGPIALYLAGFDASWELDL
FT                   FGGTRRAVEAASAQADASQAELADAHVQLAAEIGSAYVGLRDQQQSMAIVRKSAELEAR
FT                   VLTLTEQRRDRGVASQLDVERVRTQVENTRNALIPLDAQIAESLDELAVLTGREPGALD
FT                   DELNASAPLPALPQTIAVGDPAQLLRRRPDVRAAERRLASQSAQIGEREADWFPKVTLF
FT                   GSLAFSAADPGHLVRKNNFTWLAVPYLQWNAFDFGRTKARVDQSRAALDEAQAKYESTV
FT                   LGALRDADVALSRYGHERENVVSLRTVESSATRAATLTEQRYRAGTATALDWLDAERTR
FT                   YTAEQNRIQSDAQLIKDYVALQKSLGLGWEGMVSTQ"
FT   gene            complement(299041..300648)
FT                   /locus_tag="Bphy_3361"
FT   CDS_pept        complement(299041..300648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3361"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rme:Rmet_5591 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72516"
FT                   /db_xref="GOA:B2JKY7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY7"
FT                   /protein_id="ACC72516.1"
FT                   /translation="MAEHAAVRSKSQGQEQAASAKPANASAGDWTAVAAGALGALMATL
FT                   DISITNSALPQIQGQIGATGTEGTWISTGYLMSEIVMIPLAAWLTRVFGLRNFLLGNAT
FT                   LFTLFSLMCGMSHSLPQMIAGRIGQGFAGGAMIPTAQTIVATRLPRHQMPIGMTMFGLI
FT                   VLLGPLLGPVVGGWLAENIDWSWCFFLNLPVGVALVVLLVAGLDSARTNWQQFMRADWL
FT                   GIVGMAAGLSSLTVVLEEGQRERWFESSMIVWLSVVAFVGIALLIAAQFASKQPIVRLK
FT                   LLTNARYSSVIFIVFTVGAGLYCVSYLLPQFLSGVAGYNAQQSGAVMLMSGLPAFLMMP
FT                   VLPRLMGRVDTRLLVAAGLACFAGSCLLDIALTAQSAGDDFTWSQLLRGVGQVLAMMPL
FT                   NQASMAAVPREQAGDAAGLYNMARNLGGSVGLALLGTFIDRRNTFHDDMIRESVTANSL
FT                   VGEEHVAQSAAGFFARHGDMAYAKMQALGQLAAQMQLQASVITFSETFYVLAVALLLCI
FT                   PLAFLLKKPAPGTPSAGH"
FT   gene            complement(300641..301789)
FT                   /locus_tag="Bphy_3362"
FT   CDS_pept        complement(300641..301789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3362"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_5592 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72517"
FT                   /db_xref="GOA:B2JKY8"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY8"
FT                   /protein_id="ACC72517.1"
FT                   /translation="MSATLPVEESGRATRAQRSGKKGVFLLIGGVAVLGAIAWGAHWWT
FT                   MGRFIESTDDAYLQADGMTVAPKVSGYVAEVLVGDNQRVTSGQPLVRLDSRQYDAVLEQ
FT                   ANATIAARRADILRGEAELAQQQAAIAQARAQLDGATANEAHAADQVKRYEPLAATGAE
FT                   TNERVADLRNTQRQASATRAADAAALQSAERQIATTHAAIEQSRAQLAAAEASARQAQL
FT                   DAQDTMVKSPIDGRVGDRSVRVGQYAQPGTRFMTIVPVQDVYLVANFKETQIGMMRIGQ
FT                   PVTLRVDALPGAKLHGTIDSFSPGTGSQFALLPAQNATGNFTKIVQRVPVRIKLDVGPE
FT                   TRKVLLPGLSVNVDVDTRSARNNEARIERENEAHVARENNRG"
FT   gene            301924..302658
FT                   /locus_tag="Bphy_3363"
FT   CDS_pept        301924..302658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3363"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Transcriptional
FT                   regulator TetR; KEGG: bch:Bcen2424_3902 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72518"
FT                   /db_xref="GOA:B2JKY9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKY9"
FT                   /protein_id="ACC72518.1"
FT                   /translation="MITRTPRHRPAAEGGYQRGEETRAKIIEAALGLFGERGFEGASTR
FT                   EIAEHAGVNAPALVYYFDNKEGVYQACVEYIMTSVGAYFADAVAAAQTVLEGKPSDDEL
FT                   IDAFRVIQARVASYLFTTETPATWRLFMAREQAGLGPAFSAERLNERMRKPLLSVSSEI
FT                   VGRLLGRPADDPETIIRLLAINGQLVSFHLTRCTALSALQWKSIDGERLQQLCALIDEQ
FT                   SVILLRAMVDMREANKQRRKKK"
FT   gene            complement(303160..303510)
FT                   /pseudo
FT                   /locus_tag="Bphy_3364"
FT   gene            303941..304507
FT                   /locus_tag="Bphy_3365"
FT   CDS_pept        303941..304507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3365"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bxe:Bxe_B1787 putative phosphinothricin
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72519"
FT                   /db_xref="GOA:B2JKZ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ0"
FT                   /protein_id="ACC72519.1"
FT                   /translation="MSETSPAAAPLIRDATHADFHAIQAIYAHHVLTGVASFEETPPSA
FT                   DDLLQRRAAVLAHGLPYIVAVVDGKVAGYAYATLYRPRVAYRYTIEDSIYMDDAFRGRG
FT                   VGRALLAALIERCEQGPWRQMVAVIADGGRGGSLSLHRSAGFELVGTLKAVGFKQGRWL
FT                   DSTLMQRALGHGSETLPTGMHGESD"
FT   gene            complement(304566..305120)
FT                   /locus_tag="Bphy_3366"
FT   CDS_pept        complement(304566..305120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3366"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   bxe:Bxe_B1793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72520"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ1"
FT                   /protein_id="ACC72520.1"
FT                   /translation="MREVRWTPQESEGVEHLAFDARADGFYIESVLVGERDGRAYGLMY
FT                   RVKCDLQWRTLRASLKLVGGAELELHGDGEGNWHDGHGLVLASLAGCIDIDISATPFTN
FT                   TLPVRRLQLAKGAREPIAVAFISVPDLQVSRVEQAYTCIEPGSEYRYEGIDTGFAAELK
FT                   VDGDGLVIDYPTMFTRTLPLV"
FT   gene            305373..306323
FT                   /locus_tag="Bphy_3367"
FT   CDS_pept        305373..306323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3367"
FT                   /product="Urea transporter"
FT                   /note="PFAM: Urea transporter; KEGG: bxe:Bxe_B1794 UreA
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72521"
FT                   /db_xref="GOA:B2JKZ2"
FT                   /db_xref="InterPro:IPR004937"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ2"
FT                   /protein_id="ACC72521.1"
FT                   /translation="MPAAPHEKPLDALRTLLRSFGQIVLQRNAATGACVLAAWLVSDAR
FT                   LACAAFTGAIAANVGAMLRGYDCTDTRNGLHGFNGALAALAAFTFISDDARAMAVAILA
FT                   ATAAAWLLGPWERLLRSRGQGFYSSPCLLVTWAWLPFVRPVSAHAPASEMPGWLGPLPG
FT                   LLAGIAQTSFASSALAGALIVVGIAFSSMRAARFALAGAALASSAQWLVAADSASFDAG
FT                   LLGFNGALTALAVADCGVLAALAGVGVSVALQQATLFYGVPALTAPFVVATWTTRRIMR
FT                   DTRRTCTNGAERSPDDSVAVGHRKQASRAALLRER"
FT   gene            306346..307125
FT                   /locus_tag="Bphy_3368"
FT   CDS_pept        306346..307125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3368"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bur:Bcep18194_B1139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72522"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ3"
FT                   /protein_id="ACC72522.1"
FT                   /translation="MSSFAHTPAGRVAQPKPVSEEERRTRVDLAAAYRLAAVNGWDDLV
FT                   YTHISASVPDEPGHFLINPFGLSFDEVCASNLVKIDIDGNIVGASEHPVNATGFALHAA
FT                   VHAARTDAFCVMHLHNTAGIAVSLQRNGLLPGSQHALRFHGYLAYHDYEGLAFTPAEGE
FT                   RLVSDLGDKPAMLLRNHGTLTTGRTVAEAYVLMATLIKACEIQLLAQAGGGELVLPAEA
FT                   VAERTAEQLYDGGAVEGGIEWPALLRKLDRVDSSFRD"
FT   gene            307201..307386
FT                   /locus_tag="Bphy_3369"
FT   CDS_pept        307201..307386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3369"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bam:Bamb_4075 4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72523"
FT                   /db_xref="GOA:B2JKZ4"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ4"
FT                   /protein_id="ACC72523.1"
FT                   /translation="MPTFRIELFEGRTVEQKRQFVEAITKATCESLNVEPGSVDIILVD
FT                   VKKENWATGGRLWSDA"
FT   gene            307971..308936
FT                   /locus_tag="Bphy_3370"
FT   CDS_pept        307971..308936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72524"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ5"
FT                   /protein_id="ACC72524.1"
FT                   /translation="MRDQLIASIATRIADYRRGEIAAPTPEHVERWVNQFPNQQDEILA
FT                   ELDHVLGRTYITETSFRAWIAHFVADANILGPAPADFWAGAQLLANQGGGGSQRHLIQV
FT                   IRETINATFGQLQPRAQVATYVYVDDVSYSGNRILNDIGNWINVAPANASLLIFTIGAH
FT                   AYGKWRVERDLGDAVRASGKNITIRWYSYVTLEDRRAHTDVSDVLRPVQVAGDQTVANY
FT                   VQTFARPVVWRLGTSVGVGELFSSGNARSILEQQLLHAGIRIKNMCQFFGKNHRPLGYT
FT                   NLETLGFGSTIVTYRNCPNNAPLALWAGAPWYPLFPRRIN"
FT   gene            308936..309595
FT                   /locus_tag="Bphy_3371"
FT   CDS_pept        308936..309595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3371"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rba:RB1597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72525"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ6"
FT                   /protein_id="ACC72525.1"
FT                   /translation="MVSSSAGVRSYTRKESVVFRKTTDEFGGLSNMAPNFPLFVVGVSV
FT                   RTSEALYQACRFPHLPDVQKLIIEQTSPMTAKMKSKPYRPESRQDWDRVRNMVMRWCLR
FT                   VKLAENWQEFGDLLLATGARPIVEDSSKDAYWGAIHVGDGIYRGENVLGRLLMELRKKL
FT                   IEDPDSLRVVKPLALSEFLLLGKHIEAVTADQAAMSEVPASVRTARLEYLRGRDGS"
FT   gene            309684..310010
FT                   /locus_tag="Bphy_3372"
FT   CDS_pept        309684..310010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72526"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ7"
FT                   /protein_id="ACC72526.1"
FT                   /translation="MAIRLYRNGGCMTKGSVTLGDVAARTTHINIACSRCERRGHYRLS
FT                   KLVATLGEDFPVTSLAGQISDCPKQDAPTWEKCDVFYPGLRAIMDGGKPSDTPKPEHGD
FT                   DDDD"
FT   gene            310206..310604
FT                   /locus_tag="Bphy_3373"
FT   CDS_pept        310206..310604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72527"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ8"
FT                   /protein_id="ACC72527.1"
FT                   /translation="MKTQNELLDLIADESTPLADAWQAIQDLQTRFIERIARVAIEERA
FT                   DVSALVISQVMQIHKPGKAVVIDPSATLIDSAQAAHLLGVSKKSMSNYASPSTRTAYNF
FT                   PIEPIRDGRRVMWDRAAIEALAAERVIA"
FT   gene            310622..311032
FT                   /locus_tag="Bphy_3374"
FT   CDS_pept        310622..311032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3374"
FT                   /product="Antirestriction protein"
FT                   /note="PFAM: Antirestriction protein; KEGG: ajs:Ajs_4298
FT                   antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72528"
FT                   /db_xref="InterPro:IPR004914"
FT                   /db_xref="InterPro:IPR042297"
FT                   /db_xref="UniProtKB/TrEMBL:B2JKZ9"
FT                   /protein_id="ACC72528.1"
FT                   /translation="MKVTYTEVPASERLAFFPKLFGTRMMMAAEAMVYDRASELSINYR
FT                   GGLWSFYTLSNGGFYMAPQSPERLAVLVRSNDFECEVSADAFGLIVSLFVLGALCWIEQ
FT                   EELREKFATHFYQLRDFALEHEEASVILRAID"
FT   gene            311041..311256
FT                   /locus_tag="Bphy_3375"
FT   CDS_pept        311041..311256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72529"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL00"
FT                   /protein_id="ACC72529.1"
FT                   /translation="MPKAPDYLIALTAETDKGEAHTALTGQELNAVLKLLTRVAFANEE
FT                   APADPFERACMITAVRKLQRMIIDVL"
FT   gene            311265..311597
FT                   /locus_tag="Bphy_3376"
FT   CDS_pept        311265..311597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72530"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL01"
FT                   /protein_id="ACC72530.1"
FT                   /translation="MKTTVFCIAFAAAAVAVPAHADQPATPADKVAFCKELANTTGKIV
FT                   KARNAGVPMQKLMGDVDKQQAKTPGLGDYFRHQIRAAYSVPRNYITPEQGQQAAYDSCV
FT                   EKYGVK"
FT   sig_peptide     311265..311330
FT                   /locus_tag="Bphy_3376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            312012..313562
FT                   /locus_tag="Bphy_3377"
FT   CDS_pept        312012..313562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3377"
FT                   /product="phage protein"
FT                   /note="KEGG: bch:Bcen2424_0454 phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72531"
FT                   /db_xref="InterPro:IPR011202"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL02"
FT                   /protein_id="ACC72531.1"
FT                   /translation="MNLADQLEAHLGQFSSPPYLFVGSGIARRYMGLESWAGLLATQCE
FT                   LHGLPYGFLSTSAKGDLPELASGMARELHPRWWKEEKYKESRAQFEKFAINEESALKFE
FT                   IAKYIKDNANVIADPDLAAELDLFKQIVVDGIVTTNWDGLLEALFPDYDVYVGQEALLF
FT                   AHIQGIGEIYKIHGSFEDPNSLVLTSADYGEFHRKNPYLASKLLTFFVENPIVFIGYSL
FT                   TDPNILDIIHSVLDCLSPKNVEKLGDRLVFVHWDKDSKEDRFERTILSKNGRTLPVFQA
FT                   TTNSMSSVLGGLTRIKRKIPAKVLRMLKKQVYELVHATIPSERVYVQDIDANTDLDKVE
FT                   FAIGVGIQERLREKGYTALSRVDIARDVIFSNGGYRADMIVRDTLPALLKGMEYVPVFK
FT                   YLHEASAVPKWNPASVSQRVIKASKADLKKFQPKGIGKITAATLEAYDGDFATYTKQHD
FT                   RETVINRAGMLPWEKLNATELQQFLADNIDLMSSDNITVTTNFFKLVCIYDWLAFGQL"
FT   gene            complement(313855..314034)
FT                   /locus_tag="Bphy_3378"
FT   CDS_pept        complement(313855..314034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72532"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL03"
FT                   /protein_id="ACC72532.1"
FT                   /translation="MKINLYNEGDNPIRVIIDGDTVNDSTLEPGEERFIESRDAGVIEL
FT                   RELDGPQAATDPSD"
FT   gene            complement(314044..314259)
FT                   /locus_tag="Bphy_3379"
FT   CDS_pept        complement(314044..314259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72533"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL04"
FT                   /protein_id="ACC72533.1"
FT                   /translation="MKTQLLIALRILAPVLVVLASACTLVFVRGDGNSFADTRGDTKGQ
FT                   LTVNRRAAKGPASETEPPIVIPHKSR"
FT   sig_peptide     complement(314191..314259)
FT                   /locus_tag="Bphy_3379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.739 at
FT                   residue 23"
FT   gene            314300..314764
FT                   /locus_tag="Bphy_3380"
FT   CDS_pept        314300..314764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72534"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL05"
FT                   /protein_id="ACC72534.1"
FT                   /translation="MDILPDPVTFEASGLPCVIIMTIAGRWLACVEITREHALYRRRRE
FT                   VEVAVPDALAGLDVTLERVAYADISAAKLPAVLDSGASLPASILLACPGGIMYTGVAYD
FT                   GRPGKWWIGFNMPGETSHDEVRVELEHFAALVAALAQATVTGGPAAAPEV"
FT   gene            complement(314761..315546)
FT                   /locus_tag="Bphy_3381"
FT   CDS_pept        complement(314761..315546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3381"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   hau:Haur_1973 tail collar domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72535"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL06"
FT                   /protein_id="ACC72535.1"
FT                   /translation="MTQVPNYQVPAHPSGLDMRTQLNNIVLALIGDNSGPVAPTQTYPG
FT                   MWWGDTTAKRWKHRTNADDGWIDVGPLDDILGDFRSASPKGTIIMWWGDGTKIPTGWAK
FT                   CDGTQGTPNLTDKVPVCAGGTYASGATGGANTVTLSASQMPVHAHGISDPGHGHGVADG
FT                   GHNHSVWDNGHQHTLPNLGSVQAGSDNGGASSPVSTGYGSSRYQNPTDAGGGNHGNNAS
FT                   GAGIGIYGNGTGIGIQNAGGGAAVDIRQPYYALWFLMKL"
FT   gene            complement(315543..318854)
FT                   /locus_tag="Bphy_3382"
FT   CDS_pept        complement(315543..318854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3382"
FT                   /product="Phage-related protein tail component-like
FT                   protein"
FT                   /note="KEGG: rso:RSc1698 probable bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72536"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR037221"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL07"
FT                   /protein_id="ACC72536.1"
FT                   /translation="MNSRDLVPVAGAGGGGGKGGGGGSRSPVEAPDSLRSVQYARVINL
FT                   LCEGEIEGIVGNAAGIYVDDTPLANADGSWNFNGAAIEWRTGTAQQAPISGFSATESES
FT                   TVGVTVTAAAPVTRSITNPNVTAIRVTLGFPQMTSLDTTTGDLSGTSVQLAIDVQRNGA
FT                   GFQTFYTDTVTGKTTSRYQRSYRLGLSRFGVLGGTYDIRVRRITPDSTTSNLQNAFQWE
FT                   TMTEIVDSQLMYPYCALVGVQIDASTFKSIPKLSFDTQLRRVQIPSNYDPPTRTYTGVW
FT                   DGTFKVAWSDNPAWIVYDLSVTQRFGLGAYLSPALIDKWTLYSIGQYCDGMVNNGFGQL
FT                   EPRYTCNCYIQERADAITLLQHFASIFNGLIFWSGGALTFSADMPADAVDEFSPSKIID
FT                   GAFNYVGSPLNQRHTIALVTWNDPAQKYAQAIEYVEDAEAIAQWGIRELQIQAFGCTSR
FT                   GQAHRVGRWALLTERYLSESVTFKTGVNAAFVRPGDVFLTTDPTRAGARMGGRVLDGGT
FT                   DWLTLDASVNLTTDTSWSISVMLPDGTFATRALLVTQDGPQATVHLAQALPIAATRMCA
FT                   WAISGGTLQMEQWRCTSASEDEDGNIEIAGIAYRPDKFAAIEADLKLEPLPTSIIDPFN
FT                   VGPCTELDVTESKYLISPMVVGSRATFSWLAPVGAVRFAVSYQHEQDSPVYADCFMNSI
FT                   DIQPTEEGTWYFTVWAINSIGIRSAPASITVQLRALNQPPEDVKGFQLTVINDSANLGW
FT                   IASTDLDVTVGGQVAIRFSTRLTTAVMWEEASDIARFSGSQSSGYTLLMKGTYLAKFIN
FT                   SSGAYSENPAYVISTTGPLRDYNLVANLQQDPTFTGVKQNMIVRNGILFLDQNPDTGLV
FT                   VSTQGGYYFDRVVDMGKVYTVRCSTYNEGAVYDVTDDVDTWPDFDARSDVDGTKINEGG
FT                   SLVLASITNVDPNVAQAADWSPWTRLVVADLTFRAVRFSLAVKVPDTTHGIGITSLGAI
FT                   VDVPDRIESRNNVPVAATGSSITFSVPFKAAPAISIIAQGLASGDKWSITNQSATGFTI
FT                   QFQNSGGTGIAKTCDWIARGYGYEHVDLDGLGWSALMKGDIERLLADRQRMGVTP"
FT   gene            complement(318854..319423)
FT                   /locus_tag="Bphy_3383"
FT   CDS_pept        complement(318854..319423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3383"
FT                   /product="lambda tail assembly I"
FT                   /note="PFAM: lambda tail assembly I; KEGG: rso:RSc1696
FT                   probable phage HK022 GP20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72537"
FT                   /db_xref="GOA:B2JL08"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL08"
FT                   /protein_id="ACC72537.1"
FT                   /translation="MLTVLFYGDLRRRFGRRYVLDVHSPREAILALCLQLDGLRRYFRD
FT                   HATQNFLVRGYQDYDESDLDYPQSTGTLKVVPLVAGAGAWGKIIGGAALAVVGFVISPY
FT                   SGGLGMALVSMGLSMALGGVAQMLAPRASGSATPEKADNQPSLAFDGAVNTTGQGGPVP
FT                   LGYGRMIVGSQVISVGFSTNNEIVVN"
FT   gene            complement(319433..320155)
FT                   /locus_tag="Bphy_3384"
FT   CDS_pept        complement(319433..320155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3384"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rso:RSc1695 probable
FT                   phage HK022 GP19-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72538"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL09"
FT                   /protein_id="ACC72538.1"
FT                   /translation="MNDELTALVPYVRIHAEAEAPRECCGLAVRDTSGLLVYVACRNEA
FT                   RDHEHFIINATDYARAEDTGTIVAIVHSHPYADPAPSLADRAGIEDTELPWLIVNHPLG
FT                   TYTISRPEGFAAPLIGRPFVHGVHDCYALVRDYFAKFGIPLNDYTRSWGWWEGASGPDL
FT                   YRDNFVREGFREVPRETLREHDLILMRIRAPRENHMAVYLGHGVILHHLIGQPSRRETY
FT                   QEFYQRRTTAVLRHRSFP"
FT   gene            complement(320152..320850)
FT                   /locus_tag="Bphy_3385"
FT   CDS_pept        complement(320152..320850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3385"
FT                   /product="phage minor tail protein L"
FT                   /note="TIGRFAM: phage minor tail protein L; PFAM: minor
FT                   tail protein L; KEGG: ypp:YPDSF_4037 phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72539"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL10"
FT                   /protein_id="ACC72539.1"
FT                   /translation="MKLNGAIQELAPGAVIQLFVLDLSAYHVPSGNEITRFHAGTNEIG
FT                   GDVVWQGNTYQRFPVQATGFEFKGQGTLPRPHFAVSNVGGIISALCREYSDMVGAPVTR
FT                   KRTLARYLDAVNFADGNPLADPTEGFPDDVFYVNQKLRESVDVCEFELAVAFDVQGVQL
FT                   PRRQVICNSCPWEYRGDGCGYAGGPVADINDNPTSDPNRDACGKRLASCRLRFAGWVPF
FT                   GGFPGAGQYR"
FT   gene            complement(320847..321251)
FT                   /locus_tag="Bphy_3386"
FT   CDS_pept        complement(320847..321251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3386"
FT                   /product="minor tail family protein"
FT                   /note="PFAM: minor tail family protein; KEGG: sec:SC1230
FT                   Gifsy-1 prophage VmtM"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72540"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL11"
FT                   /protein_id="ACC72540.1"
FT                   /translation="MITTFERWIGRSIITPRATGAVFDWCVTSANYDLEPKVIKAQFGD
FT                   GYAQRRPAGINTQAHMWSVEMRNITGDTYSNVVAFLQARNGVDVFNWTPPRQSVAEDVI
FT                   CSSWSFSYGDLLADGSRLLNLSMKFEQVFV"
FT   gene            complement(321248..323395)
FT                   /locus_tag="Bphy_3387"
FT   CDS_pept        complement(321248..323395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72541"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL12"
FT                   /protein_id="ACC72541.1"
FT                   /translation="MASAGSLVFEIAADVSRLRQDLNQANNDIKSQLESIRRSSAAEAF
FT                   MTGADYAMEFARGFAEKIRSAIDQADAMGKLAQRIGTTTEALSALAYQGEFAGVSVDDL
FT                   TAGFKALNKAMVDARDPANDSAVAIKALGLNVKDLQSADPTQAFSEIAESFSKYRDGAE
FT                   KAAVATQLFGRDGQKMIPLLNQGAEGFATAADEAQKMGLVISTSTAQAMGELNDNISRL
FT                   GKVSEGSAAIVAQDLAPALMGLTQAMMDGQQAGGGMRAVLEWLGKDLAALVVNFTYAAG
FT                   AVGNFFKEAQGAIGVAKKFMSGDIEGGKQAWADNVKDSQARMQQLDFTIQQTRNRMTDG
FT                   YRESAAAWAQVDKNSGFATQATLKYSQGLDDMAASQKRAKKAVDDYAQMLGSLQDQYRK
FT                   LAAEGDPMKELISDPKYLKMNQQQQQTLHDVVQAIKDKTVALDAEKQAQENLQSAEDTA
FT                   YKAAAANLKAEYDRIDALFAFGDAQARAVDPTIQYTDTVNQLNDALEAGAIDSAHYTLA
FT                   IRKAGDDLKNAQDKTDPWLKQLKAIQDAIDAFGKQSSDAFVDFIFSTKDASVSFSEMVT
FT                   SILKDMAKMLVYQNVFQPLMKIVGAGMTGGGRDWSSFLSAPGRMSGGPVSAGMLYQVNE
FT                   LPGRKEFFIPNVSGRIATDAGVPSGPNVQVNVNMYGERDDRTTTDTKGDERNATELGKR
FT                   IATVVRQVISTEKRTGGLLAS"
FT   gene            complement(323584..323916)
FT                   /locus_tag="Bphy_3388"
FT   CDS_pept        complement(323584..323916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72542"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL13"
FT                   /protein_id="ACC72542.1"
FT                   /translation="MTDLSQPVRAFDLTLASETVETECFGAVTISDIGADGIERIASHM
FT                   REAGLSDDREMARQLLCESASGPNGERFTAEGLAHMPARAFRDRIKLLTAAMRVNGLSQ
FT                   VDVEKA"
FT   gene            complement(323924..324856)
FT                   /locus_tag="Bphy_3389"
FT   CDS_pept        complement(323924..324856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72543"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL14"
FT                   /protein_id="ACC72543.1"
FT                   /translation="MKKAISAQGTKMFLENPDAAPIATGLLMAGSVSTPCVVTFDNVTK
FT                   MANGEPLYITGSGWPSIDDQEWVIQNLDKTAKTASLANSDTSKETATWNAAASYTLNAF
FT                   ADVCAQSYQINQNPATTIDTTTLCDSEKTSLVGFRDPGTLTFDFFIDPTDPDYLALHDA
FT                   YDDGEERMFELIYKNGAVRTLPVIVQSINETGGVDQAVHGSATLKITGSPILTQPGSTT
FT                   PPVYALTVDVAPASGVAPLSVTATMAETNGTASQFQIDWGDTTAIDTVTGSLTKTHDYA
FT                   AAGSYTAHVTPTVNSSVLAPVAANAVTVS"
FT   gene            complement(324853..325212)
FT                   /locus_tag="Bphy_3390"
FT   CDS_pept        complement(324853..325212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72544"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL15"
FT                   /protein_id="ACC72544.1"
FT                   /translation="MTDAELLIILNQALPSRAFLMLAPQGFAEPYLIYQRIWWGPENSL
FT                   CGYMEGDHVRYQIDSYARTHKEAAANMDAALDALRASSDPPNVENGGDLYEQDTKLHRV
FT                   TVNIITWFDPQGVTP"
FT   gene            complement(325205..325714)
FT                   /locus_tag="Bphy_3391"
FT   CDS_pept        complement(325205..325714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3391"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="TIGRFAM: phage protein, HK97 gp10 family; PFAM:
FT                   TP901-1 ORF40 family protein; KEGG: asu:Asuc_1243 phage
FT                   protein, HK97 GP10 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72545"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL16"
FT                   /protein_id="ACC72545.1"
FT                   /translation="MRVYVEQHVEGLAELDRFLSTLPENIQRKMLNSALRAAGKPVLDQ
FT                   AKQNIRSLFGSSPRYTGTLEAGVVIAKQRNTGLAARVNVKTKKPRGNKTNDVIHGVKKP
FT                   YGRDPFYGRFLEKGTSKMPARPFLGPAGYARQSDAGRALNASLQQQIARWCKANGVKFV
FT                   PGGAYD"
FT   gene            complement(325711..326052)
FT                   /locus_tag="Bphy_3392"
FT   CDS_pept        complement(325711..326052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3392"
FT                   /product="phage head-tail adaptor"
FT                   /note="TIGRFAM: phage head-tail adaptor; PFAM: putative
FT                   head-tail adaptor protein; KEGG: asu:Asuc_1242 phage
FT                   head-tail adaptor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72546"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL17"
FT                   /protein_id="ACC72546.1"
FT                   /translation="MQAGRLRYRLTFEKPVRLLDETGEVIVDQWVKAFTVWGSLEPLSG
FT                   REYLSASEFRAGITTRVRVRWRSDLDPAMRIRCDEVTYDIAAILPVMGLHKEAQIMCQS
FT                   GVVTTGGQP"
FT   gene            complement(326055..326630)
FT                   /locus_tag="Bphy_3393"
FT   CDS_pept        complement(326055..326630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3393"
FT                   /product="phage conserved hypothetical protein, phiE125
FT                   gp8"
FT                   /note="KEGG: pla:Plav_0908 phage conserved hypothetical
FT                   protein, phiE125 gp8"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72547"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL18"
FT                   /protein_id="ACC72547.1"
FT                   /translation="MDSIVIAATGDSEEPVTVDMAKAHCRVDVDDDDALFESIYIPAAR
FT                   QTVEQYTGLTLLSCDVDVLVCQCDVTQNVIAVPVQPVASVTALATVDANGVQTPLDLDE
FT                   YGIAVAKVGMRSVIVARNGPLPSAPYYRVQYVAGYAENATPPNLLLAILEYVGDAYENR
FT                   EAQQTSQAINDNPRAVRLMDPFRITFGL"
FT   gene            complement(326640..327833)
FT                   /locus_tag="Bphy_3394"
FT   CDS_pept        complement(326640..327833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3394"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="KEGG: bpm:BURPS1710b_1682 phage major capsid
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72548"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL19"
FT                   /protein_id="ACC72548.1"
FT                   /translation="MDMTEIKKALEETFGQIRDAQTKSLEEVRTELKTLDDKLSKTDIN
FT                   MIDLGQKLAGLSEKGQRETGAQTVGEYFVKSDAFKAMQGGGNAGRARISLEGEQLKAVA
FT                   PIFESVDPNQYPVPSDRRTTIIPPGMNDVWIRDLLPGGTTTSNLIEYPREKAAQLNADY
FT                   QTEGQLKAQSDLSFEMAQAPIVTLAHWLLASRQVLDDVAQLQSYINMRMTYGLRMKEDK
FT                   ELLTGDGATGHIAGLITQAAPFAPTDPALNGVDNIRLAMAQVQAAFYNPTFAVMNPLDW
FT                   ASIQLMKNAQGEYLFGSPLAPVTPRLWNINIDATYAMAQGQFLVGDARQAMVWDRQAIN
FT                   IEVSREDVDNFRRNMVTILVEERLGLSVFAQAAFATGSLVATVAPGGTKSSKSSASA"
FT   gene            complement(327847..328557)
FT                   /locus_tag="Bphy_3395"
FT   CDS_pept        complement(327847..328557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3395"
FT                   /product="phage prohead protease, HK97 family"
FT                   /note="TIGRFAM: phage prohead protease, HK97 family; PFAM:
FT                   peptidase U35 phage prohead HK97; KEGG: nar:Saro_0648
FT                   peptidase U35, phage prohead HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72549"
FT                   /db_xref="GOA:B2JL20"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL20"
FT                   /protein_id="ACC72549.1"
FT                   /translation="MSRKFAGDTDHGSVLSMVEFKFDSTAKGSFEGYASVFNNIDSYGD
FT                   IMLPGAFEESIAKKDAVPMLFNHWIDNLIGKAANLKEDEIGLKFNGRLTPGASMSTDVY
FT                   QHMKAGALDGVSIGYRVQPGGADMDGKVRTLSRVDLLEISMVISPANKSARANLGSLKS
FT                   DLDPDEMKSLADAEAWLRDANGWSRIEAKVYIARVRDMVLRDAGLSDDSATVVKTDPDD
FT                   VALATFLRDFKFNL"
FT   gene            complement(328561..329898)
FT                   /locus_tag="Bphy_3396"
FT   CDS_pept        complement(328561..329898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3396"
FT                   /product="phage portal protein, HK97 family"
FT                   /note="TIGRFAM: phage portal protein, HK97 family; PFAM:
FT                   portal protein; KEGG: bpm:BURPS1710b_1680 phage portal
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72550"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL21"
FT                   /protein_id="ACC72550.1"
FT                   /translation="MADIRYNTPQREMELSVRDPAGWLPRAFNQALTWLGGGWFGGGNV
FT                   DEPGQQINTPTGDYYAGSETQAMQISTVWACVRLITETIGTLSINVYERTPTGRNLVQS
FT                   HPLNYVLNTAPNDRNTPVELLESFGMNLAIDGNCYARIIRDGSGDVISLMPRASQQTTL
FT                   IENTDNTYFYKYSTGGEQITYQPPQMFHSRLMGNGLKGLSPLGYARRSIANALALQNNA
FT                   LRFNAKGGKPAGVLMIDHVLKPEQREAVRNNFADLEAGGDAGSRLFVLEAGMQYQQLTI
FT                   SPADAQMLEQLKFGVDDICRIFRVPSFLVNQYERNTTWGSGIEQMDLGYSKYTLQPYVT
FT                   RLESSMNRWLLRPSEQQRYYVEFNLESLLRSDSASRASFYSTMVQNGLMSRNECRVKEN
FT                   LDRRDGADDLTVQLNLTPIEDLPKVADQNTQQQQQSQDVPTQPIKE"
FT   gene            complement(329914..331659)
FT                   /locus_tag="Bphy_3397"
FT   CDS_pept        complement(329914..331659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3397"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: son:SO_2967 hypothetical
FT                   phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72551"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL22"
FT                   /protein_id="ACC72551.1"
FT                   /translation="MKANRPPAKKATSDPVTRYASDVIAGIIIAGPHVRAACARHLDDL
FT                   KFGPGRGLSWDLPAAMRAISYFADVLCLNGGDFEGKPFVLLPWQKFIVGSLFGWKRRDG
FT                   SRRFREAYVEAGKGCGKSPLAAGVGLYMLTADGEMRPEIYAAATRRDQAMILFRDAVAM
FT                   VDLSPELSNRLVKSGRGERCYNLAYYAKGGWFRPIASDSSGQSGPRPHCALIDEIHEHR
FT                   DPTVINIMRAGKKGRSQPLLFMITNSGFDRTSICWEQHQYGTNIVSRAIEDDAYFAYIC
FT                   ALDEDEEPFEDESCWIKVNPSLGKTIQKTYLREQIHQARGMPSQESTVRRLNFCQWVDA
FT                   ENPWIDGDLWRACEVEDLPDEVFAGRTVYGGLDLSGVRDLSALAYVVRQEDDSVDAFID
FT                   FFIPRDGLADRIKRDNAPYEAWINKGFVTATPGKSVDYAFIVEAIVSRSMSFDMQGIAY
FT                   DTYRIKDFIGDMDEGNCDVPLVAHPQGYARASESNLWMPRSIEMLEKLVIDGKLRVRLN
FT                   PCLRWNSGNAVLQADAKNNRIFTKSRSTGRIDGIVALAMAVGYAFRIDEEEDLDDFLNA
FT                   PLMAS"
FT   gene            complement(331619..332095)
FT                   /locus_tag="Bphy_3398"
FT   CDS_pept        complement(331619..332095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3398"
FT                   /product="phage terminase, small subunit, P27 family"
FT                   /note="TIGRFAM: phage terminase, small subunit, P27 family;
FT                   PFAM: terminase small subunit putative P27; KEGG:
FT                   rsh:Rsph17029_0646 phage terminase, small subunit,
FT                   putative, P27 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72552"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL23"
FT                   /protein_id="ACC72552.1"
FT                   /translation="MPQPRKPTALRIIEGNREKRPLPKNEPKPRRGVPQPPAHLDAYAL
FT                   EEWARITPELEAIGLLTTIDGTTLAAYCQCVSRWRQAEEAIQRMKKKDALTSALMIKTS
FT                   NGNAIQNPLIGVANRAMHMAIKFASEFGMSPAARARLAALPDEGKPATRKESYF"
FT   gene            complement(332079..333149)
FT                   /locus_tag="Bphy_3399"
FT   CDS_pept        complement(332079..333149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3399"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: oan:Oant_1510
FT                   DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72553"
FT                   /db_xref="GOA:B2JL24"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL24"
FT                   /protein_id="ACC72553.1"
FT                   /translation="MAYHDRLAVAWESHLAPRAPDAPTVVSTFAGCGGSSLGYSMAGFD
FT                   ERLAVEWNEKQAASFVANFPHVPLHLGDIADLSDADALRMARLEPGELDVFDGSPPCQG
FT                   FSLAGARKFQDGRNQLFIEYVRLLRTFAPKAFVMENVRGMVVGKMRLIFADILNELKGC
FT                   GYTVCARVLTAGYYGVPQMRPRMIFIGIRNDLAACGVLPSHPEPQCWPPCVAEAWHGVA
FT                   NTPDEIEAAAFAQTRLVWRLLWRMKPGEYGDEYHPNKQLYGLYRLDPARPSPTILRNGG
FT                   AGGACEACHPTEHRRITIAEAKRIGSFPDPFVLRGNFQERWAAIGNCVPPLFMRAIALH
FT                   VRGLLETASEHHAATA"
FT   gene            complement(333155..333757)
FT                   /locus_tag="Bphy_3400"
FT   CDS_pept        complement(333155..333757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3400"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   rsh:Rsph17029_0653 ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72554"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL25"
FT                   /protein_id="ACC72554.1"
FT                   /translation="MTGKTRPARAPRAEPENVAGANGSPDAPESSTPAPWPALSIERRP
FT                   LVSLVPYARNARLHSDAQINQIAASMREWGWTQPVLVSEDGMIIAGHGRVLAGLRLGLD
FT                   EAPVMVARGWSEPKIRAYVIADNRLAETATWDREMLGAELAELRDAFDLTLTGFTAGEI
FT                   DAMVVTDLPALGVEYDEHAADGVKFIKCPACGHEFPR"
FT   gene            complement(334208..334924)
FT                   /locus_tag="Bphy_3401"
FT   CDS_pept        complement(334208..334924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72555"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL26"
FT                   /protein_id="ACC72555.1"
FT                   /translation="MIPSIWRRRAAAAGFAIVSTSSAYGTAPVVNQGNAYANVPAPTNI
FT                   SAGNFLYAFYVADELTITPTLACSGWTTHRTYQYSGNNNYGFIGALYKVATASEPASYS
FT                   FGGTGVNTFSLCILNMTGVVTSDPFSGVTPTNAKANSATTTFATVTRPRAGAQLLVAVT
FT                   GSSYSPNVANAWTPPASYTLAGQITDLYNQPGKGEAQAAFSAVRTNAPAGATGSMTGTL
FT                   GKSYYNGTMNVVLNTG"
FT   sig_peptide     complement(334847..334924)
FT                   /locus_tag="Bphy_3401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.887 at
FT                   residue 26"
FT   gene            complement(334921..335682)
FT                   /locus_tag="Bphy_3402"
FT   CDS_pept        complement(334921..335682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3402"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG:
FT                   sus:Acid_1349 collagen triple helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72556"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL27"
FT                   /protein_id="ACC72556.1"
FT                   /translation="MSTPDQIDVVVVEGLRIVVDVTDLGSTAGPPGPPGPAGEQGEQGP
FT                   AGPAGSQGVQGDPGPEGPQGPQGPAGATGDAGPAGPQGDTGAQGVKGDTGADGPMGPAG
FT                   PAGPKGDTGDAGPRGIQGDPGPQGAAGATGAQGPKGDTGAGAVPLPVNAQTVTAYTLVL
FT                   TDAPAPKYEGGVTMTNAAANTVTVPPNSAVAFAVGALVTIAQLGVGQTTLVAGSGVTLR
FT                   MSSTLALRAQYSAATLWQIAANVWLVMGDLT"
FT   gene            complement(335679..337427)
FT                   /locus_tag="Bphy_3403"
FT   CDS_pept        complement(335679..337427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3403"
FT                   /product="Collagen triple helix repeat"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG:
FT                   bcy:Bcer98_2389 collagen triple helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72557"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL28"
FT                   /protein_id="ACC72557.1"
FT                   /translation="MSTPTVEIIDVVAIDAERMTVAVTVDIEPEEVDITDVEAANAILI
FT                   EIIEQSNRSGPPGPIGPQGPAGPQGVQGIAGNDGKDGATGPAGARGPAGPQGDAGPQGV
FT                   AGPAGTTGPQGATGPAGPRGDPGVAGPQGAQGLKGDQGPKGDAGPQGPAGATGSQGPAG
FT                   AMGLTGPQGAKGDPGPVGPMGPEGDTGPAGDQGPEGDTGAQGPQGATGSQGPAGPVGQT
FT                   GPQGVKGDTGATGEQGPKGDTGAQGPQGPVGPAADTSTFVQKSGDTMTGQLRIAPASGD
FT                   ASLLLNAQGSNLPRIYFQKGGAGPSMLYDGTSIGFANATLNAWNMAINDSGSVSFRNTV
FT                   NINNGTDLWLSAQSGSYSGRLMLNANGYAPFLRSNGANGNIEVVNSANSAVNFTIWDDG
FT                   HVTARGNVYASSAFLQTNGDVNGSQWVGGWLSAGINNICMTRTTGNTYKIGWDGGAGNL
FT                   NFYVDGTFIAYLHSNASDSALKANVEEVTPDSLTLIEQIDFCSYDIAGRHVDMGIIAQQ
FT                   LQTITPRWAYKPPTPDTPEPYYGDPEPQPYTPSPLAYDRDALLFDALRAVQQLSARVTQ
FT                   LEAMRP"
FT   gene            complement(337424..337795)
FT                   /locus_tag="Bphy_3404"
FT   CDS_pept        complement(337424..337795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72558"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL29"
FT                   /protein_id="ACC72558.1"
FT                   /translation="MKPGNYPLDIYRGDTYRWQFTLWSDTDKTQPVDLTDVIARSQIRD
FT                   KPAGKLLATIDCAITLPNVILGTLSADECAKLTATKCAWDLQLEWPNTDITTLLAGDVT
FT                   VTIDVTDSAPTLVSVKASA"
FT   gene            complement(337782..338105)
FT                   /locus_tag="Bphy_3405"
FT   CDS_pept        complement(337782..338105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3405"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   shw:Sputw3181_2485 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72559"
FT                   /db_xref="GOA:B2JL30"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL30"
FT                   /protein_id="ACC72559.1"
FT                   /translation="MGRWAHLYETVRWRKLRASHLHAHPCCVMCLALGFDTRATIVDHR
FT                   HPHRGDTRLFFDPSNLQSLCKLHHDSVKQTAEKRGLMPGCDEDGNPVDPKHPWNRGLHH
FT                   ETR"
FT   gene            complement(338244..338852)
FT                   /locus_tag="Bphy_3406"
FT   CDS_pept        complement(338244..338852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3406"
FT                   /product="GP66"
FT                   /note="KEGG: bpm:BURPS1710b_1674 GP66"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72560"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL31"
FT                   /protein_id="ACC72560.1"
FT                   /translation="MLAIFADTIVALHVSYAIRATRSVPATSMRNVLRTIMESAEMMNR
FT                   QQMDWLERLIGRPSRLVDFGGLSQSEVHAQAVMITEAVRRRLPEHESYVLMARFARDID
FT                   KCAGVYGVADHLLASGSPVTHREAITDLVWRRYLPREYQGGFSLRDIEGRTRVSKSSLG
FT                   RAARWLDDECDEVELSALHHLEDMFVEQGVVRYTVMEPA"
FT   gene            complement(338855..339085)
FT                   /locus_tag="Bphy_3407"
FT   CDS_pept        complement(338855..339085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_2200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72561"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL32"
FT                   /protein_id="ACC72561.1"
FT                   /translation="MQHECLWPGCGRLIPLAQWGCKAHWYKLPAQLRTRIGRAYRAGVD
FT                   TDTHPTKAWRRAHAAALAWIEQFEAQRASES"
FT   gene            complement(339046..339300)
FT                   /locus_tag="Bphy_3408"
FT   CDS_pept        complement(339046..339300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL33"
FT                   /protein_id="ACC72562.1"
FT                   /translation="MNRKTTESLAMRQHLAHDNDRMREALRTIVAMAETSPSALTMNDI
FT                   ARIARAALIAIPRENPALRHPETKEASCSTNACGPAAAG"
FT   gene            complement(339308..339802)
FT                   /locus_tag="Bphy_3409"
FT   CDS_pept        complement(339308..339802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3409"
FT                   /product="endodeoxyribonuclease RusA"
FT                   /note="PFAM: endodeoxyribonuclease RusA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72563"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL34"
FT                   /protein_id="ACC72563.1"
FT                   /translation="MRVAFTLRGEPASKANSREIVARKVRSKTDGTLKTRPMSIKSDKA
FT                   RNFERDALKQIPPSARVRMTGPVRVILKIFYATERPDLDESVILDVMQDRFRTVTVKGI
FT                   ERRELVYHGVYRNDRQVRQKFVFHGIDRVNPRAEVVIESLQEQQLALALEPDFDPFEVI
FT                   A"
FT   gene            complement(339805..340266)
FT                   /locus_tag="Bphy_3410"
FT   CDS_pept        complement(339805..340266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3410"
FT                   /product="DnaB domain protein helicase domain protein"
FT                   /note="PFAM: DnaB domain protein helicase domain protein;
FT                   KEGG: btl:BALH_4975 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72564"
FT                   /db_xref="GOA:B2JL35"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL35"
FT                   /protein_id="ACC72564.1"
FT                   /translation="MNFENDLRTRAERLVLSALMQDNGSLRHIATLRPSHFSHDTHGQI
FT                   FRHMLALIAKDVPADACSVFASMGHKRQLRKVGLFSYLCEIAALPAIPANIGFYACALT
FT                   SEELVSMALRLAPVLLDPAHDHRISDPGHCHDINRPLVMWAAVEPSTDR"
FT   gene            complement(340272..340820)
FT                   /locus_tag="Bphy_3411"
FT   CDS_pept        complement(340272..340820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A2361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72565"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL36"
FT                   /protein_id="ACC72565.1"
FT                   /translation="MTRAIPEHWLERLFARMESIYGSRFHDMWRDCEIAEVKATWREGL
FT                   AGITDEGLKRGVAALFHEKSPPTLPRFLELCQPQPAMHMPNRLLTDEVGCTPSHEARAQ
FT                   LAEIAKRIGMREPGIAWARRIFDEAARGHVLPGSRLQVALDAIKSWDATHGAIHREREP
FT                   GCDDEESLVADATTSPEQE"
FT   gene            complement(340801..341724)
FT                   /locus_tag="Bphy_3412"
FT   CDS_pept        complement(340801..341724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72566"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL37"
FT                   /protein_id="ACC72566.1"
FT                   /translation="MPRIRTVKPALFQHSTLFDAEHETGLPLRLAYIGLFTCCDREGRF
FT                   KWDERELKLHILPWDDLDFSRVLDALVTRGFVVEYASDTGEKYGWIPTFCKHQVINNRE
FT                   TASELPAPPEPLIQQRSATRDSRVPRACPTRAKRKGRERKGKEVNLKTKGTAQVSGTAS
FT                   RARAKQPPAPPTPSGPATITLAMRKAHISGAQPSNPRIIALAEQGVTPEAVNDACEEAH
FT                   RVHPDESIPVAYVCTILERWQREPQRSNGHGRAYGHASSGFDERAKDRKRAGDELTGRA
FT                   RRAREVDAGDVIDVTATEIGHDPRHS"
FT   gene            complement(341738..341953)
FT                   /locus_tag="Bphy_3413"
FT   CDS_pept        complement(341738..341953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3413"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   spc:Sputcn32_3522 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72567"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL38"
FT                   /protein_id="ACC72567.1"
FT                   /translation="MECKERLLRMPEVVRRTGMSSTTVYRRISDGTFPRPVSLGCNRVA
FT                   WLESEIDAWIFARVEERERDRETEAA"
FT   gene            342813..343724
FT                   /locus_tag="Bphy_3414"
FT   CDS_pept        342813..343724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3414"
FT                   /product="Phage-related protein predicted endonuclease-like
FT                   protein"
FT                   /note="KEGG: bld:BLi01440 YqaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72568"
FT                   /db_xref="GOA:B2JL39"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL39"
FT                   /protein_id="ACC72568.1"
FT                   /translation="MNTQRDAWLELRRKGIGGSDAAAALGQSRHKTSFQLYQEKTDDTF
FT                   DIVVSSEHAERMRFGQRMEAVIADEYAERYGVKLRRHNRIAHHPRYGFMLANYDRTIDG
FT                   RREGLEAKNVDALSYRFGEWGEPGSDMIPPEYMLQCAHYLSVSGYDVWHLAACIGGNRL
FT                   EVYHVERDAEMIELIEEGEATFWKHIERKEAPSLDYQHASAIPLLKRMYSGTNGATIKL
FT                   PAEAVALHFSKLDFDEQEKLMHAGSEAARARLLHMMGNASIGLLPNGGSYRRKIVERKG
FT                   YEVEPVEYVDFRYSKKGGHGDE"
FT   gene            343717..344793
FT                   /locus_tag="Bphy_3415"
FT   CDS_pept        343717..344793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oan:Oant_1553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72569"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL40"
FT                   /protein_id="ACC72569.1"
FT                   /translation="MNDVVAPNPFGNEPAAAVPVAAGALIAAEQSKAIAEVQAALYFAR
FT                   TQPRDPRRAMDRMLQECMRPGLAEEATYQYSRGGNDISGPSIRLAEMLAKRWGNMEAGV
FT                   KELSRRDGVSECLAYAWDYETNYRDVRTFTVRHWRDTKQGGYALKDERDIYEMIANYGA
FT                   RRKRACILALIDGDVIEAAVRQCEATLATKVEINDELITQMIERFETFGVTKEMIEKRI
FT                   QRHMSALTPALAVSLKRIYNSLRDGMSAPAEWFEMPDDPAANVAQPSGGTRAEAVKSRM
FT                   KAKKEAKLKAAAAKQDEAKPQYTYADVADRLKNAKSRDDLDIAADLIKSVIGDEALRTE
FT                   LGELYSTLAADFDNGDAS"
FT   gene            344790..345248
FT                   /locus_tag="Bphy_3416"
FT   CDS_pept        344790..345248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72570"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL41"
FT                   /protein_id="ACC72570.1"
FT                   /translation="MTLYATREGIETAFASAFDEGSDEMIDDLLYQYFSKLTCASFEVP
FT                   GVSQCIDSWALLDSVLRMIEPTDVFGTGGTAIRSDSAIGELIHGLIGLGECLAETRMAN
FT                   LFGVSRAVMGVVAGSIPSGLEPADTFEERALRFARLLAHEAREDEVRV"
FT   gene            345245..345490
FT                   /locus_tag="Bphy_3417"
FT   CDS_pept        345245..345490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72571"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL42"
FT                   /protein_id="ACC72571.1"
FT                   /translation="MKSIEQRWHDFSTFAIPHDAPPVQFHEMRKAFYAGFKSMLDVDCE
FT                   LAELTDEDAIVLLDSYYHEAHGFLNGGLIISIVRER"
FT   gene            345493..346017
FT                   /locus_tag="Bphy_3418"
FT   CDS_pept        345493..346017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72572"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL43"
FT                   /protein_id="ACC72572.1"
FT                   /translation="MLDFIRHPVRILHLNVRTEVHGDEERTAVDIKLGFDLPNRALDKL
FT                   SPSLRASLYEVLDDPNLPVLGPDGQHLTHVKNPQLGTLKWAGEYAPVGLHFHTGNGRSA
FT                   KGDLLFPEATFGKLAITAKEGGTCACVARAQILPNPDETAKLVGLLKHEIPATLDSAGA
FT                   VDTEVEGADDE"
FT   gene            346010..346180
FT                   /locus_tag="Bphy_3419"
FT   CDS_pept        346010..346180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72573"
FT                   /db_xref="GOA:B2JL44"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL44"
FT                   /protein_id="ACC72573.1"
FT                   /translation="MNDRPRIPRQPLAPSAKIFAAMFVALFIALFALLMTGAVAGIVRM
FT                   VRWIMSTQCGG"
FT   sig_peptide     346010..346132
FT                   /locus_tag="Bphy_3419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.975 at
FT                   residue 41"
FT   gene            346226..346630
FT                   /locus_tag="Bphy_3420"
FT   CDS_pept        346226..346630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72574"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL45"
FT                   /protein_id="ACC72574.1"
FT                   /translation="MNTDEGLTDDDGNVETRISVLDPRALGLLLETVRKIGMNVGLRVA
FT                   YAEVMKYARERIASSDEELARAGEDTSQAFITMGEISAWRKLAALYEDAPAHYTERADS
FT                   HAAGLTRALIRIGLLRAQDAPDAQADLQRE"
FT   gene            347223..347495
FT                   /locus_tag="Bphy_3421"
FT   CDS_pept        347223..347495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72575"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL46"
FT                   /protein_id="ACC72575.1"
FT                   /translation="MGEGAYPPAADTGDGRDASGEKKARQVKDFPEASGRFLRSGETAR
FT                   ETGHSRPRLDGRFGDAAADTATFDGHPAPRAVQSRFEFGDERSGL"
FT   gene            347505..348611
FT                   /locus_tag="Bphy_3422"
FT   CDS_pept        347505..348611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72576"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL47"
FT                   /protein_id="ACC72576.1"
FT                   /translation="MTKNTVMSADDLFAAMKSDFEGKRRRKFAAGLLVALIDFMKALDT
FT                   PSLKLKGLDEFYAKFPRQIKTAAGLGANTLIVSKPAGGTVSIRPFYGAIENFFRNKEKR
FT                   YDFPSAAPHATQSWPDYVDWIGSLATFDLPTLDSLRDKVVKYVLEKLPSHEVDSSEIAK
FT                   DPPVFEIFLRDFNFRAVGRGEPTGSGFQGAVFAYIRADSPHLQVEVDKTRTGSKRVHRI
FT                   GDIDAWDGSRLVKTCEVKHFKVMTADAIDFTAFAGEAGKRRAGAYLVAEDFESEETRSA
FT                   IEELGVKTMTLEDLKHHVSVWDPLKQQIALQAFEYFITHREQNSSLTSRFRQFCLDKGF
FT                   RYVWSRPVVDDYGNQVSLLVLDESWKAD"
FT   gene            348742..349866
FT                   /locus_tag="Bphy_3423"
FT   CDS_pept        348742..349866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3423"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rca:Rcas_1171 DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72577"
FT                   /db_xref="GOA:B2JL48"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL48"
FT                   /protein_id="ACC72577.1"
FT                   /translation="MSLAPGVIRDSIIEYLAMVGKDASTEEIVAAVKRSVGAAPTSSVR
FT                   SYLSLNTPTTFERVGRGRYRLRSASLLDHHATRETKILKLGQATLHQGDCFEWLASQKP
FT                   SSVHAVVTDPPYGLVEYTAKETAKLRAGKGGVWRIPPSFDGHQRAPLPRFTVLTDTDRQ
FT                   ALHAFFKRFGTLIGRVAVPGANVVIASNPLLAHIVAEAMGLAGLELRGYIARQVMTMRG
FT                   GDRPKNAHEEFDGVSVMPRSQWEPWVVLRKPLEGRVQDNLRRWGTGGFRRPSKERPFGD
FT                   LIKSHPTPASEKKIAPHPSLKPQAFMRQIVRAVLPLEEGIVLDPFMGAGSTLAAANAVG
FT                   YQSCGVELDEEFFALAAKAVPKLAAIPVRDLDAE"
FT   gene            complement(350060..351373)
FT                   /locus_tag="Bphy_3424"
FT   CDS_pept        complement(350060..351373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3424"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bxe:Bxe_A3658
FT                   putative bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72578"
FT                   /db_xref="GOA:B2JL49"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL49"
FT                   /protein_id="ACC72578.1"
FT                   /translation="MANERINRELIRRLEAERKAKIAAGGTLKVREIYDDLQRGFGVRM
FT                   SVKGSLSFVYRWTRPDGGQQRIVIGDASMTVEEARKALAKFIARTDHKVDDTSVRVTKH
FT                   ERRVADAKNVGMPTVGDYLDGDYRTFWLGSTRSETPEQNIKNIRRDFPDLMDRRLDEVT
FT                   RPAMKKWIEKRLADGCKATGINRVLGSIGGLFSYAVEHEIIAANPCAKLRCKIDPEEDS
FT                   EHGRELTAEEEQRLRVVLDERETRIREEAAARHDSRKVATIPGEFHSFVDHVKPAILLA
FT                   LNTGMRRSELLRARWTAIDWKAQTIRIEAWTSKVKRTRVIPMNVEALSILKAWRRQTRF
FT                   EFIFTNEIGECLREVRDWNKIKREAQIRDFRFMDTRHHTATRMINEGASPYHVQKLLGH
FT                   KDGRMTQRYMRARDVKLAEAVALLDVPRQADADHPVAA"
FT   gene            complement(351638..351928)
FT                   /locus_tag="Bphy_3425"
FT   CDS_pept        complement(351638..351928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72579"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL50"
FT                   /protein_id="ACC72579.1"
FT                   /translation="MQINFPKEVPEYSGRELTLAFPAMVDGERVECMITAEALEDHFGA
FT                   ASPRIEDMLGAFSTHRERIEAATRRLLSETGAQCVVLRSGYVRFYEANWRA"
FT   gene            complement(352161..352427)
FT                   /locus_tag="Bphy_3426"
FT   CDS_pept        complement(352161..352427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A0892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72580"
FT                   /db_xref="GOA:B2JL51"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL51"
FT                   /protein_id="ACC72580.1"
FT                   /translation="MVRMELRVVLATLAIFIALGGIGLSIHGSLYYLDREIWTGVILIA
FT                   IGIAGCVTMLTLWPRDLPDRTPPEHPADEASPHEHHPHLPTQF"
FT   gene            352713..354659
FT                   /locus_tag="Bphy_3427"
FT   CDS_pept        352713..354659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3427"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B1075 sigma54 specific
FT                   transcriptional regulator with GAF sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72581"
FT                   /db_xref="GOA:B2JL52"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL52"
FT                   /protein_id="ACC72581.1"
FT                   /translation="MTQRSVTPSVMGRADALAQAHARSREFGLRASEAPDFHPLQPFAL
FT                   RDLVELNRSLYAHALPVMETLHAQIVDTESMVLLTDSNGVILHSLGDSDFVEKASRVAL
FT                   CAGVSWSEAHRGTNAIGTALAEGEPTVVHGGEHFLEANRILTCSCAPIADPYGRTIGAL
FT                   DVSGDPRGFHKHTLALVRMSAQIIENQLFANQFGNAVRVRFHARSEFIGTLFEGLAAFG
FT                   ANGTLLAANRSALFQFGRPLDALLAQPFEALFGTAFPAALQQASRAPGECLTLMLPSGV
FT                   RVLARAEYAARPAFSADARPQHTAAPVPPAPASCKPRAAAITFATLDTGDARMAAVLGR
FT                   VEKVRGRDIPLLVLGKTGTGKEWLARAMHEESPRRDAPFVAVNCASLPDTLIEAELFGY
FT                   EDGAFTGARKRGNVGKIVQADGGTLFLDEIGDMPLAQQVRLMRVLQERSVVPLGGTRAV
FT                   PVDVRVVCATHRNLRAMIEAGTFREDLYYRINGLVVTLPALAERTDLPVLVERILGRLR
FT                   LVEPDSDRMPARVSLEVLDCFARCRWPGNLRQLANVLRTAGIMAEGAAEIGLDHLPDDF
FT                   LHDCEPPRDTPLHALPATDPPLAARPANMEELQATLIEQTLARNNGNISAAARELGLAR
FT                   NTVYRYMRMRTTH"
FT   gene            354716..355105
FT                   /locus_tag="Bphy_3428"
FT   CDS_pept        354716..355105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3428"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: bte:BTH_II1820 2Fe-2S
FT                   iron-sulfur"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72582"
FT                   /db_xref="GOA:B2JL53"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL53"
FT                   /protein_id="ACC72582.1"
FT                   /translation="MSREEQSRSESLQPPNETPHEQEERTYAVRVEPLGRTFEAPGSLT
FT                   VLEAAGFANLHLPRMCRNGTCRTCLCRLESGSVRYTVEWPGVSADEKAQGYILPCVAVA
FT                   QSDLVIDVPDAAEVPSAPTPPVRRF"
FT   gene            complement(355109..355306)
FT                   /locus_tag="Bphy_3429"
FT   CDS_pept        complement(355109..355306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3429"
FT                   /product="protein of unknown function DUF1653"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   bxe:Bxe_B1072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72583"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL54"
FT                   /protein_id="ACC72583.1"
FT                   /translation="MTVRYRHYKGGIYEFICEATLESDPSITMIVYRADNGTIWTRPSS
FT                   VFFEMIEHEGQTVQRFAPIN"
FT   gene            complement(355376..356020)
FT                   /locus_tag="Bphy_3430"
FT   CDS_pept        complement(355376..356020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3430"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: bcn:Bcen_0364
FT                   YheO-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72584"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL55"
FT                   /protein_id="ACC72584.1"
FT                   /translation="MRKKKPSPVKDLLLTRYAPIADGIAALFFPYAEVVIHDLHDQTVL
FT                   YLANNLSKREIGDDSALEETEHSARERVIGPYEKLNWDGRRMRCVSNVLFDDNGQAAGM
FT                   LCINFNIAVFEDVRSTLDLFIKGAGVVAQPDELFRDDWQERINTFLHGWLRERQIGLNG
FT                   LTREHRRELVEALYAEGAFRGKSSANYVANVLGMGRATVYKHLKQMKEGAN"
FT   gene            complement(356111..357076)
FT                   /locus_tag="Bphy_3431"
FT   CDS_pept        complement(356111..357076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3431"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bur:Bcep18194_A3938 ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72585"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL56"
FT                   /protein_id="ACC72585.1"
FT                   /translation="MKTALPLAVDEQAVRETLPALDVRRALTAMFRALASSEAVQPPQT
FT                   LTLLPNGAGDFITYLGALADAKVFGAKLSPYIVTGGRPIITAWTALMSMETGQPLMWCD
FT                   AGLLTTERTAGTTALAVDQLARADAARLAVVGAGAVGLAHLRHVAPLRAWESIRVYSPD
FT                   LASNHEKRAAVQAAEPRAEASASLAACVKDADVVMLCTSSGTPVLPRDALTKPALVTSI
FT                   STNAANAHEIDPAWLPEMDVYCDYRATTPASAGEMKLAAQQGWSPEDVQGDLPSLLAGT
FT                   CAKPAYGRHAFFRSIGLGLEDVAIASELYRHLSNRRDEAQ"
FT   gene            357422..358201
FT                   /locus_tag="Bphy_3432"
FT   CDS_pept        357422..358201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3432"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bch:Bcen2424_0849 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72586"
FT                   /db_xref="GOA:B2JL57"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL57"
FT                   /protein_id="ACC72586.1"
FT                   /translation="MNLKLSFAAAVLAMTAGAACAQSSDTLRFGIEAAYPPFESKSASG
FT                   QLEGFDVDVGNAVCAKLKMKCVWVENAFDGLIPALQARKFDVINSAMNITSKRKESIAF
FT                   TPPIYIVPIVMIAKHGSGLKPDVKNLQGKHVGVLQGSSQEDFLKAHWANAGVQVVSYQD
FT                   QDQVYADLVAGRLDAAVQEAQTASDGFLNKPAGAGFEIVGEPLKDPSTLGEGTGFGLRK
FT                   GDKALQAKVDGALAELKKDGTLTSLSQKYFKRDIIAK"
FT   sig_peptide     357422..357487
FT                   /locus_tag="Bphy_3432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.907 at
FT                   residue 22"
FT   gene            358334..359578
FT                   /locus_tag="Bphy_3433"
FT   CDS_pept        358334..359578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3433"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcn:Bcen_0367 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72587"
FT                   /db_xref="GOA:B2JL58"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL58"
FT                   /protein_id="ACC72587.1"
FT                   /translation="MDFDVIVLGAGIVGVSSALHLQDRGQRVALVDRRAPGEETSFGNA
FT                   GLIERSSIVPYGFPRKLGTLLRYARNQSTDLYWDYKALPAYATWLARFWWESSPQRLAA
FT                   AARDMMPLIAACVDEHDRLITRAGLDALVHDGGWIEAFRTRAAFEHEAKASEDAVREHG
FT                   LHVSVLDTASLRAREPSVGDGICGAIHWKDPKSVKNPGALVKGYARLFEAEGGTFVTGE
FT                   ATSLRPSGDAWTVQTQHGTLSAKQVVLALGPWSDTVFGPLGYKIPLRAKRGYHMHYRPA
FT                   RHMLSVPIVDTERGYVVAPMDGNRLRVTTGVEIAERGAPPTGIQLERVEPLARATFGLG
FT                   ERIDERPWLGMRPCTPDMRPVIGPAPRHRGLWFAFGHNHHGLTLGPVTGRLLAEMMTGQ
FT                   TPFTDPRAYRVERFG"
FT   gene            complement(359701..360258)
FT                   /pseudo
FT                   /locus_tag="Bphy_3434"
FT   gene            360333..360467
FT                   /locus_tag="Bphy_3435"
FT   CDS_pept        360333..360467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0242 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72588"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL59"
FT                   /protein_id="ACC72588.1"
FT                   /translation="MHVEHAYRQLAFRRLADTPTISQLRVWSPSNRNPCLARFLEMAN"
FT   gene            complement(360547..361314)
FT                   /locus_tag="Bphy_3436"
FT   CDS_pept        complement(360547..361314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72589"
FT                   /db_xref="GOA:B2JL60"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL60"
FT                   /protein_id="ACC72589.1"
FT                   /translation="MVGKLLMRGMLAGIVAGLLTFAFARVAGEPLVDTAISLEHKLHAE
FT                   HDHADAGGHDHDEELVSRGTQAGLGLLTGVVAYGMAFGGLFALSFAYLHGRVGKLSARA
FT                   LSAWLALGAYVAVVLVPTIKYPANPPSVGDPDTIGTRTGLFFLMIVTSLVVAVFSMKVR
FT                   KHLMPRLGVWNASITGGIVFIAIIAAIQIALPTVNEVPEAFPAVVLWKFRVTALGMQAI
FT                   TWAVIGLLFGALAERSERIARESNAAARKSAYL"
FT   sig_peptide     complement(361231..361314)
FT                   /locus_tag="Bphy_3436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.919 at
FT                   residue 28"
FT   gene            complement(361336..361560)
FT                   /locus_tag="Bphy_3437"
FT   CDS_pept        complement(361336..361560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72590"
FT                   /db_xref="GOA:B2JL61"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL61"
FT                   /protein_id="ACC72590.1"
FT                   /translation="MNDTALHHAGQTDEPAITPIPLRELLPWIVFGGLLMLLALYFVGA
FT                   EQGATSLFPGMYVHEFVHDGRHLLGFPCH"
FT   gene            361798..362373
FT                   /locus_tag="Bphy_3438"
FT   CDS_pept        361798..362373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3438"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bxe:Bxe_B2602
FT                   putative phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72591"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL62"
FT                   /protein_id="ACC72591.1"
FT                   /translation="MRTRLLLISHPATAAQRKGAFPDDDPLDAPAADEAAAFRASNAPL
FT                   LDADLALSSPAACARDTAKAFGLAAHALAALADADYGRWRGRRLLELSDEEPDALAAWA
FT                   RDPSAAPHGGESFDALRFRVGGWLDALEHRGNTVAVTHASVIRAALIHVLQAPPAAFAR
FT                   IDVPPLAVVELRRSERGWTWRPTPHRPA"
FT   gene            complement(362377..362784)
FT                   /locus_tag="Bphy_3439"
FT   CDS_pept        complement(362377..362784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72592"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLF9"
FT                   /protein_id="ACC72592.1"
FT                   /translation="MTLRTIAPLALWTVAQLAVAATGDASCGVLAGGGAADGTGASGVP
FT                   VASGFALRDGEPVDFIAGGKIVRGTLHVLTDDGIYRAYWQPQGRPERYVLANAGADAVR
FT                   LIATPAQGSPAASGMPGTTLNPQQVLSCPAF"
FT   sig_peptide     complement(362722..362784)
FT                   /locus_tag="Bphy_3439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            362964..363182
FT                   /locus_tag="Bphy_3440"
FT   CDS_pept        362964..363182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72593"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG0"
FT                   /protein_id="ACC72593.1"
FT                   /translation="MATLEAFRTVLDDARTPEIIRNHIIDSLQYALRNHGQIFTSKEVE
FT                   WLAKWDDARIPLAATRELQKRMTQTAE"
FT   gene            363705..363989
FT                   /locus_tag="Bphy_3441"
FT   CDS_pept        363705..363989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72594"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG1"
FT                   /protein_id="ACC72594.1"
FT                   /translation="MTQGVKTYKGYEIHPLVYPRRTAAGVTHRNSIDSGYDASVRICRV
FT                   GANPAADGRVFRFAYFRPFEGAGKARMACIEHASQVIDGRVDGQSVSDL"
FT   gene            364126..364389
FT                   /locus_tag="Bphy_3442"
FT   CDS_pept        364126..364389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3442"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   bxe:Bxe_B1067 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72595"
FT                   /db_xref="GOA:B2JLG2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG2"
FT                   /protein_id="ACC72595.1"
FT                   /translation="MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGRMRKNHI
FT                   RILAGDRVTLELSVYDLTKGRINFRHKDERSSGPRSAPVRRR"
FT   gene            complement(364531..365238)
FT                   /locus_tag="Bphy_3443"
FT   CDS_pept        complement(364531..365238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3443"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_C0727 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72596"
FT                   /db_xref="GOA:B2JLG3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG3"
FT                   /protein_id="ACC72596.1"
FT                   /translation="MATRPLTPPPAAHSDTVEDRIYASITAALLEGRLRPGAQLVERDL
FT                   AAAFGCTRGALRKVLARLGFEGKLVLEANRGAFVPSPSEEDVRQVYRARQIVEAGIVAA
FT                   LCGALTAQDRRALKAHVASEKKALKDARIDEQVRLAGHFHVLLTQIAGGAALQGFVAQL
FT                   VAKTELYKALYDPSKGTTCSADEHAHLIQALDAGHLNDALKAMREHLAELEERVVTRMR
FT                   SGASDDPGAVFRG"
FT   gene            365409..366668
FT                   /locus_tag="Bphy_3444"
FT   CDS_pept        365409..366668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3444"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pap:PSPA7_2739 probable MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72597"
FT                   /db_xref="GOA:B2JLG4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG4"
FT                   /protein_id="ACC72597.1"
FT                   /translation="MNRTSRVDTPIFPRAARSAALSWHDGLWLAVIVAIGINLRPLLTS
FT                   VSPLLATIRAATDLSFSGASLLTSLPVVAMGFGALGAGLLTRVVGEARGVALGLLAIAA
FT                   ACAARFAASSGAALLMTALLAGIGVAVIQALLPGVMKQRFHSRVPLAMGLFSASIMGGG
FT                   GLGASVSPCVAKAFDSWRAGLAIWAIPAMLAGVCWLVLQRSMLADQRVASPAAAHARHT
FT                   SHVAMWRKRRAWTLGLYFGLVNGGYTTLVAWLPAYYQQRGASVAHSGSLLAAMTVFQAA
FT                   SAMLLPLAAALFRDRRPWLVAGLSAQLTGVVGLLAWPDAAPLAWVAITGAGLGGTFSLT
FT                   LVTSLDHADDHRVAGRLVAFVQGVGFIVAAISPIVAGRLRDLTGSFTAAWTMLAVCIAA
FT                   MIALTFAFSPRSYARWLGAR"
FT   gene            366960..367535
FT                   /locus_tag="Bphy_3445"
FT   CDS_pept        366960..367535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3445"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; KEGG: bxe:Bxe_B1048 response regulator receiver
FT                   (CheY) and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72598"
FT                   /db_xref="GOA:B2JLG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG5"
FT                   /protein_id="ACC72598.1"
FT                   /translation="MLRVLLVTDTDKPIGELRDALARLGYDMLAATASPQALHETVESE
FT                   RPDVVIIDTESPSRDTLEQLAVMNATAPRPVLMFSNDANQQLIRDAVGAGVTAYLVEGL
FT                   ATERLAPILEVALARFAQESQLRERLAHAENELAERKLIDRAKRMLMDSQKMTEHAAYA
FT                   TMRKRAMNQGVKLAEVARQIVAAADLPD"
FT   gene            367546..368688
FT                   /locus_tag="Bphy_3446"
FT   CDS_pept        367546..368688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3446"
FT                   /product="ABC nitrate transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: bxe:Bxe_B1047 ABC nitrate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72599"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG6"
FT                   /protein_id="ACC72599.1"
FT                   /translation="MNSTANTALSADSGKLEKSHLRLGFVALSDAAPLVAAKLLEFGHA
FT                   HGLTIELLKQPSWAAIRDKLLSGDLDAAHSLYGLVYGVQLGLGGPQTDMAVLMVLNRNG
FT                   QAITVSNRLAAALDEHKTLPAALATLGRKPVFAQTFPTGTHAMWLYYWLASQGVDPLRD
FT                   IDSVVIPPPQMVDALARDRLDGLCVGEPWNAVAQERGVGRTIAYTSEVWPDHPEKVLAS
FT                   RRDFVTRYPNTARALVQTMLEACRWLDDDEHRVEIARRLAADEFLGVPAASIASRLVSA
FT                   GCDETRRPVAFFADGAVNYPHPAEGVWFFAQYARWGMVHSRGDFARIANEVNQVQLYRQ
FT                   AAINVGVAVRDDAPSVQLIDGRRWDGNFDRAYLQGFSIKA"
FT   gene            complement(368803..369744)
FT                   /locus_tag="Bphy_3447"
FT   CDS_pept        complement(368803..369744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3447"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bam:Bamb_4564
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72600"
FT                   /db_xref="GOA:B2JLG7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG7"
FT                   /protein_id="ACC72600.1"
FT                   /translation="MKRKLMMAAALMMTAAATAQAADPAACRNVRFADVGWTDIAATTG
FT                   LASTIFQGLGYSPTKTIASVPITFAGIKSKQIDVFLGYWAPTMDPIIQPFVKAGTIKVL
FT                   ATPNLTGAKYTLAVPDYVYNGGLKNFSDIAKYADKLDGKIYGIEPGNDGNALIKKMIDG
FT                   NQFGLGKFKLVESSEAGMLVEVNRAVRDKKWIVFLGWEPHPMNVQMKIDYLAGGDDVFG
FT                   PNYGEAKVFTATPPDYAARCPNAAKLVSNLQFTTAIENHVMVPIMNKEDANKAALAWLK
FT                   ANPQALDKWLAGVQTFDGKDGLPAVKAYIAAH"
FT   sig_peptide     complement(369679..369744)
FT                   /locus_tag="Bphy_3447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            complement(369796..370773)
FT                   /locus_tag="Bphy_3448"
FT   CDS_pept        complement(369796..370773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3448"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B1614
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72601"
FT                   /db_xref="GOA:B2JLG8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG8"
FT                   /protein_id="ACC72601.1"
FT                   /translation="MTSTRAEAPLSDLAHVGFLTLPSFSMIAFTSAVEVLRMANYVSRA
FT                   QHYRWSIITHDGVPVRASNGLTVKPTRTLEEAGMPDVLIVCGGTQIRNAVDTNVKTLLA
FT                   EAASQGVPLGGICTGAYALMAAGLLDGYRCSVHWEDLSALHREYPHVRFADELFVIDRD
FT                   RLTCTGGTAPLDLMLDLVSSRFGQNLAAQVSEQFILERIRSASDPQPIPVDARVGFSRA
FT                   ELIEVVRLMEANIEEPLSLEELARLVQLSQRHLQRMFKVYLSVSPTHYYLSLRLRRARD
FT                   LLRTTDASIARVTAVCGFHSPCHFSKAYRAQFGHAPSVERRHAS"
FT   gene            complement(370907..371812)
FT                   /locus_tag="Bphy_3449"
FT   CDS_pept        complement(370907..371812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3449"
FT                   /product="choline ABC transporter, permease protein"
FT                   /note="TIGRFAM: choline ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; KEGG: bxe:Bxe_B1615 ABC proline/glycine
FT                   betaine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72602"
FT                   /db_xref="GOA:B2JLG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG9"
FT                   /protein_id="ACC72602.1"
FT                   /translation="MSEIIPLGRWVDQSVHYLLDHDASTFDSIGKAIESFAAMIEHGLQ
FT                   AVPMWALMALFIAVGLWRVGWRFAIFATASLLLIYATGFWDQTVITLGLTLSSTLISLV
FT                   FGIPLGIWAAKNKHVQMVVRPILDLMQTMPAFVYLIPAAMLFGLGRVPGILSTVIFAMP
FT                   PAVRLTSLGIKHVNREIVEAGQAFGCTPWQLLYKVQFPNALPSIMQGVNQTIMMALSMV
FT                   IIASMVGAGGLGNDVLASIQRLDIGLGFESGLSVVLLAIILDRITESFGRTPGSATAPR
FT                   FAGLRSVMRVRREQPAVAQS"
FT   gene            complement(371805..372977)
FT                   /locus_tag="Bphy_3450"
FT   CDS_pept        complement(371805..372977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3450"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bpd:BURPS668_A2027 glycine betaine/L-proline
FT                   ABC transporter, ATP-binding subunit; TIGRFAM: glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72603"
FT                   /db_xref="GOA:B2JLH0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH0"
FT                   /protein_id="ACC72603.1"
FT                   /translation="MKSPKVVVEGLCKVFGPNPKLAQDMLSRGASKDEVFAKTGHVVGV
FT                   HNVSFDVQEGEIFVLMGLSGSGKSTLIRLINRLVEPTAGKVIIDGRDVAAIKRSELTSL
FT                   RRTDMSMVFQSFALMPQRTVLSNAAFGLEVAGVGRKEREKRALDVLEQVGLATFAGKLP
FT                   AELSGGMQQRVGLARALAVNPSLMIMDEAFSALDPLKRKEMQNVLLELQKNQQRTILFV
FT                   SHDLEEALRIGSRIAIMEGGRVVQIGTPQDIIANPADDYVRAFFEGVDTSRYLTAGDLM
FT                   QANGVPVVRNLDHASVAESLNGSAEYAFVLDGERRIRGFVTRDSIGSATPSLNKVECIS
FT                   RGAPLEHVVSRVCASATALPVVDDEDRYCGSVDQAAVLKVITRNRGAAHV"
FT   gene            373440..375152
FT                   /locus_tag="Bphy_3451"
FT   CDS_pept        373440..375152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3451"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bxe:Bxe_A4479 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72604"
FT                   /db_xref="GOA:B2JLH1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH1"
FT                   /protein_id="ACC72604.1"
FT                   /translation="MRKLRSQSWFGRNDKDGFIHRSWMKNQGIPHDEFDGRPVIGICNT
FT                   WSELTPCNAHFRELAEYVKRGVREAGGLPLEFPVMSLGESNLRPTAMLFRNLASMDVEE
FT                   SIRGNPLDGVILLVGCDKTTPALLMGAASCNLPALAVSGGPMLNGRFRGRTIGSGTGVW
FT                   QMSEEVRAGTMSQQEFIDAESCMNRSRGHCMTMGTASTMASMVESLGIGLPHNAAIPAV
FT                   DARRQVLAHVAGRRIVEMVRNDMTMDKILTREAFENAIRTNAAIGGSTNAVVHLIALAR
FT                   RIGVDLSLDDWELGSNVPCLVNLQPSGEYLMEDFYYAGGLPAVLRQLGEQGLLHRDALT
FT                   VNGRRIWDNVSDAPNYDQKVITTFEAPFKPHAGIAVLRGNLAPDGAVIKPSAATASLLK
FT                   HRGRAVVFENVEELHAKVDDESLDIDEHCVMVLKGAGPKGYPGFAEVGNMPLPKKVLQK
FT                   GITDMVRISDGRMSGTAYGAVVLHVSPEAAAGGPLALVQTGDMIELDVAARRLHLDVPD
FT                   EELARRRAAWQAPELPARGYYRLYVEHVLQADQGADLDFLVGASGAPVPRDSH"
FT   gene            complement(375468..375713)
FT                   /locus_tag="Bphy_3452"
FT   CDS_pept        complement(375468..375713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_2574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72605"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH2"
FT                   /protein_id="ACC72605.1"
FT                   /translation="MNKHIIAAALAGLFSIAAFAQASAPAATEAAPAAASAPAPAPAPA
FT                   PAAKHHAKKHHAKKHHAHKKAAPAKAASDEAASAAQ"
FT   sig_peptide     complement(375651..375713)
FT                   /locus_tag="Bphy_3452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.552 at
FT                   residue 21"
FT   gene            complement(375896..377194)
FT                   /locus_tag="Bphy_3453"
FT   CDS_pept        complement(375896..377194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3453"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   bxe:Bxe_B0733 type I secretion outer membrane protein,
FT                   TolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72606"
FT                   /db_xref="GOA:B2JLH3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH3"
FT                   /protein_id="ACC72606.1"
FT                   /translation="MCRFKASLFAVALCVAGTAAHAADLVTVVQQALGHDADLAQARAA
FT                   YVAAQEAVPQARAALLPQISAGWGRTYNSIETEGFPRQSYWQNGWTVSLTQPIFDWTRW
FT                   AAYRQADYVEARGGVDVGAAQQAALLRAVRAYFEALAADDEVTRTADYRAAVDAHCHVL
FT                   QRNRAAGEATVVDVREAQTALDQATLQHADAQSALQTKRRALQQATGVPFDALARLPDG
FT                   LALPRLVPEDADAWAAQAKDHGYGVQQKQLDWQIAKLDVSKAEGAHYPSVYATGTYTPA
FT                   GAASGYARPATTTTGMLSVSIPLYAGGAMQSRVRETQALQDKAQEALVSAVRAADASAR
FT                   DNFARYQEGRTRVELLARFVASCRDTLAATRIGYKVGTRTSTDVLRAIDMFYAAQRDLF
FT                   AARYDTVVALMLLKGDTSTLGLTDVVQINAVLH"
FT   sig_peptide     complement(377126..377194)
FT                   /locus_tag="Bphy_3453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(377187..379307)
FT                   /locus_tag="Bphy_3454"
FT   CDS_pept        complement(377187..379307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3454"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B0732 ABC
FT                   bacteriocin/lantibiotic exporter, fused ATPase inner
FT                   membrane and peptidase subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72607"
FT                   /db_xref="GOA:B2JLH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH4"
FT                   /protein_id="ACC72607.1"
FT                   /translation="MRMIFQNEVAECGYACLAMVLTHLGRATEVRELSVYRPISANGLS
FT                   LMDLYDMATEFGLAVQAYRFGIEDVPTIRRGSIVHFGGAHFVVFEKCGRGYVQILDPAT
FT                   GRRRIAMDTFSSAVSGFLLECSPTPSMPRIRAKSQVPRALVRIRALNPDLRGHLGKLMF
FT                   VMTGSQFAILAAPYLGNLTLDYVVAADNLNLLNVLVLTFAGIFAVGALSQYVESRLIEL
FT                   LHQRVQIHATQGLLGHLLRNPMSWFEKRHVGDIFARVKAQDEISRHATRTVTHMCVDAS
FT                   VGLLALALMLVQSPLLTGVALAMFGLYLSIALGVFAPMRDNHALLLETSARCDDALIET
FT                   IRAASLIKLAQGETRRTAMFMTKYREYVTALLTGNRLGSARDSCLKAVQYADTLAITWV
FT                   SARLMLGGKISVGVFYSFLIYKSLMSDRFASVVNAVFARFMLSVPVARVDDIVECEEER
FT                   YTPSSDIQRATEVRRFERIEVRGVTFSYGVSDQPVLKDASLEIRAGDKIAITGPSGAGK
FT                   STLFKLLSAAEPLQYGHIALNGIAWQNLTVDEIRRHAAHMRQGDLILHGSIADNVSLFS
FT                   GSIDEERLQSTLENVGLWNDVMRLPMRTRTIISDTIANISAGQRQRLLLARALYQERSL
FT                   LLLDEPTSNLDPASVSQIGELLQRLACTVVVITHDTSLAASFDQRYRLVDGALVRELSG
FT                   PTHLNAVDPLHV"
FT   gene            complement(379313..380515)
FT                   /locus_tag="Bphy_3455"
FT   CDS_pept        complement(379313..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72608"
FT                   /db_xref="GOA:B2JLH5"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH5"
FT                   /protein_id="ACC72608.1"
FT                   /translation="MEPTSLPQFNDVPWRWIAYGASTIVAGAVAFGFVHEVELKQDVQC
FT                   EIVSPSDVKVQGTSGLVSSVYVHPGERVHQGTPLFSVQRDLSLASDGRQRPQFDEQMRD
FT                   EQIRMVDLQYDQRRAQLAAQLDASNATAAARQAEARALDEQIEQNRQLVSEAQQKLGRL
FT                   QSVSDYVTADRIEQASADTHQMKISVAQGLARRQQLAGEIVALHSTQGNLAAQLKENDA
FT                   RHVREIQDIRMRFEQARQDSTISAPKSGVVAFSNLVPGRTLDAADVALVIVTDDRSALR
FT                   AALRMPSRRRGFVHTGQTVRLKFDAFPYVKFGTYDARVDAISPTTIQSGMSVAPASPAA
FT                   PKETGDGDFMAWATLRGRTFDYGKQRFDILPGMRATASIVVERRTIAEWVLEPLFRTLR
FT                   G"
FT   gene            complement(380559..381542)
FT                   /locus_tag="Bphy_3456"
FT   CDS_pept        complement(380559..381542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72609"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH6"
FT                   /protein_id="ACC72609.1"
FT                   /translation="MPPDSPMNILSRLHMPLCVLRLACTGALRCARLGARCVVMSRVPV
FT                   AALQPIAACAALLRALFDANGRALASERADFCREVMKVASPGRVRLLAARTRESLIDQR
FT                   LHFGRQRRFDEAWPDLQRIAGLLAQAIGQIRRDAPGSPVIVSPFHYVSQYANIYVIDDL
FT                   RVKLGLARIGVVSGMPRDLYGSDGAMIPDIDVLYTYDQNNRSGLGLQVARSLRRHGVVV
FT                   VFADVPPYTLHRYPMETVGVSIFGSAARIHNGVFRMGGPLGAVLLPFYLCFERGRFGGT
FT                   VLEPIRLADADAPQRVAQQIEQALRGNFESSLVTGHPSLYAFAAAK"
FT   gene            381816..382061
FT                   /locus_tag="Bphy_3457"
FT   CDS_pept        381816..382061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72610"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH7"
FT                   /protein_id="ACC72610.1"
FT                   /translation="MEVNESAYYRSTRRRKRSIGFDHCRVIACSRRHPTFNLASTSAQC
FT                   LTGGEIVPPPDCPPDELLPPEITNVIVVVLELELAL"
FT   gene            complement(382205..382927)
FT                   /locus_tag="Bphy_3458"
FT   CDS_pept        complement(382205..382927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72611"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH8"
FT                   /protein_id="ACC72611.1"
FT                   /translation="MAVRSKVSLCFAVMCLLCDLVDAFGGATFNSSSANAMDFDGAQTS
FT                   RLPAVNAGRTTRHAHSVVSRSRTRRTRCEVARSACRPLASHCRHKSMASVGHVRPRCSV
FT                   IHRRRRERLYAHRNPPAPGQLVTRASEATLVPRCTNGCDLAAGEVLSRDVMRPVESERV
FT                   AQAPRAPDFGGWFGSERPLTVSVRESASTVEQTIAVNVATADQTDGAAKLMLLSAALPA
FT                   TPPLSEWNASSPVAATSR"
FT   sig_peptide     complement(382817..382927)
FT                   /locus_tag="Bphy_3458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.825 at
FT                   residue 37"
FT   gene            383200..383859
FT                   /locus_tag="Bphy_3459"
FT   CDS_pept        383200..383859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3459"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bma:BMA1034 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72612"
FT                   /db_xref="GOA:B2JLH9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH9"
FT                   /protein_id="ACC72612.1"
FT                   /translation="MNPSRAFRIVIADDHPVIRHAVIHALNGLPGFTVDAAVKSGAELL
FT                   GVLSQGKWDLIITDFTMDTGKSETDGLSLIGQLCRQHPDVPVVVFTMLNNDDMLARLSR
FT                   SGVAGVVDKCEGVEEFRSAALEVMHHRRPYFSAKIRMRLQHLNFGNGRRGGEPALTKKE
FT                   LEVIRLFASGASLTDIARHLNRSLSTIATQKSAAMKKLYLQTNADLVKYAQENGLT"
FT   gene            complement(383916..384926)
FT                   /locus_tag="Bphy_3460"
FT   CDS_pept        complement(383916..384926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3460"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /note="TIGRFAM: rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein; KEGG: bxe:Bxe_B1038 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72613"
FT                   /db_xref="GOA:B2JLI0"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI0"
FT                   /protein_id="ACC72613.1"
FT                   /translation="MNKPLRHAGAMLLCAAMLGASVAAAAAAGIKPDLKIAFVPKQINN
FT                   PYEVIADDGGMAAIKEFKGQGKVVGPSDAGASSQVSYINTLTTQRQDAIVIAANDANAL
FT                   VPYLKKAMSQGIKVVTFDSDTAHDGRQLFVNQANAESIGRGQIQLVSKLMGGEGEFAIL
FT                   SATPNATNQNTWIKWMQEELKKPEYSKLKLVKIAYGNDDDQKSFVETQGLLQAYPNLKA
FT                   IVAPTSVGIAAAARYISTSSSKGKVAVTGLGTPNQMRAFVKNGTVKAFQLWDPGQLGYL
FT                   AAYAAASLASGAITGKEGESFDAGKLGKRTIGAQGEIILGPPTTFDASNIDNFNF"
FT   sig_peptide     complement(384849..384926)
FT                   /locus_tag="Bphy_3460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.429 at
FT                   residue 26"
FT   gene            complement(384994..386022)
FT                   /locus_tag="Bphy_3461"
FT   CDS_pept        complement(384994..386022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3461"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B1037 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72614"
FT                   /db_xref="GOA:B2JLI1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI1"
FT                   /protein_id="ACC72614.1"
FT                   /translation="MAKPDSALLTRKRETPLRWETLLVVVLIASLGLGRVLSPVFLTGA
FT                   NLSNVLADLAEIALMALPMTLIIVAAEIDLSVASVLGASSALMGVLWHMGLPMPVVIVL
FT                   VLASGMIAGLLNGLVIVKLNLPSLAVTIGTLALFRGLSYVLLGDQAVADFPPNYTAFGM
FT                   DTLFGTFVPLPFAIVIVCAVLFTVLLQATAFGRCLYAIGANSTAAAFSGIEVAKVRLLL
FT                   FVLSGFMSALAGIVYTLRFTSARGDNGEGFELSVIAAVLFGGVSIFGGRGSMVGVLLSL
FT                   LIIGVLKNALTLDDVSSETLTIVTGALLLASVLIPNLVARWRAMRDRKLIAAQALTKPT
FT                   AP"
FT   gene            complement(386015..387076)
FT                   /locus_tag="Bphy_3462"
FT   CDS_pept        complement(386015..387076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3462"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B1036 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72615"
FT                   /db_xref="GOA:B2JLI2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI2"
FT                   /protein_id="ACC72615.1"
FT                   /translation="MIRHSTHSHAASIEHAPLRHTRSGPGGLVGALAKSRETTLFVVLI
FT                   LLILGTSLARPQFLNLQNLRDVLLNVSIISLLTAGMTVVILMRHIDLSVGSTVGISAYA
FT                   VGSLYVAFPHMPVLLALLAGVAIGLTAGGINALLIAVGRVPSLVATLSTLYIFRGADYA
FT                   WVHGGQINATSLPEAYSRLATGTLLGIPTLALIAAVVLFALSFYLKQFRAGREHYAIGS
FT                   NPEAARLAGIDVERRVMSGFMLSGAIAGFAGALWLARFGTVDASTAKGIELQVVAAAVV
FT                   GSVAITGGVGTVLGATLGALVLGVISIALVVLHVSPFWEQAIEGALIVAAIAADTLLAR
FT                   SVAKRMMRKRDHG"
FT   gene            complement(387073..388623)
FT                   /locus_tag="Bphy_3463"
FT   CDS_pept        complement(387073..388623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3463"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B1035 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72616"
FT                   /db_xref="GOA:B2JLI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI3"
FT                   /protein_id="ACC72616.1"
FT                   /translation="MKEETVQQQRNTQDVPRLELRHASKTFGRVRALSDGELVLWPGEV
FT                   HALLGENGAGKSTLVKILAGVHQPDTGLLRVDGIERRFATPAEARDAGLAVIYQEPTLF
FT                   FDLSIAENIFMGRQPVDRFGRIQHDAMRREVDGLLASLGVDLRADRLVRGLSIADQQVI
FT                   EIAKALSLNANVLIMDEPTAALSLPEVERLFTIVRKLRERDVAILFITHRLDEVFALTQ
FT                   HVTIMRDGAKVFDAPTAEMTTESVVAKMVGRDLETFYPKADVKPGDVRLAVRKLTRTGV
FT                   FKDISFEVRAGEIVALAGLVGAGRSEVARAIFGIDPIDSGEVRVAGKLLPTGNPAAAVR
FT                   AGLALVPEDRRQQGLALELSIARNASMTVLGRLVRHGLISSRSETQLATRWGTRLRLKA
FT                   SDPSAPVGTLSGGNQQKVVLGKWLATGPKVLIIDEPTRGIDVGAKAEVYGALSELVQEG
FT                   MAVLMISSELPEVLGMADRVLVMHEGRISAEIARADASEERIMSAALGQSAALLGRAA"
FT   gene            complement(388672..389565)
FT                   /locus_tag="Bphy_3464"
FT   CDS_pept        complement(388672..389565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3464"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bxe:Bxe_B1034
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72617"
FT                   /db_xref="GOA:B2JLI4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI4"
FT                   /protein_id="ACC72617.1"
FT                   /translation="MKVVDPHIHLWDLKTHHYPWLANPGVSFVGDARALKHDYLIADLL
FT                   KDAGEIELLKCVHVEANHDPQDPVEETRWLQEVAGAAGSRAMPNGIVAAVDLSAANAAD
FT                   VLEHHAAFANTRGVRQILNVHHDRLYDYVGRHLMREPTWRENFRLLRKHGMSFDAQLYP
FT                   SQMEEAARLANEHHDTQFIVNHAGMFVDRNSVAGYRAWREGMKTLAQCPNVAVKISGLA
FT                   MFDHAWTVESLRPYVLETIDTFGVGRAMFASNFPVDGQFGSYGDLWRAYAAIVGAASDA
FT                   EKNALFVRNAERLYRI"
FT   gene            complement(389610..389936)
FT                   /locus_tag="Bphy_3465"
FT   CDS_pept        complement(389610..389936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3465"
FT                   /product="protein of unknown function DUF718"
FT                   /note="PFAM: protein of unknown function DUF718; KEGG:
FT                   bxe:Bxe_B1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72618"
FT                   /db_xref="GOA:B2JLI5"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLI5"
FT                   /protein_id="ACC72618.1"
FT                   /translation="MDTIAFRMVLNRGMRDEYERRHREIWPELVSKLHNAGVRDYRIFL
FT                   DDDTHHLFAVLTRTADHSMERLPELAVMRKWWDYMADIMQTAPDRTPLQQALIPLFELQ
FT                   HPSN"
FT   gene            390098..391063
FT                   /locus_tag="Bphy_3466"
FT   CDS_pept        390098..391063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3466"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1032 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72619"
FT                   /db_xref="GOA:B2JLI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI6"
FT                   /protein_id="ACC72619.1"
FT                   /translation="MSQNAATVALVNRLKFKHLALLVALDDARNVHQAADAINVAQPSA
FT                   SRMLGDIEEALGFLLFERNARGMQPTPLGVVTLAYARRALAELTRFSEDLDVKRKGGHG
FT                   QLTVGAIMGAAPDLLAMAVAALKTERPLLHVCILGETSDQVVQLLHRREVDLALGRLTN
FT                   PLQHNDFSFEPLARETLTLVVRSVHPLAKRASISLRELMEWPWVAQPISSPARVLFEEE
FT                   LARAGLGTPANLTECASIFATLQLLENYDAVAMLPESVVRDHVRGKLLVALPVEIGKSL
FT                   AGFGILTRKEEALAEPAQRFVELLRVYSARLSKDEPLAVQ"
FT   gene            complement(391324..392106)
FT                   /locus_tag="Bphy_3467"
FT   CDS_pept        complement(391324..392106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3467"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B1031 putative short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72620"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI7"
FT                   /protein_id="ACC72620.1"
FT                   /translation="MLLKDKSVIVTGGSRGIGRAIAVACAREGADVAVNYWGDNDASYD
FT                   RRSAVDEVVGEIEALGRRVIAVEGNVAVKATGTELVRRTVEAFGKVDVLASNAGICPFH
FT                   AFLDMPVEVLETTVAVNLNGAFFVTQAAAQQMKAQGTGGAIVATSSISALVGGGMQTHY
FT                   TPTKAGVHSLMQSCAVALGPFGIRCNSVMPGTIATDLNAEDLADEGKKAYFEKRIPLGR
FT                   LGRPDDVAECVVFLASDRARYVTGAALLVDGGLFVNLQ"
FT   gene            complement(392121..393299)
FT                   /locus_tag="Bphy_3468"
FT   CDS_pept        complement(392121..393299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3468"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_B1030 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72621"
FT                   /db_xref="GOA:B2JLI8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLI8"
FT                   /protein_id="ACC72621.1"
FT                   /translation="MAMPSIRHVRAFVVRGGGADYHDQADGHWIDDHISTPMARYPEYR
FT                   QSRQSFGINVLGTLVVEIEASDGTVGFAVTTGGEIGAFIVEKHLARFLEGQLVTDIEKM
FT                   WDQMYFSTLYYGRKGVVLNTISGVDLALWDLLAKVRKEPVYQLLGGPVRDELQFYATGA
FT                   RPDLAKEMGFIGGKLPLQHSPAEGEEGLRKNIDKLAEMRGRVGGDFWLMYDCWMSLDVT
FT                   YATKLAKAAHEHGLKWIEEALPPDDYWGYAELRRNVPRGMMVSTGEHEATRWGFRMLLE
FT                   MGCCDLIQPDVGWCGGITELVKISALADAHNVLVVPHGSSVYSYHFVVTRHNSPFAEFL
FT                   MMAPKADQVVPMFTPLLLDEPVPVNGRMRVPDTPGFGVRLNPECKLERPYQH"
FT   gene            complement(393340..394671)
FT                   /locus_tag="Bphy_3469"
FT   CDS_pept        complement(393340..394671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3469"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B1029 major facilitator superfamily (MFS)
FT                   metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72622"
FT                   /db_xref="GOA:B2JLI9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI9"
FT                   /protein_id="ACC72622.1"
FT                   /translation="MNRTRPTTTLDAAVSQVMRRLLPFLLLMYVLAFLDRANIGFAQKA
FT                   LQHDTGISNAAFAFGAGVFFVGYALFEVPSNLLLHRVGARLWMCRIMVTWGLVSAAMSL
FT                   AHTATSFYALRFLLGVAEAGFFPGVIYYLARWFPQSARARAVGVFYFGAPLAFMFGSPL
FT                   SGLLLDLHGAFDLAGWQWLFLIEGGLASVVGVWAFFYLDDRPEDARWLAPEARQALSAA
FT                   LDDDARAAAAHGPHNLLAALVDGHVLLLSAIYLLIQMSVYGVIFYLPQQVAVLMGESVG
FT                   LRVGLVAAVPWICALALTWYVPRRADLTGTHRRWAVVLLVLAGCGIGVSGLAHSPLSAL
FT                   LALCCAASGFIAAQPLFWTFPTRYLTGAAAAGGIALINSLGSLGGFIAPTLRTSAEHAF
FT                   QSTSAGLLLLGAASLLAALLIGTLMRRDVSRDTSAFPQPIHRAR"
FT   gene            complement(394745..395497)
FT                   /locus_tag="Bphy_3470"
FT   CDS_pept        complement(394745..395497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3470"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bxe:Bxe_B1028 putative 3-oxoacyl-(acyl-carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72623"
FT                   /db_xref="GOA:B2JLJ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:6D9Y"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ0"
FT                   /protein_id="ACC72623.1"
FT                   /translation="MNRIDLEGRVVVITGGARGIGYAVAQRALRSGAAVALWDLDAERL
FT                   ARSERELAELGKVCAVTVDQTKEAQIEAAVGKTLAAFGAIDVLINCAGITGGNGTTWEL
FT                   EPDVWRQVIDVNLIGPYLVCRAVVPQMLKQGYGRIVNIASVAGKEGNPNASHYSASKAG
FT                   LIGLTKSLGKELATKNILVNAVTPAAAKTEIFDSMKQEHIDYMLSKIPMNRFLLPDEAA
FT                   SLILWLGSEDCAFSTGSVFDLSGGRATY"
FT   gene            396300..397019
FT                   /locus_tag="Bphy_3471"
FT   CDS_pept        396300..397019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3471"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bxe:Bxe_B1014 NADPH-dependent FMN reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72624"
FT                   /db_xref="GOA:B2JLJ1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ1"
FT                   /protein_id="ACC72624.1"
FT                   /translation="MVRTCIRPAATAARSLKLTRFDQNRRPLVIGIGGTTRTASSTERA
FT                   LGFALGGAEQAGARTRLFGGAFLHSLPHYAPETAQRTDEQRELIEAVRHADALVIATPG
FT                   YHGGVSGLVKNALDTLEELRADERPYLDGRAVGCIVTAYGWQAAGSVLTSLRSIVHALR
FT                   GWPTPFGAGINTLETRFETADTCSDPKVVDQLSTVGQQAAQFALAFRSHHTGGVAAHAA
FT                   TDDAVDARDSRVLALAN"
FT   gene            397353..397634
FT                   /locus_tag="Bphy_3472"
FT   CDS_pept        397353..397634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72625"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ2"
FT                   /protein_id="ACC72625.1"
FT                   /translation="MKNPNNFRTRSEHPKPEKAVRGSRHLRYKGYEVAPAAQRLPNGLF
FT                   AANLTIEKTTPASGAHAYSFDALDYFFDEEHALAYAYRWGRLWIDSHQ"
FT   gene            397774..398682
FT                   /locus_tag="Bphy_3473"
FT   CDS_pept        397774..398682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72626"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ3"
FT                   /protein_id="ACC72626.1"
FT                   /translation="MSDTLITEAEAAHDHAMRHWTFDGHARMRIGSEEHKQMFCRMLLE
FT                   THNPYKPAVIDWPQLPPDALKRITSLPIWDIAVQTEGRASIRVATYAGQVQDPLVREAI
FT                   EMDAAEEARHKHVLSRLVAAYGIELAPEPDYPAPRDPEWAWMFTGYSECIDSFFAFGLF
FT                   RSAQLSGYFPEELVDTFEPVIQEEARHILFFVNWVAWYRRTMPWWRRPWHSLRVGAIWV
FT                   KLIWDRVAIAKGIDSNGVAHDSNFLPANSATIGQALSTRQLIELCLQENDQRMAGYDKR
FT                   LVRPMLVPKLARLALRLMRAQ"
FT   gene            398791..400245
FT                   /locus_tag="Bphy_3474"
FT   CDS_pept        398791..400245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3474"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bxe:Bxe_B1011 putative indole
FT                   acetamide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72627"
FT                   /db_xref="GOA:B2JLJ4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ4"
FT                   /protein_id="ACC72627.1"
FT                   /translation="MQWTVDEQLALTASEAVAAVQSGRLSATDYVATLLARAAALATLN
FT                   AFTAIDMEGALAAANRIDALPAGEKARLPLAGLPVVIKDNINTAGLLTSAGTPALDGFK
FT                   PKTDAPSVRKLIDAGAIVLGKTNMHELAFGITSANLAPHAGPVRNPYDPSLIAGGSSGG
FT                   TAVAVAARISPAGLGSDTGGSTRIPAALTGIAGFRPSVGNGGAERRYHDPQAVVPISHT
FT                   RDTVGPMARTVADVALLDGVITGDAALPDVQLSALRIGLPEPLWAELERATEEVARRAL
FT                   VKLEAAGVTFVSVAMPDLLRLNEQTGGPIAIHEALEDVRDYLVANDAPVKTVGEIAARI
FT                   ASPDVREIYDVVLADALAQQYPAALHTWRPQLQQHYADTFAAERLDALLFPTTRLVAVP
FT                   IDEVNGSSIVSIDGAPAIEEMTAYLRNTDPASNAGIPGLSLAAGLTQEGLPVGIELDGP
FT                   LGSDRRLLAIGIAFEALLGTVPAPTI"
FT   gene            400254..401003
FT                   /locus_tag="Bphy_3475"
FT   CDS_pept        400254..401003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3475"
FT                   /product="CDP-diacylglycerol diphosphatase"
FT                   /EC_number="3.6.1.26"
FT                   /note="PFAM: CDP-diacylglycerol pyrophosphatase; KEGG:
FT                   bxe:Bxe_B1010 CDP-diacylglycerol diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72628"
FT                   /db_xref="GOA:B2JLJ5"
FT                   /db_xref="InterPro:IPR003763"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR038433"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ5"
FT                   /protein_id="ACC72628.1"
FT                   /translation="MLRPRIRHLTALAVALWTSGCALIATADPNALWKIVDHQCVPAAR
FT                   ASGRPGFCTSVDLQKRYAILKDINGNTQFLLIPTDRVTGIESPSVLDADAPDYWADAWA
FT                   ARQYVGSRIGLTFPPNQLGLEINSAYRRSQQQLHIHMDCMHDSVIKDLARFATVEPGQW
FT                   HWTTLDGNRYRVMRVLSLTGADDPFRIVARDRQGSDAMAQQTILVTGAGPTDKDGWLVV
FT                   NSGPELDDGSGSAEPLLDHACEIGMHR"
FT   sig_peptide     400254..400337
FT                   /locus_tag="Bphy_3475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            401125..402231
FT                   /locus_tag="Bphy_3476"
FT   CDS_pept        401125..402231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3476"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: bxe:Bxe_B1009
FT                   putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72629"
FT                   /db_xref="GOA:B2JLJ6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ6"
FT                   /protein_id="ACC72629.1"
FT                   /translation="MTTDLPMSFYLDDAQRYTLTRRRTSFSWRTEWPTWLLIGAIYGGW
FT                   FFIASHARVLGLNAAIPLLAVFSAWYMSLQHELLHGHPTRSAFVNALIGFAPIAVWFPY
FT                   RVYRQLHLQHHDDPHLTHPEIDPESFFVSSHAWRQAGPLTRALLVARNTFFGRLLLGPA
FT                   FSIAATATQALRKPLRGDWSDVPAWLAHFAALAVLMVWLDRACGIAPWLFIAAVGYPAL
FT                   ALSAVRSFHEHRAARSHEQRSVINEAAWCWRLLFLNNNYHLVHHDLPQVPWFALREVYH
FT                   ESRQQYLERSGGFLVKGYGEWLKRYSFTRIAHPLYRDISDVILDKPSGADSFAGKLRVK
FT                   SMVVVLRGEFHEVDLPAVAERQTARQAL"
FT   gene            402263..402760
FT                   /pseudo
FT                   /locus_tag="Bphy_3477"
FT   gene            complement(402762..403133)
FT                   /pseudo
FT                   /locus_tag="Bphy_3478"
FT   gene            complement(403289..403732)
FT                   /pseudo
FT                   /locus_tag="Bphy_3479"
FT   gene            403844..404236
FT                   /locus_tag="Bphy_3480"
FT   CDS_pept        403844..404236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3480"
FT                   /product="integrase/recombinase"
FT                   /note="KEGG: mlo:mll6231 integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72630"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ7"
FT                   /protein_id="ACC72630.1"
FT                   /translation="MLQELFPEVHRRYEGSRFAADLEGFAAWLRRSGYSRNTTCDHLFR
FT                   AKQTLERMDDAEPGGEFATEHLYTAFTSSHFPALYRGTQRAFERFLSSRGRLIRAEPEA
FT                   PFGALRGHYTLVSATGNDCTERSSRN"
FT   gene            complement(404592..404684)
FT                   /pseudo
FT                   /locus_tag="Bphy_3481"
FT   gene            complement(404887..407217)
FT                   /locus_tag="Bphy_3482"
FT   CDS_pept        complement(404887..407217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3482"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; KEGG:
FT                   bxe:Bxe_A4024 putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72631"
FT                   /db_xref="GOA:B2JLJ8"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ8"
FT                   /protein_id="ACC72631.1"
FT                   /translation="MIFRREVQGLAIRPIAALVLCLLAPVAVHAQLVGDAASAERLSDA
FT                   WSLRFAPQLTETPSVPGVKAATIGLGDAVTGTVDSDVSLKGAAELRRYGFVVKGDALHY
FT                   DVDGDMADAYGHVSIVSKGDVFTGPFGQLHVDASEGIIAQPRYRFYLNGGWGSGRRAEL
FT                   LDNERSKIEDGTYSTCDCDGNPAWYIRASQFAMDRGADEGVAHNGVLYFQNIPLLASPW
FT                   LSFPLDGARRSGLLSPTWSMSSKNGVDITVPYYFNVAPNYDLTIAPRYMSKRGEMLSAD
FT                   YRYLTEASSGSLSIAYLPNDITTHERRYSIDLNHIWRLGSGFAAYVNYNRVSDANVSTD
FT                   LGSGSAFPTSSTTLYQQEAGLTYNNGPWSVLAREQHWQSFSSDTTYNREPQVNVRYNRY
FT                   DVGGFDYGFEADATRFTLASDDVTQGTRFVFNPFVSYPVVRPGWFFTPKIKWHFASYDL
FT                   TSIASDAPTGQPHSVNVNVPTLSLDSGMTFERAVRLWGGSYIQTLEPRLHYVYTPYRNQ
FT                   TYVPLFDTTEADFGLGELFTDNAFVGNDRVSDESRVTAALTSRLIDAATGDERARFVIA
FT                   QRYDFIQPRVTLYDTESTANVARTSLIAGSSIKVGPDLILQNALQYSQSDNYLTQGSIG
FT                   FAWAPATAHVVNVAYRYTRANTTLDFQPVNQIIVSGQWPLAKNMASVARINYDMSTHRL
FT                   IAGLLGLQYDAQCWSLSLGMEKYTNATGSTSPSTGTRMLMQLQLKGLSRTDRGLLDQFK
FT                   ADVPGYSSTPADETPVSRFSEYQ"
FT   sig_peptide     complement(407125..407217)
FT                   /locus_tag="Bphy_3482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            complement(407284..407688)
FT                   /locus_tag="Bphy_3483"
FT   CDS_pept        complement(407284..407688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72632"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ9"
FT                   /protein_id="ACC72632.1"
FT                   /translation="MSEHAAHVVNSISDLQMTEDGLYLLIHGNQPMTAIHRSVLDQLLV
FT                   ALPNAIEHSDRITSGNAQTAFAYQSYGWEIGRLNGTQTAVIRFRLAGNMGISFSLPCEQ
FT                   IAPLIEALNGVAASAGATVAQVTSDTVTLQ"
FT   gene            complement(407681..407884)
FT                   /locus_tag="Bphy_3484"
FT   CDS_pept        complement(407681..407884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72633"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK0"
FT                   /protein_id="ACC72633.1"
FT                   /translation="MLEHIDPVVLVAVLRTSSSPLFSAWIARASSYEPWIEDTCAHHLD
FT                   DADRRPGTAVGSGARVDEVRHV"
FT   gene            408148..410457
FT                   /locus_tag="Bphy_3485"
FT   CDS_pept        408148..410457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3485"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: bxe:Bxe_A1690
FT                   putative outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72634"
FT                   /db_xref="GOA:B2JLK1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK1"
FT                   /protein_id="ACC72634.1"
FT                   /translation="MKQRASTICLASALTVCATTLTPSIAHADDSMIVMDIRLEGLRRI
FT                   EAGTLLANLPIKRGEVFTDDKASAAVRAIYDTGLFNDVNVSLDGDVVVVHVVERPAIAD
FT                   IDFAGIHEFEKDNLTKALKAVGLSRGRPFDKALIDKAEQELKRQYLTRGYYAAEVQTTT
FT                   TPVDSGRVSILFSVIEGPNAKIRQINFIGNRVFSESTLRDEMELSTPNWFSWYTKNDLY
FT                   SKEKLGADLDRLRSYYLNRGYLEFRIDSTQVSLTPDKKEMYLTLNVHEGKPYTITGIRL
FT                   AGNLLDREGELTPLIGIKPGEKFSEDKLRATTKAVVDRLGEYGYAFATVNAVPRIDQDK
FT                   HTVDLTLQVDPGRRVYVRQVNVEGNTRTRDEVIRREMRQLESAWFDSNRLALSKERVNR
FT                   LGYFTDVDVTTVPVSGSNDQVDVDVKVTEKPTGAITLGAGFSSSDKVVLSAGVSQDNVF
FT                   GSGTSLAVNVNTAKTYRTLSVTQTDPYFTVDGIKRISDVYYRTSYPLYYSNDESFRIVS
FT                   LGADLKFGIPFSEIDTVYFGLGIEQDRFNTDSSTPQAYLDYVKEFGRVVNNVPITAAWS
FT                   RDARDSALMPSRGYMLQANGEVGTPAGETEYYKADVQSQYYYSFARGFILGLNLQAGYG
FT                   NGFAGKAYPIFKNYYAGGIGSVRGYESSSLGPRDSSTGDSIGGSKMVVANVEMTFPLPG
FT                   SGWDRTLRVFTFVDAGNVWGNEGSSTGANGLRYSYGAGLEWISPIGPLKLSVGFPIVRH
FT                   ADDKYQVFQFQIGTSF"
FT   sig_peptide     408148..408234
FT                   /locus_tag="Bphy_3485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(410682..412184)
FT                   /locus_tag="Bphy_3486"
FT   CDS_pept        complement(410682..412184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3486"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_A1741 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72635"
FT                   /db_xref="GOA:B2JLK2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK2"
FT                   /protein_id="ACC72635.1"
FT                   /translation="MMDKATRTTRRVQRSIVAAAIATLCAGCAVGPDYKRPDVVVPAAF
FT                   KEANSSDAGDVWQQAKPDPAASLDSRWWTVFGDGTLDDLCERALKANQTLAQYEAAYRS
FT                   ARAQVASSRASLFPTVSFAGSGTRSRTGTGSNTTPISSGSSTSSYASKSVSAELEASWE
FT                   PDLWGSVRRSVEVSEASAQASDAQLAGERLSVLATLAVDYFTVRAADADLAILEEERRI
FT                   DAELLALTEAKYKQGVSSYDDVRTAHNTLQAIDESIASAQLTRRQYEHAIAVLLGEPPA
FT                   AFSLPVQADYRFDLPALPVALPSTLLQRRPDVVQAERTVAQYNAKIGVAKAGYFPTITL
FT                   TADGGWSGTSFAHLISLPTRFWSLGLDVAQTVFDAGATSASVRAARANYDQEVAAYRQT
FT                   VLSAFQDVEDYLSAVQIASRQAAASNEVARRSGELAASQQRNFAAGTASRIDMLDTQLT
FT                   QVEDRKIALDYSSTTLQNAVLLVKALGGGWDSQLKTADSSGR"
FT   sig_peptide     complement(412095..412184)
FT                   /locus_tag="Bphy_3486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.415 at
FT                   residue 30"
FT   gene            complement(412181..415291)
FT                   /locus_tag="Bphy_3487"
FT   CDS_pept        complement(412181..415291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3487"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   mms:mma_1682 AcrB/AcrD/AcrF family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72636"
FT                   /db_xref="GOA:B2JLK3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK3"
FT                   /protein_id="ACC72636.1"
FT                   /translation="MVNLSAPFIRRPVGTMLLALGLALFGIVAFRLLPVAALPSVDFPV
FT                   VMVSATLSGANSDTVAKTVTAPLERAFGSIAGLSQMTSQSSSGSSQIVLQFDLNRDIDG
FT                   AARDVQAAINAARSNLPTTLTQTPTYRKMNPAAAPMMIVGLTSDTVGVGQMYDYASSVL
FT                   QQKLLQVEGVGDVTVGGGALPAVRVELNPDQLSRYGIALDSVRTALANASVDLPKGAVS
FT                   MNGQHYVTGANDQLTEPADYKPLVIRTHDGTVVHVTDVAQVVRSTEDLRNYGLANGKPA
FT                   VLLIVSKQPNANVIKTVDAIRDTLPQLAASLPSTVKLNVVLDGTQTIRSSVFDVEISLL
FT                   AAVLLVTAVSYAFFRDWRSTLIPAITVPLALAGTFTAMYFLGYSLNNLSLMALTISTGF
FT                   VVDDAIVVVENIMRHVDQGKTPLAAALDGTREVGFTVLTISVSLVVVFLPLIMMSGIVG
FT                   RLFREFSVSLAIAIMISMVISLTLAPTLGRLLLRGPPHKQSEGASGPRVERAYARSLRW
FT                   ALRHPKMMLAVTVFLLFANVGVVAVMPKGFFPIEDTGRLMGNIQASQSISFQAMKQKFD
FT                   EINRRILQNADVQSVSGYVGGRNAVSNSMMFITLKPLSERKHSADQVIADLSRRTADIP
FT                   GVRLLLQSAQDLMFGARQSSAQFQYTVTAENQDDLDKWVPRIEAKLRTLPQLRDVNTDV
FT                   QSASLSMMLQVNRDAAARLGVPFEAIDDALNNAFSQRQIATVYGPANQYHVVMEIAPQY
FT                   AQDPKTLDTLYVPATNASSTSSTSSSTSTASSATLVPLSALATRTLSHAPVTIAHDNQF
FT                   AAVTLSYNLREGVTMSDANESIKSAVASLNLPNTILPGFAGQGAMMQQSGGSELLLIIG
FT                   ALMAVYIALGILYENLIHPLTILSTLPSAGLGALVALYVCGYELTIIALIGIVLLIGIV
FT                   KKNAIMMVDFAVTYEREQGSSAEESIYQACLTRFRPIMMTTLAALLGAVPLIVSSGYGH
FT                   EFRHPLGVAIFGGLMVSQLLTLFTTPVIYLWLDRFNGRRASRNGTPS"
FT   sig_peptide     complement(415181..415291)
FT                   /locus_tag="Bphy_3487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.674 at
FT                   residue 37"
FT   gene            complement(415299..418439)
FT                   /locus_tag="Bphy_3488"
FT   CDS_pept        complement(415299..418439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3488"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   cvi:CV_2733 probable drug efflux pump transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72637"
FT                   /db_xref="GOA:B2JLK4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK4"
FT                   /protein_id="ACC72637.1"
FT                   /translation="MDISRPFIRRPVATGLMTLALLLIGLIAYRLMPVSALPEIDYPTI
FT                   QVYTQYPGASPDVISTSVTAPLEKQFGQMAGLKRMNSTSSLGVSLVTLQFLTSTNLDEA
FT                   EQEVQAAINSANSTLPSNLPYPPVYSKVNPADTAVLTLAVTSDALPLTRVEDLTDTRIA
FT                   QKLSQVSGVGLVTLSGGARPAVRVQTDTRALNAMGLSLEDVRTAVGDANVNSAKGTIDG
FT                   NLQAFTIDANDQLTSAADYQDLVLAYRKGAPVRLADVARISQTAENPRQAAWSGATPAI
FT                   IVNVQRQPGANVIEVVDGIEALLPQLRASLPATVKISVLSDRTQTIRASVHDVKMELVA
FT                   AIALVVMVVFVFLRRLEFTLIPAVTVPFALVGTVAGIYALGFSVNNLTLMALTVATGFV
FT                   VDDAIVMLENVMRHIENGETPLDAALKGARQIGFTILSISVALVAVLIPLFFMPDVIGR
FT                   LFREFALTLAIAIVISAWVSLTLTPMMAARMLRADRAASDSDATARDWLARLNRGYLRG
FT                   LDWAFEHRVTVLVMVAITTLLTCVLFLLLPKGLLPEQDTGMIEGISLGSPRASFERMAA
FT                   STRTLAGRVANDSAVASVSSFVGIDQNNPTINQGRMLISLKDGDASRTVIQRLTRDVGQ
FT                   RADLKLYLHPVQDLTLDDQINANSYRVGVQATDRAELDEWTQRLLDALRTDPMFTDVQS
FT                   QAQQQGNVLTFDFDRATASRLGLTAQDLDNALYDAFGDRQISTIYTHVNQYHVTLGADV
FT                   RLVGESPLALLDGLYVGTTSASSSSSSSSSSTSTSGSTSTSLAPLSSIATATVGAAPLT
FT                   IQRQAQFPYADVSFNLADGVTLGTAVSRLEAIEQKLNAPASVQMNFEGAAQLYSTSLAN
FT                   EALLLIGALVAVYILLGILYESLVHPLTILSTLPSAACGALAALLLCGGELDIIGLIGI
FT                   VLLVGIVMKNAIMMIDFALEQERTLGLAGRDAMRRACELRFRPILMTTCASLFGALPLA
FT                   LGTGIGHELRQPLGIAIIGGLVVSQLLTLFSTPVIFLALHRFATRAAITPTDDANAS"
FT   sig_peptide     complement(418329..418439)
FT                   /locus_tag="Bphy_3488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.494 at
FT                   residue 37"
FT   gene            complement(418465..419610)
FT                   /locus_tag="Bphy_3489"
FT   CDS_pept        complement(418465..419610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3489"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS03141 putative resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72638"
FT                   /db_xref="GOA:B2JLK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK5"
FT                   /protein_id="ACC72638.1"
FT                   /translation="MKFTRPSRRLLVVACIAAVGVIVWQAYAAFHKPQHPAAQETPVTI
FT                   GTVQRADVPLQLDALGTVTPRATVTVKTQVNGTLEAVLVKEGQRVNAGQPIARIDSRAL
FT                   RAQLLEAQGTLEHDEALLANAKADLARYETLIDGGSISRQTLDTQRATLRQYQGTVKAD
FT                   EGSVANLRVQVSYCDIVAPMDGTIGLLSTDAGNYVTTSDTTGIATITSDSPTTVVYALP
FT                   EDKMGEVVDAFHDKGALPVEIFARDKRTVLDHATLAAIDNQADTTTGTVKLKASAPNRD
FT                   GRLFPNRFVNVRMTVGTLRDALTVPTVAIQHGASGDFVLTMAAADVKRNAGTVALRHVT
FT                   AGVSYNDATVIEQGDVKAGDAIVLDGADKLDDGSAVKIVRN"
FT   sig_peptide     complement(419524..419610)
FT                   /locus_tag="Bphy_3489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.834 at
FT                   residue 29"
FT   gene            complement(419800..421311)
FT                   /locus_tag="Bphy_3490"
FT   CDS_pept        complement(419800..421311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3490"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bte:BTH_I0682 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72639"
FT                   /db_xref="GOA:B2JLK6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK6"
FT                   /protein_id="ACC72639.1"
FT                   /translation="MNRTILTALAAALFASGCTLAPTYERPAAPVAATYPQGDVYDNQP
FT                   AKGAATRTANDHAAIDIGWREFFIDPRLQRLIELALQNNRDLRVSALKVEEARAQYRIQ
FT                   RADLMPSVSVDGTGTRSRTPKDLSYVGRATVGSDYQVAASASWELDFFGKVRSLTEQSM
FT                   QTYFSTAQARKAEEILLVSQVADQYLTLVAYGEMLASTKNTYDTARRSYELTKLQYDMG
FT                   TGSELDLREAAGTMQQAQANYESQQRSRAQAENALVLLVGAPLAADLPQGLPLASQQLL
FT                   ADIPAGLPSDLLTRRPDIMEAEATLIGANANIGAARAAFFPSISLTGDFGTASASLGTL
FT                   FKPGQLAWSFGPTISVPIFKGGENRANLDLAKLEKNVAVAQYEKAIQTAFREVSDGLAA
FT                   RGTYDRQIKALQENVESQQRRYDLSDVRYRNGADSYLNVLTAQTDLYSAQQSLITASLN
FT                   RLTNLVDLYQYLGGGWIEHSGDTPRAADAPYAQQTEPTTHVASQP"
FT   sig_peptide     complement(421249..421311)
FT                   /locus_tag="Bphy_3490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.724 at
FT                   residue 21"
FT   gene            complement(421323..424481)
FT                   /locus_tag="Bphy_3491"
FT   CDS_pept        complement(421323..424481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3491"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A0709 RND family hydrophobe/amphiphile efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72640"
FT                   /db_xref="GOA:B2JLK7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK7"
FT                   /protein_id="ACC72640.1"
FT                   /translation="MAKFFIDRPIFAWVIAIILMLAGIASIFNLPISQYPTIAPPAVQI
FT                   SATYPGASAKTVENTVTQVIEQQMSGLDHLLYMSSSSDDSGSATITLTFEAGTNPDIAQ
FT                   VQVQNKLQLATPLLPESVQQQGTKVTKSSSSFLLVMAFVSTDGSMDRYDLANYVASHVE
FT                   DPVSRVNGVGTVQLFGSQFAMRVWLDANKLNQYSLTPVDVETALTNQNVQVAAGSLGGT
FT                   PSVPGQVLQATITQATLLQTPEQFGNVLLKVNQDGSQVRVKDVARIELGGENYNFDTEY
FT                   NGQPTAGFGIQLATGANALETATLVRAKIDQLSKNFPHGLVVKYPYDTTPFVKMSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATLIPTIAVPVVLLGTFAIMSAAGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPREATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVAAMVLSVLVALVLTPALCATILKPVPKGHHGAKTGFFGWFNR
FT                   TFDNGRDRYHSGVQHVIRRSGRWLVLYVVVIVAVGFLFMRLPKSFLPDEDQGTMFVLVQ
FT                   TPPGSTQETTARTLKNVTDYLLNDEKDIVESVFTVNGFSFAGRGQNAGLAFVRMKDYSV
FT                   RQHANQKVQALVGRVFGHYASYKDATVLAVNPPSIPELGTASGFDFELTDNASLGHEAL
FT                   MAARNQLLGMAAKDPSLALVRPNGLSDTPQFKIDIDREKAQALGVTVSDIDQTFSIAWA
FT                   SAYVNNFLDTDGRIKKVYLQGDAPFRMTPEDMSKWYVRGSSGTMMPLTSVASGHWIYGS
FT                   PKLERYNGIASVELQGQAAAGKSTGQAMSAMEALAAKLPQGIGYEWTGLSFQERQSGSQ
FT                   APILYGISILVVFLCLAALYESWSIPFAVILVVPLGVIGALLAVTMRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQTNERMTAMQAALEASRLRLRPILMTSLAFVLGVLPLA
FT                   ISNGAGSSSQHAIGTGVIGGMLTATFLAVFMIPMFYVVIRSKFSRDGATPNSTEPDVEE
FT                   ETAQ"
FT   gene            complement(424496..425713)
FT                   /locus_tag="Bphy_3492"
FT   CDS_pept        complement(424496..425713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3492"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_A0708 membrane fusion protein, RND efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72641"
FT                   /db_xref="GOA:B2JLK8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK8"
FT                   /protein_id="ACC72641.1"
FT                   /translation="MPALLKNRNFRMLAATAAISAVLPLLAACGDQHAAPPQQTPEVGV
FT                   VTIRPSAVPVTVELPGRVSAHLVAEVRARVDGIVQKRLYTEGSEVKAGQTLYKIDPAPY
FT                   IASLNSAKATLAKAQATLVSAHAEAARYKVLVAANAISKQDYDNAVASEGQATADVAAG
FT                   KAAVDTAQINLGYTDVSSPISGRIGKSSVTEGAYVQSSAATLLATVQQLDPVYVDLTQS
FT                   SLVGLKLRRDAQEGRLKTSGPNAAKVTLILEDGRPYGGTGKLEFSDVTVDQTTGSVTVR
FT                   ALFDNAQGVLLPGMYVRAKIEEGVNEQAFVVPQQGVTHDQKGDPTALVVGADGKVAMRQ
FT                   LVTSGTYGANWVVESGLQTGDRVIVQGVDKVRPGMSVKTVAAQLPAADTATQTAATPAS
FT                   GAQSAQ"
FT   sig_peptide     complement(425609..425713)
FT                   /locus_tag="Bphy_3492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 35"
FT   gene            425910..426545
FT                   /locus_tag="Bphy_3493"
FT   CDS_pept        425910..426545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3493"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracycline
FT                   transcriptional repressor MAATS-type domain protein; KEGG:
FT                   bur:Bcep18194_B1196 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72642"
FT                   /db_xref="GOA:B2JLK9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK9"
FT                   /protein_id="ACC72642.1"
FT                   /translation="MGRTKQQALDTRAKIIEAAERVIYVRGFARASLEDIASEAGVTRG
FT                   AVYGHFRNKEAVFQAIYENADMPLDPFVVQACEQDADPLQHLHAQLRQRLRDALHMRRA
FT                   RRLYSIALTKREVTAETAAFYERVSMASLRAEAQIDAALRAASERGQLPPGVDTRAAAG
FT                   FIHAALTGFLHKRLLMSGEPRVDGEADQTLASALRCIGAQTGFEPARV"
FT   gene            426795..427565
FT                   /locus_tag="Bphy_3494"
FT   CDS_pept        426795..427565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3494"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bvi:Bcep1808_4761 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72643"
FT                   /db_xref="GOA:B2JLL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL0"
FT                   /protein_id="ACC72643.1"
FT                   /translation="MPDTPLQVLLVDDDADLRDLLRNFFQQRGIDFSVLHDATHLARRL
FT                   ERERPSIIVLDLMMPGVDGLTALKQLRASGNTIPVIMLTARADGVDRVIGLELGADDYL
FT                   GKPFMPQELLARIHAVLRRHALHPDAPPAEHREALEFGRFRLDFASRTLFRDNEPIRLT
FT                   GSEYALLEVFAQHPMETLSRTRIVDLLHGPDSEVTERGIDVPVWRLRRLLEDDPAAPRR
FT                   IQTMRGIGYMFVPGETGNGGNGGETSDDGSDATQ"
FT   gene            427562..428815
FT                   /locus_tag="Bphy_3495"
FT   CDS_pept        427562..428815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3495"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bvi:Bcep1808_4762 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72644"
FT                   /db_xref="GOA:B2JLL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL1"
FT                   /protein_id="ACC72644.1"
FT                   /translation="MKNPFNTLFGRLATLTVGLIVAVHVTSLIVVDRERGQIDADHVRR
FT                   AVMLAVQAKHDGEASARHLAQTLGIEYIAAADVDRSGCPNGCTGSAAPFEHDLLPRMPE
FT                   GSRVVFDPHTGSLWIRYGNEPYWLFMRNANLPGMRFVGSSLVMLVLAVCAALFAAWQFQ
FT                   RPLHRLADAAREFRIGRRVPPVTESGPAEMRSLIGDFNEMMSELGKAEQERAVMLAGVA
FT                   HDLRAPITRMQVRADLLPDAANRSGFLRDAESLSRIVTQFLDYARDTADPSPQTNVDAH
FT                   CRRHYGDGLDDEALVRLHLNAGDGFNLPLVDLDRILSNLIENAMNYGDPPVEISTSAHS
FT                   GVYTLTVHDHGVGIPRGQLERALQPFTRLDPARGGDAHCGLGLAIVRRLTRYNGGQFEC
FT                   DNAPEGGFRVTLTFRREA"
FT   gene            complement(428901..429155)
FT                   /locus_tag="Bphy_3496"
FT   CDS_pept        complement(428901..429155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72645"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL2"
FT                   /protein_id="ACC72645.1"
FT                   /translation="MNELLLQPVEETVSDEAIQDFLSRYGFPPVVTIERIPATGSRPAV
FT                   LIVFRDLSPEALKTLQSRIHQVHWNGRKIEAIVLRQRAE"
FT   gene            complement(429319..430089)
FT                   /locus_tag="Bphy_3497"
FT   CDS_pept        complement(429319..430089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3497"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rru:Rru_A2446 ABC transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72646"
FT                   /db_xref="GOA:B2JLL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL3"
FT                   /protein_id="ACC72646.1"
FT                   /translation="MTRPDPQRTTERLRVDNLTVAFGPRIIQRELSFSVRKGSIFAIMG
FT                   GSGCGKSTVLRAMIGLLRPSSGSIAVDGEDYWTVSEERRAEMSRRFGVLFQSGALWSSM
FT                   TVAENVALPLQMFTTLASDSIAVLVQLKLSFVGLSDAAAKMPAELSGGMRKRAALARAL
FT                   ALDPDILFFDEPSAGLDPITSNRLDELILELSRGLGATVVIVSHELPSLFGICDDGVFL
FT                   DGESRTAVAHGSPRILRDSCVHPSVRAFMKRGQL"
FT   gene            complement(430094..431242)
FT                   /locus_tag="Bphy_3498"
FT   CDS_pept        complement(430094..431242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3498"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   rru:Rru_A2445 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72647"
FT                   /db_xref="GOA:B2JLL4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL4"
FT                   /protein_id="ACC72647.1"
FT                   /translation="MNLSFDLRPGWNLERHESLAVLHLRGDWITCATGVRSAAEVHEIV
FT                   KAVGACALRLETSNLGRWDSALIVFLMMLRESVRKGGTRPFEIDESDLPHAAQRLLALA
FT                   AAGSGEVAGIAAVHRSLATQVGEAYFQAWANAVSIVALVGETALHCTAAFAHRVRTRGV
FT                   DVLQLMREAGAGALAIVAIVNGLVGAILAFIGAVQFQRFGAGIYVANLVGIAVVREMAA
FT                   LATAIVMAGRTGGAYAAHLATMQGNEEIDALNAVGIPVFDFLVLPRVIALVSMMPLLYV
FT                   YSCAVGLLSGFIVTLATLDITAVTYLQQLRGAVDGVQFAIGLAKSIAFGSFVALAGCHI
FT                   GLKAGRSAAEVGRAATSAVVVGIVGVISLDAIFAVCTNALGI"
FT   gene            431728..432702
FT                   /locus_tag="Bphy_3499"
FT   CDS_pept        431728..432702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3499"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rru:Rru_A2447 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72648"
FT                   /db_xref="GOA:B2JLL5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL5"
FT                   /protein_id="ACC72648.1"
FT                   /translation="MNPRPAVVGGFILGAITLGIAAIVFFGGAQLFAKTSNAVVFFGES
FT                   VAGLDVGSPVTFHGVRIGSVKRIAVHFSSETMTAKIPVYLEFESTNQAVWEGRKFGGRA
FT                   VDFERAVKAGLRAQLALQSFVTGQLRVDLDFRPGTPAQLTGSVTDAPEIPAIPSDLDQL
FT                   RNQLAGLPLRELSGSVQQALSSLTRLSDHVDVLLEPLAQSVIRTADAATQTLHATDATV
FT                   RHVEADATHTLHDLDLLLVDAREQLDARSGELSRTLVTTDRAVRQADTLLESLNDLADP
FT                   HAQFRGDLEATARDLAVSASRLRSFAETVERHPNALVIGRATR"
FT   sig_peptide     431728..431829
FT                   /locus_tag="Bphy_3499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.959 at
FT                   residue 34"
FT   gene            432699..433337
FT                   /locus_tag="Bphy_3500"
FT   CDS_pept        432699..433337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3500"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   rru:Rru_A2448 protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72649"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL6"
FT                   /protein_id="ACC72649.1"
FT                   /translation="MMPVTSFALLRNKLLNRTTRSVLPAVATFAIAACSLSGPPPAEYV
FT                   ISAMPPAAATTISQKGWPIIEVKRVQLPDYLDTTDIVERRGNQLLPRPTGRWSERLSVG
FT                   MTRALSASLAARLPRMLVTATTPVERPARLLLVDVTAFEWRADRQVVLVARSTIMDGAK
FT                   REILRIQQVSLTEETDGESDSAIVAAMARAVADLADQLAAGINHDCQTC"
FT   sig_peptide     432699..432812
FT                   /locus_tag="Bphy_3500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.939 at
FT                   residue 38"
FT   gene            433568..434425
FT                   /locus_tag="Bphy_3501"
FT   CDS_pept        433568..434425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3501"
FT                   /product="Amino acid transporter-like protein"
FT                   /note="KEGG: bxe:Bxe_C0744 arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72650"
FT                   /db_xref="GOA:B2JLL7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL7"
FT                   /protein_id="ACC72650.1"
FT                   /translation="MARPATTTAPATNLAPEAKPALPSRKADKRKLGLLLLSGIVVGSM
FT                   IGGGAFNLPQNMAAGAGLGAIALAWGITLVGMFFLSNCFRTLADQRPELKSGIYSYARE
FT                   GFGRFAGFEMAWGYWLSSAFGNVAFAVLIMQTLGFFFPVLDGKNWQSIAGGSLLIWTTH
FT                   FMVLSGVKRTAMVNTIASVVNIITLSFGIAIVALVFQKHASLRTGILGTSYASWLLYAA
FT                   DPKFLLMSTILFVIGIPVFWYARREKDAGAPTFTPLERTAAGSLCVVAVTAVVLFATKT
FT                   VAIG"
FT   gene            434626..435447
FT                   /locus_tag="Bphy_3502"
FT   CDS_pept        434626..435447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3502"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   reh:H16_A1271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72651"
FT                   /db_xref="GOA:B2JLL8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL8"
FT                   /protein_id="ACC72651.1"
FT                   /translation="MSEFRNEVKVHGAKAGDRLSNSAYQKELAVLHVELVKLQEWVVRT
FT                   GARICIVFEGRDGAGKGGVIKAITERVNPRVFRVVALPAPTDREKTQMYLQRYLPHLPA
FT                   AGEIVLFDRSWYGRAGVERVMGFCTEADVQMFMMATPLVERAFIDSGLILIKYWLEIGA
FT                   EEQTRRLEARIRDERKIWKLSPMDLESYRRWYDYSRARDAMFSMTDTEYSPWYVAKADS
FT                   KKRARLNIISHLLSKIPYEALPRKKVSLPKRQKAEGYRESDHHFRYVPEKF"
FT   gene            435639..436424
FT                   /locus_tag="Bphy_3503"
FT   CDS_pept        435639..436424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3503"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: cyb:CYB_1806
FT                   potassium transporter, voltage-gated ion channel (VIC)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72652"
FT                   /db_xref="GOA:B2JLL9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL9"
FT                   /protein_id="ACC72652.1"
FT                   /translation="MYRIEEPRLGGLRIQEWRRRAHLAVGMLFLVLLGSTLGIELLDHT
FT                   DAPVSTKTFTAFWDAVNLITTLGDFSDFNADQKIFMLVAILVTVVIAGYALRQLAGMLS
FT                   GDDVMIFWENRVMEHKLEALINHVAVCPFGPVGQMVAARLRDAGSTVLVLDSDAKQADK
FT                   ASRLGYMVMLGDQNSFDDILARARLDTASTLFLTGSDPNSNLEITLVAHTLNPALQIVV
FT                   SGENDLRRMLLRKAGASTVIDQNDIVACAMVGQVDAQPA"
FT   gene            436805..438535
FT                   /locus_tag="Bphy_3504"
FT   CDS_pept        436805..438535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3504"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; sulphate transporter; KEGG: rme:Rmet_0606
FT                   sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72653"
FT                   /db_xref="GOA:B2JLM0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM0"
FT                   /protein_id="ACC72653.1"
FT                   /translation="MGQDSSRHSTGGLRIPVLEWIRDYQKSWMKPDIIAGVSAAAVVVP
FT                   KAMAYATVAGLPVQVGLYTAFVPMVIYALLGTSRPLSVSTSATIAILTAAALARVVPAG
FT                   GAADLLRACATLAFLVGAILTLAGLLRLGFVANFISDPVLTGFKAGLAVVIVLDQLPKL
FT                   LGIHVPKGAFFHNVLGIVIGIPHASMATVAVGLMTAIALVAIERYFPRAPAPLFALACG
FT                   IGSVSLLGLQFQGVEVVGHVPTGFPAFTMPDLSLVASLGPAAAGIALMSFTETIASGRA
FT                   FVESGEPVPLANRELVAIGLANMCGALLGSMPAGGGTTQTAVNRLVGARSQLSELVTAT
FT                   VTLGTMLLLGPLIGLMPQATMAAIVIVYSFGLIAPSEFRAIVAVRRTEFLWALVAVLGV
FT                   VLFGTLPGILTAIVVSLLALAYQTSDPPVYVLRRKPGTNVFRPVSAEHPEDEAFPGLLL
FT                   LRPEGPIFFANAQRVRQKIRTLIEGSHPQIVALHLRAVSDLEYTALKMLTEAEKDLRKQ
FT                   GIVLWLVGLNPGVLTMVQHSPLGDTLGRNRMFFNLDRAIAAWQAQRSSGNQEPSGGAVH
FT                   "
FT   gene            complement(438726..441815)
FT                   /locus_tag="Bphy_3505"
FT   CDS_pept        complement(438726..441815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3505"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rpc:RPC_1357 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72654"
FT                   /db_xref="GOA:B2JLM1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM1"
FT                   /protein_id="ACC72654.1"
FT                   /translation="MKSFNLTEWALSHRAIVLFLILVIGIGGTFSFTRLGQLEDPNFSV
FT                   PSMTALVIWPGATAQQVQDELLNRMEKKFEQLDHFEKVVTYARQGYGGMTITVKGGTSH
FT                   ADQREAWYQARKKFGDIKLELPDGVVGPIFNDEYGDVTGLLYAVKGDGISQWELTDVAE
FT                   DIKRQLLKVPMVKKVDIYGKQAKKIYVEFSNERLAALGITPLQIAESLRSQNSVLASGQ
FT                   IDTHDDRVLVRVSGQFSSLDDIRNVPIAAGGRLLKLGDFTSITRGYEDPPIYTVRHNGQ
FT                   QVLMLGITMTDDGNIVDLGKAIDRTIAKVQLELPYGVELERVADQPTVVSESIWEFERS
FT                   LLEALTIVLAVCLISLGWRTGIVVGISVPIVLGVVALVMLTMGWNLERVSLGSLIIALG
FT                   LLVDDGIIAVEMMVVKMEEGWDRVKAAAYSYTATAMPRLTGALITAAAFMPIGFAKSTT
FT                   GEYAGGIFWIVGTAVLFSWVVSGLITPYLAVKMLPEDFGKQHRGGDPYDTAFYRKLRGW
FT                   IDLALERRWWVIAATVAALAAAIAASRFVPQQFFPNSARPELVVELRLKEGASFAATTE
FT                   QVKKMEAVLKKDKDVRFFTAYTGAGQPRFYLALNPELPNPGYAVFVVMTKDTQARERVR
FT                   SRLMGSVNAEFPQAWIRVTRLELGPPVGFPVQFRVVGSGTQKVREIAREVEAVVASSPK
FT                   VRDVQLDWNDPVRTLRVDLDQDKARALGLAPADVAFVTQTFMNGVTLSHLREREDLIDI
FT                   VARAVPSERLDLGMLKDINLYTREGTVVPLSQIARVRYELEEPVLWRRNRDMAITVRAD
FT                   VKDGEQGVSVTQEIRPLLKDIEAKLPFGYRIDVGGAVEESDKANRALMAVFPVMLITIL
FT                   TILMLQLQSFSRMTLVFLTAPLGLIGVVAGLFVFQAPLGFVAILGVTALSGMIMRNSVI
FT                   LVDQVQAEIAQGRDTWTAVVDAAVHRTRPVALTAAATVLAMIPLTRSIFWAPMAIAIMG
FT                   GLTVATLLTIFFMPALYAAWFKVRRNAELKPGDLPRVDAP"
FT   sig_peptide     complement(441705..441815)
FT                   /locus_tag="Bphy_3505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.690 at
FT                   residue 37"
FT   gene            complement(441812..442906)
FT                   /locus_tag="Bphy_3506"
FT   CDS_pept        complement(441812..442906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3506"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tbd:Tbd_2532 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72655"
FT                   /db_xref="GOA:B2JLM2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM2"
FT                   /protein_id="ACC72655.1"
FT                   /translation="MKNLLRALFAAVPSAAMLVACGSKPAPDALRAVRTAEIRYDETLV
FT                   TDRYVGTVQPRHEVIEAFRVGGKVVKRKVDVGQKVREGDVLAVLDDTDYRLAEEAARQQ
FT                   LAAAISQARLAESDRRRLNSLKTDGSVSVSDDEKAQTGAQTTSSAAEAEGKKLELARNR
FT                   LKYTVLRASQSGVITSVRFEAGEVVAEGQPMVSIANAGEPEIVADLPEDRLSTFKTARY
FT                   KAWLASAPEQSFDVVLRELSPQATAQTRTYRARLKPAMPRALPLGATATLVVERPVGDA
FT                   SAAVIPASAITQNKGQPAVWVVHRVGSEPVGTVELIGVSVHGYRNDDVLVSGPPAGELI
FT                   VTAGVQKMAPGLKVALAETRQSVR"
FT   sig_peptide     complement(442838..442906)
FT                   /locus_tag="Bphy_3506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.619 at
FT                   residue 23"
FT   gene            complement(442903..444375)
FT                   /locus_tag="Bphy_3507"
FT   CDS_pept        complement(442903..444375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3507"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pca:Pcar_0814 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72656"
FT                   /db_xref="GOA:B2JLM3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM3"
FT                   /protein_id="ACC72656.1"
FT                   /translation="MAGRSAAAAAVVSLALLLASCATPVMQPAIEVPGRFAAASASAEE
FT                   PEAAWWDSYGDPVLSDLVRRAAQENRDVRIAAERVRAARAGETISRSWLLPTLSVGAMG
FT                   FNHTTNYDTVLKNFVPEAANTRAGQVGIGASWEVDVFGRLRAGAAAAAADTIAVQNTAR
FT                   GVRLLVLTDVATNYFTLVGALRQLETVRAISAAQDETLRLVTARERVGLATPFDVERVK
FT                   TEASRTHAAIPPLETLAAVSRHHIAVLVGDQASNAASITPSGVGAIVPPARPGQPATLL
FT                   QRRPDLLVASAQLDAANARRQQAMAEWFPRLFLGAVFGRESIDLNGIALGPARFSNVAG
FT                   LIAMPIFNAGRTQAINDIAEIGQKEAVLHYEDAIVRALEDVENALVALDDERQRAQLLE
FT                   NAATTAEAALGRAQSLYNRGQTDLLPLLDAQRTRLAVRAIANDSSTQLLLDSVQLYKAL
FT                   GGGWEVFEAAPAPDGTAPSHSSSNVDRDEGPS"
FT   sig_peptide     complement(444307..444375)
FT                   /locus_tag="Bphy_3507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.779 at
FT                   residue 23"
FT   gene            complement(445040..445342)
FT                   /locus_tag="Bphy_3508"
FT   CDS_pept        complement(445040..445342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72657"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM4"
FT                   /protein_id="ACC72657.1"
FT                   /translation="MLMEDASYIFSTPRPAAGRRIYIRLWLDDSLWARDAFYLCGCGDV
FT                   RLSNFLTESSAAPLWLAFSATLRRRSSVFAAGFRAAVTECPHSDSDCYTRRGDGL"
FT   gene            complement(445372..446112)
FT                   /locus_tag="Bphy_3509"
FT   CDS_pept        complement(445372..446112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3509"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: reu:Reut_A3378
FT                   OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72658"
FT                   /db_xref="GOA:B2JLM5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM5"
FT                   /protein_id="ACC72658.1"
FT                   /translation="MRNYSRKLRSAGVAACICSAALGDNASSQTAGSFTVATGWLHVAP
FT                   QSSATPLTVESVGGMTVNQQLPGTGAHATSTDTMGITTEYYVTDHVGVATLIGLPLTVN
FT                   LVGDGALGKYGTLGSTRPVPPAVVLRYHLFEAQSKFRPFVGLGVNYTWFTQVRTTNSKF
FT                   ITDNLGPGGSAHASLSSSWNPVFEIGANYAITKHWSVGAAVGYVPLKTHLTLDGTTANG
FT                   THIVSRSTIRINPINVFLNVAYTF"
FT   sig_peptide     complement(446032..446112)
FT                   /locus_tag="Bphy_3509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.500 at
FT                   residue 27"
FT   gene            complement(446520..447569)
FT                   /locus_tag="Bphy_3510"
FT   CDS_pept        complement(446520..447569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3510"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein; KEGG: ppf:Pput_2873 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72659"
FT                   /db_xref="GOA:B2JLM6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLM6"
FT                   /protein_id="ACC72659.1"
FT                   /translation="MDKKLYISDVTLRDGSHAIRHQYSVAQARRIAIALDDARVDSIEV
FT                   AHGDGLQGGSFNYGFGAHTDIEWIKAVASVVKHAKIATLLLPGIGTVRDLRAAYDAGAR
FT                   IARVATHCTEADISRQHIEYAREIGMEAVGFLMMSHMQTPRALAEQAKLMESYGATCCY
FT                   VVDSGGAMNMNDIRDRMRAFKDTLRPETQTGIHAHHNLSLGIANSIVAVEEGCDRVDAS
FT                   LAGMGAGAGNAPLEVFIAAAARLGWNHGTDLYRLMDAADDIVRPLQDRPVRVDRETLAL
FT                   GYAGVYSSFLRHAERAASKYGLKTVDILVELGRRRMVGGQEDMIVDVALDLCGAREFAS
FT                   SASGRADLI"
FT   gene            complement(447581..448528)
FT                   /locus_tag="Bphy_3511"
FT   CDS_pept        complement(447581..448528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3511"
FT                   /product="acetaldehyde dehydrogenase (acetylating)"
FT                   /note="TIGRFAM: acetaldehyde dehydrogenase (acetylating);
FT                   PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Acetaldehyde dehydrogenase; KEGG: ppf:Pput_2874
FT                   acetaldehyde dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72660"
FT                   /db_xref="GOA:B2JLM7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLM7"
FT                   /protein_id="ACC72660.1"
FT                   /translation="MKRKLKVAIIGSGNIGTDLMIKILRHGEHIEMGAMVGIDAASDGL
FT                   QRAARLGVVTTHEGVEGLSRMPVFADIDIVFDATSASAHTRNDAFLRAIKPGIRFVDLT
FT                   PAAIGPYCIPVVNGERHLDAPNVNMVTCGGQATIPMVAAVSRVARVRYAEIVASISSRS
FT                   AGPGTRANIDEFTETTSRAIEVVGGAAVGKAIIVLNPAEPPLIMRDTVYTLSEFVDERQ
FT                   IEESVTRMAEAVQTYVPGYRLKQRVQFDRIDADGPIRIPGISDRMVGLKTSIYLEIEGA
FT                   AHYLPAYAGNLDIMTSAAKVTAEGVANRLLANKK"
FT   gene            complement(448525..449334)
FT                   /locus_tag="Bphy_3512"
FT   CDS_pept        complement(448525..449334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3512"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: dar:Daro_3242
FT                   hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72661"
FT                   /db_xref="GOA:B2JLM8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM8"
FT                   /protein_id="ACC72661.1"
FT                   /translation="MTQTLDQTAIQAAAEALRNARATCTPIDPISTRYGISGLEAAYAV
FT                   AEANTTTLTDAGRRIVGKKIGLTSVAVQQQLGVDQPDFGVLFDDMEYLDGDEIPVSRLL
FT                   QPKIEAEVAFVVGRDIDDEAPSYGRVLSSLAYALPALEIVDSAIADWRITLEDTVADNA
FT                   SCGLYVLGHQPVALGQLSLDELGMSMTRHGKIVSTGSGAACLGHPLRAVYWLACTMGRR
FT                   GKKLRAGDVILSGALGAMVPLGRADAIHAQIGALGSVSCRIAGGEDR"
FT   gene            complement(449360..451123)
FT                   /locus_tag="Bphy_3513"
FT   CDS_pept        complement(449360..451123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3513"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: mxa:MXAN_1594
FT                   FAD-binding monooxygenase, PheA/TfdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72662"
FT                   /db_xref="GOA:B2JLM9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM9"
FT                   /protein_id="ACC72662.1"
FT                   /translation="MNVADREDACDVAIVGLGPTGLVLAHMLGRAGHRVVVLEREPVFY
FT                   GNARAVYTDDECMRIFQHLDVADELQSQMMMETPVQLVRPDGTPIAQYMPRKRPLGWPV
FT                   INFFYQPYLETTLSESLRRYPNVEVRRGREVVDFSQNSEGVSIVHQATREARFSDSSDA
FT                   RAPLRGDPDIQCMGARYMVGADGGRSIVRTKLGIEMSGRSFPEPWLVVDLERKPGTDAL
FT                   RHLPYFNFVVDSRLPVVSCVQPDKFHRFEFMLMPGETKENMEQPETVRKYLSMFVDPDQ
FT                   FVVKRKLVYTFNALIAAKWRVDRILLAGDAAHMTPQFMGQGASSGVRDAYNLGWKLDLV
FT                   LRGVAGDALLNTYQSERHGHAKAMIDVSVLLKNVVSARNPFATLARDISLNAIRMVPPL
FT                   RRWFREGGFKPTPVYRKNAYLGLPRRGRKGPEGALAPQPEVRLFDGSRRRMDDLLGHGF
FT                   SLVGLNVDPFRHLDKASAQTLKALSIQAITLYPYGGRPQGLNGVERHSRNGATEVEDIN
FT                   GDMIDWFRKAGFSKEAVAILRPDRFTFAVVPAVALNRALVRLCDQLGKQEGVCTPFARV
FT                   STDAPSVAKAA"
FT   gene            complement(451120..452130)
FT                   /locus_tag="Bphy_3514"
FT   CDS_pept        complement(451120..452130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3514"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mav:MAV_2516 extradiol ring
FT                   cleaving catechol dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72663"
FT                   /db_xref="GOA:B2JLN0"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN0"
FT                   /protein_id="ACC72663.1"
FT                   /translation="MPTIANPAPAPESLFGRVRMGYLLAESARLDEWRRFSAEGLGLHV
FT                   DIPQPGVVACRIDAHQRRLIVREGAVEDVIAIGWQLDDEAALQLAFARLAKRGIIVQEG
FT                   SAAEAALRGVEKFWFFAGPKKLRIEIFTGAVLSDLPLRMKGQGFVTGAAGMGHVAVTTR
FT                   EPEVMQAFWKSVFDARLSDEIKDRIDGLKLDFAFLRFNERHHSLATASTRGVRLNPLRT
FT                   QIHHLNLQCASLDDVTQSYLRCRAMGYRIANTIGQHPNDRELSFYVETPSGWEIELGWN
FT                   PIVVDEHTWRTATYEGISLWGHRPQNLSLRARLRRFRRALASLMQPEFTVQGEQL"
FT   gene            complement(452155..453036)
FT                   /locus_tag="Bphy_3515"
FT   CDS_pept        complement(452155..453036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3515"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mav:MAV_2517
FT                   2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72664"
FT                   /db_xref="GOA:B2JLN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN1"
FT                   /protein_id="ACC72664.1"
FT                   /translation="MDVSSLTSAMTERIVRVGARQIFLTEAGRGPAVLMLHGGGPGASG
FT                   VSNYSRNVEALARRFRVLVPDMPGYGKSTKGLDRGDPFGDLATCMLGMLDSLGIGRAHV
FT                   IGNSLGGACALRMALERPETVGRLVLMGPGGVDTTRQLPTPGLKRLLTYYKGEGPTLEK
FT                   LTRFIRGDLIYDAGLVPESVIRERFRASIDPEVVASPPLLGPKGVPQFRKIDFTRDPRL
FT                   KSVQNPALVLWGTEDKVNRPSGAHSLQRRMANCDVYLFSKTGHWVQWERAEEFNAAVVA
FT                   FLAQDGIKAGTA"
FT   gene            453163..453870
FT                   /locus_tag="Bphy_3516"
FT   CDS_pept        453163..453870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3516"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pla:Plav_1538
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72665"
FT                   /db_xref="GOA:B2JLN2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN2"
FT                   /protein_id="ACC72665.1"
FT                   /translation="MSETTNIDHRTRVAAERRERMRARLIESALLVFAEKGVGASVIQE
FT                   VIAAAGVSQGTFYNYFRTNEELLTAVTQELNDELLRLIETEVGAYADPARRIACGVRLF
FT                   LHAARTYPLLARFICAAGLHVAGPSSLIYVYLPAHIEQGLAEGHFRDVTVKVALDVIAG
FT                   TVLTTIQRFTAEGQECAQPEQAVAAILRSLGVSRSKAQALVHGELVSIAVPAGSLLERG
FT                   HARLQQQMLGSSR"
FT   gene            453877..454341
FT                   /pseudo
FT                   /locus_tag="Bphy_3517"
FT   gene            complement(454616..455493)
FT                   /pseudo
FT                   /locus_tag="Bphy_3518"
FT   gene            complement(455490..456011)
FT                   /locus_tag="Bphy_3519"
FT   CDS_pept        complement(455490..456011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN3"
FT                   /protein_id="ACC72666.1"
FT                   /translation="MIGLTSRHAETQDNSVAGTSTARQDSDEFVRMRQQVAAADREYDR
FT                   EAAAAKKVYDPRRRKRRRSATPRSRSPITARASRGRLADVAVVAAHYAAAGANERIMNF
FT                   PSRVARQCLTFKGKPPVVAALSVASTTSVYAQKNSCATDTAMNAFGDAAVKDRRYSLNG
FT                   VKTETTMDRE"
FT   gene            complement(456358..458373)
FT                   /locus_tag="Bphy_3520"
FT   CDS_pept        complement(456358..458373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3520"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: sfu:Sfum_2956 glycogen
FT                   debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72667"
FT                   /db_xref="GOA:B2JLN4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN4"
FT                   /protein_id="ACC72667.1"
FT                   /translation="MPEGVNFCIFCRHATHVELLLYEAADSAEPFQVVVLTSEHNRSFF
FT                   YWHVLVENLPPHVCYTWRVDGPHDAQNTGRVFDARRELLDPFAHAVSDLLWDRRKTIES
FT                   ADVANAVYRAIVVESTAAPRLPVARGLDDSIIYELHVGGFTRDPSSGVRHPGTFDGLIE
FT                   KIPYFQQLGVTHLELLPVMAFDEQDVPDPVAARSLVNYWGYSTHSFHSPHPRYCVDPAN
FT                   AVNEFRAMTDAMHAAGIQVLLDVVFNHTAEAGEAGPVINFKGFANDIFYQHDPGDARRY
FT                   LDYTGCGNTVNCNHPLVTAFIVHCLEYWVEEMGVDGFRFDLASVFARDGHGELMIDPPL
FT                   PWAIESSRTLSRVPLIAEAWDAAGLYHVGAFPGMAWAEWNGRYRDVIRRFVRGDAGIIG
FT                   EVATCIAGSADLYADDGRLPGSSVNFVTCHDGFTLNDLVSYNGKHNEANGQENRDGSND
FT                   NLSWNCGAEGETDDAGIVQLRGRQARNLMAILFLSQGVPMMLAGDEVLHSQHGNNNGYC
FT                   QDNALSWFDWRRVESASGMLRFMRELIALRKRHASLRRRRFLTGRPVQGHAHPDIAWHG
FT                   ERLHEPEWQNPRARLLAFTVGGEDPGEALLHVVLNMDDLARQVALPTVLGGKCWYRIID
FT                   TAQASPHDILSAPRKAATELDHCLIQPRTVVVLEAD"
FT   gene            complement(458456..458623)
FT                   /pseudo
FT                   /locus_tag="Bphy_3521"
FT   gene            complement(458667..458813)
FT                   /pseudo
FT                   /locus_tag="Bphy_3522"
FT   gene            459265..460337
FT                   /pseudo
FT                   /locus_tag="Bphy_3523"
FT   gene            complement(460307..460870)
FT                   /locus_tag="Bphy_3524"
FT   CDS_pept        complement(460307..460870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3524"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_A1969
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72668"
FT                   /db_xref="GOA:B2JLN5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN5"
FT                   /protein_id="ACC72668.1"
FT                   /translation="MKPERLSHARRKEQTRERLYGAARTMFLEKGFAATSVEDIVEAAG
FT                   YTRGAFYSNFRSKQDLLTELLRRDADEAQADLQAIFQEEGTPEHATARAIANFVRSYRE
FT                   RECFPLWVEAYLLARRDRAFQERVHALRHEKLLQISAHIQTLLTDCDNALPPRADALAL
FT                   GFVSLCEGMQLFSLCYPPNATDHA"
FT   gene            complement(461155..462018)
FT                   /locus_tag="Bphy_3525"
FT   CDS_pept        complement(461155..462018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3525"
FT                   /product="Pyrogallol hydroxytransferase"
FT                   /EC_number="1.97.1.2"
FT                   /note="KEGG: dsy:DSY0778 putative oxidoreductase
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72669"
FT                   /db_xref="GOA:B2JLN6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN6"
FT                   /protein_id="ACC72669.1"
FT                   /translation="MSKWNLVIKVGQCENCQNCVIAARDEHVGNDFPGYAAPAAASAES
FT                   PIRILRRVQGASHMVETTYLPVLCNHCDDAPCMRVGGDAIRKRSDGIVIIDPEKARGRK
FT                   DIVKSCPYHAIVWNEDLQLPQTWIFDAHLLDQGWQHPRCEQTCPTGVFEAVKLDDAAMA
FT                   EKARREGLDVLLPNLETKPRVWYSGLKRWKSCFIGGSVSATVGGVVECVAGAAVALYAG
FT                   DQRVADTVSDAFGDFRFGGLEKNSGMYRIEIHHALGNASRECKVGESVYLGEVSLKLAA
FT                   SEVEVD"
FT   gene            complement(462029..465007)
FT                   /locus_tag="Bphy_3526"
FT   CDS_pept        complement(462029..465007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3526"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: dsy:DSY3535 putative
FT                   anaerobic dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72670"
FT                   /db_xref="GOA:B2JLN7"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN7"
FT                   /protein_id="ACC72670.1"
FT                   /translation="MKRQILKTILFTMPKVLDLTARRFPAYRDRLKERDLVAWIGLMDQ
FT                   SLGRVIKLENGRIRSCAGTHPQPDVRMLFKDVGTALKFLFPNPDYLDIIHAAKNFKVIT
FT                   EGDDELLVWFMQTLSMMQTISLPMGTQMRDGTQRYTTCTNGGPLFVYVKDGRIVRVTPV
FT                   DLDSKDAPSWEIEARGRRFSPPRRGLVAPHALSIKSLVYSDKRILHPMKRVDFDPDGER
FT                   NPQNRGKSGYVPISWDEALDIVAKEINRQKRVHGPGSITFPMSSHHQWGNVGYYLSALT
FT                   RFANLIGFTRVAANPDSWEGWYWGAMHHFGNSMRVGVPSGYGGIEDCLKEAEMIVFWSC
FT                   DPESTNGAYAGFEGTPRRMWAKELGIEFVHIDPHCNPTAQLLGGRWIPVRPQTDAALAT
FT                   AIMYVWLKEGLYDKDYVANRTTGFDEWRAYLTGETDGVPKTPEWQEQETGVPAKDVRAL
FT                   ARRWGAKKVYLAVGMTGAGFGGAGRGATGAQWARCMIMMMAMQGWGKPGVNFGCLEIGV
FT                   PHDLNFYFPGYADGGVSGELAWTANAVNNYQRMPHILTMNPVKQMVPRQQLPDAIINGH
FT                   AAGYLWDGMSQEAQFAPFTYPMPGYSPIRMIYRYGGSAFSTVTKSGRWADAYRHPSIEF
FT                   VVNQSIWMEGEAQFADIILPACTSLERWDIGEWANSGGYAHHGFNTVNHRMVTMQHKCI
FT                   EPLGESRSDYDIFTAILTRLGLGGVFTEGCGELDWVKRVFDSSDLPDHISWREFCRKGY
FT                   FVVPPEKPEMRSPVDMRWFAEGRRKDLPEPLPMPSQYAEKFGMGLQTPSGKLEFVPDLL
FT                   KRHTADNPERPPVNRYIPSWEGLRSPLAQQYPLQLIATHSRYSFHTHCDGKNSSVNSVE
FT                   DHRALIGGHRFWLLRLGPVDAAARGIAHRDLVKIYNDRGAVICAADVSPLVTAGVVKSA
FT                   EASAEFQLIEIDGECVEIGGCMNLLTPDRPQTAGTSSMSPNSCLVQVEKWKDADAFMIR
FT                   RAA"
FT   gene            complement(465117..466031)
FT                   /locus_tag="Bphy_3527"
FT   CDS_pept        complement(465117..466031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3527"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pla:Plav_1539
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72671"
FT                   /db_xref="GOA:B2JLN8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN8"
FT                   /protein_id="ACC72671.1"
FT                   /translation="MLIEDIEFVTFRHPDLAAVRDFMVDYGLLDLQHDGDALYLRSYGD
FT                   APFSYVSTQGEAAFVGVGFRVSSREALDTLAARFDSPVTDCPHPGGGLYTVGADPDGRR
FT                   LEFVFGAERLPAIPSGGDPIVWNDAHAKNRLGHFQRPAFGPSHIQRFGHVAVFSPDPQG
FT                   VISWYGETLGMKASELIYQGKEKNVVAAFMHLETGAAWTDHHTLAIVGGKAVGLDHASF
FT                   ECRDIDDVGIGHMVMVDKGYKHRWGIGRHFHGSQIFDYWTDPAGFHVEHYVDGDLVNND
FT                   SPTLSYPFGRDTLLQWGPAFPGL"
FT   gene            complement(466108..466848)
FT                   /locus_tag="Bphy_3528"
FT   CDS_pept        complement(466108..466848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3528"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: reu:Reut_A3378
FT                   OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72672"
FT                   /db_xref="GOA:B2JLN9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN9"
FT                   /protein_id="ACC72672.1"
FT                   /translation="MRNYRKNVRPAVMAGLICSAALAGNANAQSAGSFTLATGWLYVAP
FT                   QGHATPLTVESVGGMPVNQQLTGTGAHASSTNTLGITTEYYVTDNIGIATLFGLPLTVN
FT                   LDGDGTLSKYGTLGTTRPMPPAIEVRYHLFDAQTKFRPYVGLGVNYTWFTQVRATNHQF
FT                   ITDSVGPGGSIHATLSASWNPVFEVGASYMFAKHWSVGASVGYMPLKTHMTIYGQTATG
FT                   TQIVSKSTLRIEPINVFVNVAYTF"
FT   sig_peptide     complement(466762..466848)
FT                   /locus_tag="Bphy_3528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 29"
FT   gene            complement(467124..467375)
FT                   /locus_tag="Bphy_3529"
FT   CDS_pept        complement(467124..467375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72673"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP0"
FT                   /protein_id="ACC72673.1"
FT                   /translation="MGKKMGIAAERSLRSLVQKWLAPTSGTPVRVTRLSRPQSHAGNCV
FT                   HIELLLPTRPVGLFFFRHRDGSWSVFPPQAERLVMRVH"
FT   gene            complement(467483..469471)
FT                   /locus_tag="Bphy_3530"
FT   CDS_pept        complement(467483..469471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3530"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bch:Bcen2424_5777 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72674"
FT                   /db_xref="GOA:B2JLP1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP1"
FT                   /protein_id="ACC72674.1"
FT                   /translation="MKAVANEQDVLAIESQGQSADLPSSTYEMICRGAAFNPSAPALSF
FT                   FATADDYANPERWTYSELVRDITRTANMLSRLGVQRETVVAYVLPNLPETHFVVWGGEA
FT                   VGIVCAINPLLEGDAIGELLNASGASVLVTLAPYPGTDLWPKVQAVLHKVASLEHLVLI
FT                   NLADHAPGEQRFAARMLQRGECSRLHGEEGVRGAVASHISIHDFGEAVAREPGMALSTP
FT                   HRATSDDASSYFCTGGTTGLPKIAMRRHGNEVANAWSAGQFLGESVGPGKTIFCGLPLF
FT                   HVNAVMVTGLLPFSRGAHVVMGTPQGYRGEGVVQRFWDIVAHYRINFFSGVPTLYGSLL
FT                   DVPVGERDIGSLEYGLCGAAPMPVELLRAFQAQTGIRILEGYGLTEGTCISSVNPPLGE
FT                   RRVGSIGLRVPGQAMKAVMVDEAGRYVRDCVADEVGQLVISGPNAFIGYMRPEQNNGIW
FT                   LDLADGGRWLNTGDLGRCDADGYFWLTGRKKELIIRGGHNIDPAAIEEALHRHPAVQIA
FT                   AAVGRPDMHAGELPVAYVQLKPGTSANEAEMAAFLRDEISERAAFPKGIRIIEAMPLTG
FT                   VGKIFKPALKRLETVDALRSALADAGVEGGTVSIADDALRGISVHVEIPGAEFESLAAS
FT                   ALGRFPFAFSIAVAQGSGRSGDGNGMS"
FT   gene            complement(469468..470424)
FT                   /locus_tag="Bphy_3531"
FT   CDS_pept        complement(469468..470424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3531"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bch:Bcen2424_5776 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72675"
FT                   /db_xref="GOA:B2JLP2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP2"
FT                   /protein_id="ACC72675.1"
FT                   /translation="MAVHVLHYLHEGRAHWGVVADNAITPVPGEFGSTAEFIEANPVER
FT                   LLVLDGPTIPESDVQWLSPVTANQQFICQGANYRQHMIESGMDPDVKKFNMIFTKATSC
FT                   IVPADSHVVKPNAVRFLDYEIELGLVLKRDITSRQTITDENLHEYIAGAVIVNDYSARD
FT                   IQIPQMQFYKGKSYRTFGPVGPYLCLLEKHDMPKLKELVLTLTVNGTVRQNDLTSGLVY
FT                   GPAETLTELSGVQDLHVGDLLATGTPSGCALIIPSPEKQRAAAQLPEAEKWRLFLALQA
FT                   ERPQYLQDGDVVEARIVSQDGSINLGTQRNVVVAEAP"
FT   gene            complement(470460..471530)
FT                   /locus_tag="Bphy_3532"
FT   CDS_pept        complement(470460..471530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3532"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bch:Bcen2424_5775
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72676"
FT                   /db_xref="GOA:B2JLP3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP3"
FT                   /protein_id="ACC72676.1"
FT                   /translation="MKLTSAQPARHPHPTAKACALAYLIFERPDLEQAERFLNDFGLQT
FT                   VSRGEGLLLLRGTGASHFCYVVRKASKAAFVGFGLQVATRSELEALATLPGASEVEQSA
FT                   LTGGGYVVRLTDPSGFRVDAIWGQTAASALPHRLPLPFNSVDATVRINDTQRPPTHAPE
FT                   VIRLGHVVLELADYQATCAWYTRHFGFIPSDVQVLPDGSPAVAFMRLDLDDTPADHHTL
FT                   ALAQGFVATYSHSAYELVDADAVGMGQRVLRENGWNHAWGIGRHILGSQIFDYWQDPWG
FT                   DKHEHYCDGDLFTSDEPTGIHAVSREAMAQWGPTMPRSFTKPRLTPASLVALFKNLRRS
FT                   PDLTLNKLRTLAKLFA"
FT   gene            471994..472707
FT                   /locus_tag="Bphy_3533"
FT   CDS_pept        471994..472707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3533"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5773 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72677"
FT                   /db_xref="GOA:B2JLP4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP4"
FT                   /protein_id="ACC72677.1"
FT                   /translation="MAAPVTPAPVAEEREPRGARRKRETRARLLDAALRLMAEKGMEGV
FT                   AINEITEAADVGFGSFYNHFESKEAIYTTLVDNVFEEFADMLDRLASGIADPAEVISVS
FT                   VRHTVLRARRDPVWGRFLIREGFSAQMISRGLGQRLLRDIGNGIAAKRFVVADPFIGFL
FT                   AVGGTVLSAIAAELNFVAPGAPAAGVLEEYGFSGEHFPERTAAMLLQTLGLKRAEAEKV
FT                   AARPLPVVEEAAEER"
FT   gene            complement(473097..473858)
FT                   /locus_tag="Bphy_3534"
FT   CDS_pept        complement(473097..473858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3534"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A2126 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72678"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP5"
FT                   /protein_id="ACC72678.1"
FT                   /translation="MMLMQFRSMRRVARALMGVGLATLAACASPPTRFYTLGIDAQPTI
FT                   AVSTASPSFRIDVRPVKVPAAVARSQLVVQINAAQVQVLEDDRWVSSLPDEIRAALIAG
FT                   VSQQAGAPAAKTLVPGEDVPVYEVTVDIQRFESWPGSHVLVDGVWTVSRSTSADTLTCH
FT                   SVVSEPVSGGYQAVAGGHRRAMSVVAAQIAKAIRAFPASGGDSPSRPDGASGTAGKRGE
FT                   RGERGKRALSCPHATDSVQTAADRTAPRVDE"
FT   sig_peptide     complement(473772..473858)
FT                   /locus_tag="Bphy_3534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(473855..475450)
FT                   /locus_tag="Bphy_3535"
FT   CDS_pept        complement(473855..475450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3535"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: bxe:Bxe_A4000 putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72679"
FT                   /db_xref="GOA:B2JLP6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP6"
FT                   /protein_id="ACC72679.1"
FT                   /translation="MHLSNLSTPELKPRKRWLPSLIWLVPLVSALIGMALVARSIADKG
FT                   PLVTVTFNNAEGMEAGKTKVKYKDVEIGAVQAVTLSSDLRRVIVSIQLSKDAEKFATQG
FT                   TRFWVVRPRVGANGISGLGTLLSGAYIGVDIGRSNERQTAFLGLESPPIVTTGQAGHQY
FT                   TLRGESLGSIDIGAPIFYHRVQAGQVVGYSLDPRGAGVIVTVFVNAPYDQYVRTNTRWW
FT                   HASGVDLRLDSNGLKLNTQSLATVVVGGLAFQSPTGQDAGQPAADKAVFRLAADEPDAM
FT                   REPDGPPLNVIMRFNQSLRGLSVGAPVDLRGIALGQVTDIGIEYNEKQKSFSMKVSMAL
FT                   YPDRLSRRSSEALPAPDTPGGHELLQHLVMEGLRGQLRTGNLLTGQLYVALDMFPKAPR
FT                   ATVDVHGNPIELPTVPNTLDELQVQIADIARKLNQVPFDKIGANLNGALENANRLFGHM
FT                   DTEVVPQARDTLAAAQKTFSTAESTLRQTAPMQSDVQDAMQQLTRTLQSLNTLADYLER
FT                   HPQALLFGKKGDRP"
FT   sig_peptide     complement(475322..475450)
FT                   /locus_tag="Bphy_3535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.439 at
FT                   residue 43"
FT   gene            complement(475508..476857)
FT                   /locus_tag="Bphy_3536"
FT   CDS_pept        complement(475508..476857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3536"
FT                   /product="integral membrane protein, PqiA family"
FT                   /note="TIGRFAM: integral membrane protein, PqiA family;
FT                   PFAM: Paraquat-inducible protein A; KEGG: rme:Rmet_4089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72680"
FT                   /db_xref="GOA:B2JLP7"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP7"
FT                   /protein_id="ACC72680.1"
FT                   /translation="MSQMEYRQLIACHECDLLFRKPSSVKGRRAACSRCGASLTALPGS
FT                   GLSLDPICAVTLAALVTFCIAQCFPLIALRANGMTSEATLFGAVRSLWSDNMCVVAAMV
FT                   FCSSILFPLIELLALSYLLVPLRMGNVPPRFNSTLRLIQVVRPWGMVEVFMLGALVTIV
FT                   KMASMAEVIPGPGLFALAALTVLLAVVTSFDPSRLWAVRDGIRSPRMAGIRWSRASGHD
FT                   GRFMKPLRARVAGSSAVITAQRAGLVGCHACGLVQTRIEQQTHHRCARCQHVLHERRPD
FT                   GLTRTVSLLLAAALAYIPANLLPIMHASTLGRSEDDTILGGVAYFWTSGDWPLAVVVFI
FT                   ASVLVPMLKLVALTLLTVVARRGSDWRARERAGLYRVVERIGRWSMLDVFVVALTVTLV
FT                   HFGSFAVITAGPAALAFGSVVILTMLASQQFDPRLIWDNAGQRIRPDDER"
FT   gene            complement(476982..478445)
FT                   /locus_tag="Bphy_3537"
FT   CDS_pept        complement(476982..478445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3537"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bxe:Bxe_A1966 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72681"
FT                   /db_xref="GOA:B2JLP8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP8"
FT                   /protein_id="ACC72681.1"
FT                   /translation="MSFTYKTSVVAVVAALAVTACSFGPSGEPPAMPSPEHYGAQPQLS
FT                   KTVAAGGIAQSFDVGATGVTQWWRLYRSPALNALVDEGLRNSPTLAATQRTLAAAQEEL
FT                   RAQVGASTLPSIDGAVQVERARSPVVPGLGPEQVQYNFFAGQLLAHYTFDLFGQTRYMN
FT                   SASAARVNVQAFELEASRRALAANIVASAINVAALDRQIALTERLVAVSIDAANEDQQR
FT                   YALGSVSRAQALASKQDAAAIAATLPALRQQRALAIHTLAVLMGRTPDNAPDVPALDSL
FT                   SLPEHVPVAVPSDLLRSRPDIQAADAAVKAAAADVGAATAQLFPSLSLTGSMGRGGFSW
FT                   PAVLSGAGGLWAIGAGLSQPIFHGGALFAQRRASIDAYAAAVLHYKSTVLSAFQDVANS
FT                   LAALDNDAQASASTEVAADAARAAFDDTASRHRMGSLPLAATHASESRYLNAQIGAVRA
FT                   AGQRMSNTAALFQAMGELPASQQTAASTQ"
FT   sig_peptide     complement(478362..478445)
FT                   /locus_tag="Bphy_3537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.748 at
FT                   residue 28"
FT   gene            complement(478448..481621)
FT                   /locus_tag="Bphy_3538"
FT   CDS_pept        complement(478448..481621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3538"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A1967 multidrug efflux pump, RND family,
FT                   AcrB/AcrD/AcrF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72682"
FT                   /db_xref="GOA:B2JLZ2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ2"
FT                   /protein_id="ACC72682.1"
FT                   /translation="MNARDHENAGDGALVNTPEKPADDGTGFNLSAWALRHQQLVIFLI
FT                   GLMTLFGVIGYTHLAQSEDPPFTFRTMVIKTYWPGATAREVQEQITDRIGRQLQAAPYV
FT                   DNIKSYSRPGESMIFFAMKDSAPVREVPETWYQVRKKVGDIRATLPKGAVGPFFNDEFG
FT                   DVYTNIYALEGDGYTPAQLHDYADKLRTVLLRVPGVAKVDYFGDPDQHIFVEISNTQLT
FT                   RLSITPQQLAQAIDAQNAVAPVGTITTADDRVFVRPSGAFRDEQALADMLVTVNRRTFR
FT                   LGDIATIKRGYDDPPVTQMRVGGQAVLGIGVTMQKGGDVIDLGKALDARTAELQASLPA
FT                   GLKLAAVASMPHAVKHSVDDFVEAVGEAVAIVLVVSLVSLGLRTGMVVVITIPIVLAVT
FT                   ALCMHLFGIGLDKVSLGTLVLALGLLVDDAIIAVEMMAVKLEQGWSRMRAAAFAYTSTA
FT                   FPMLTGTLVTVSGFLPIALAKSSTGEYTRSIFEVSAISLVVSWFAAVVLVPLLGFHLLP
FT                   ERAGPASGGHGHEHDVYDTGFYKRLSGWVAACIHRRWVVLGITAVLFVIAMGAFTRVPQ
FT                   QFFPNSERPELLVDLRLPEGASFEATLRESKRLEKVLEGKPGIDHFVDFVGTGAPRFYL
FT                   PLDQQLQQPNFAQFVITAKDVETREELMHWLDAKLEKDFSGVRTRVARLENGPPVGFPI
FT                   KFRVSGDDVATVRSIAETVADKTRADSRTRNVQFDWDEPAERSISFEIDQNRARQLGVT
FT                   SEDVSSFLAMTLSGYTVTQYRERDKLINVDLRAPNSERVDPAKLTSLAIPTPNGPVPLG
FT                   SLGHVRDTLEYGVIWERDRQPTITVQADVRGDAQGIDVTHDIDHALATVRAKLPVGYRI
FT                   DVGGAVEESVKGQTSINAEMPLMIIAVLTLLMIQLKNFARTFIVVLTAPLGLIGVVAAL
FT                   LLFGKPFGFVALLGVIAMFGIIMRNSVILVDQIDQDIAAGHARFDAIIGATVRRFRPIM
FT                   LTAAAAVLALIPLLRSGFFGPMATALMGGITIATMLTVFFLPALYATCFRVRRDERGTQ
FT                   QVVVEHTEV"
FT   gene            complement(481618..482796)
FT                   /locus_tag="Bphy_3539"
FT   CDS_pept        complement(481618..482796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3539"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bvi:Bcep1808_1683 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72683"
FT                   /db_xref="GOA:B2JLZ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ3"
FT                   /protein_id="ACC72683.1"
FT                   /translation="MNIVKHSGPVAPKLSRSLLSFLSQSTHRVPVVIAACSAVLLCACH
FT                   QREAVVPQAKPVVARAVRPDGRVAGSSLPAQVQARYSTPLSFRVGGKVIERRVRIGDTV
FT                   KAGQTVALLDPTDLQNNLVNARAQLDAAEHRLVFAKQQLDRDEAQSRANLIAASQLEQT
FT                   QDAYANAVAQRTSALAQMALASDHLRYATLTADHDGVITSEDVDTGQNVQATQAVYHLD
FT                   WTGDVDIVCDAPERTVNSLTVGSKARVTLPALPGKVLEARVREVSAAADPESRTWRVKL
FT                   TLAAPSPEVRLGMTANVVFDVAADGAAGEAFTVPVTALFHQGEKPAVWVVRNGSDTLEL
FT                   RPVTIQRYDERTVSLGSGLHDGDRVVLQGVHAVSSGQHVQVVPPLHSEDSPT"
FT   gene            483026..483778
FT                   /locus_tag="Bphy_3540"
FT   CDS_pept        483026..483778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3540"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5773 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72684"
FT                   /db_xref="GOA:B2JLZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ4"
FT                   /protein_id="ACC72684.1"
FT                   /translation="MPDGRHLRAGRRQTAKPSCTNREPMPGRSPRVARRRHETRSRLLD
FT                   AAFGLVVENGMDGVTISQITDAADVGFGSFYSHFDSKEGIFAALVEWLFEEFANTLDRL
FT                   ASGLTDPAEVIAVSVRHTLLRAYREPVWGQLLIREGLSARALSRGLGQRLLRDTARGIA
FT                   EKRFQVADELMSVISVIGTVLAAIAAELDLSTPPRRTSRIRKILPSRAEKFAGSTAAIV
FT                   LQAFGLARPEAEKIARRPLPAALQDTTA"
FT   gene            complement(483971..485025)
FT                   /pseudo
FT                   /locus_tag="Bphy_3541"
FT   gene            complement(485177..485413)
FT                   /pseudo
FT                   /locus_tag="Bphy_3542"
FT   gene            485455..485568
FT                   /pseudo
FT                   /locus_tag="Bphy_3543"
FT   gene            complement(486352..486849)
FT                   /locus_tag="Bphy_3544"
FT   CDS_pept        complement(486352..486849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3544"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: pde:Pden_4517
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72685"
FT                   /db_xref="GOA:B2JLZ5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ5"
FT                   /protein_id="ACC72685.1"
FT                   /translation="MCDLQAISAVALNHFFAQRAMRAFWTHFDETLRHTDVNASQFCML
FT                   ALLHQREPLVFGDMAAELEMDRSNLSANLAPLLRRGLISTITHERDRRKRQLVVTARGR
FT                   KAVTSAMIPWMRAYQDTFTFVRLLDIDSMRDLFRVMRDMKKQDDLSGTAVRPESQLVLR
FT                   ND"
FT   gene            complement(487051..487857)
FT                   /locus_tag="Bphy_3545"
FT   CDS_pept        complement(487051..487857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3545"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bch:Bcen2424_6530 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72686"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ6"
FT                   /protein_id="ACC72686.1"
FT                   /translation="MPNSKVIVVTGVSSGIGRATAEKFAKRGCRVFGTVRSIAKTASLG
FT                   GVELVEMDVRDDASVQTAIHTIVDRAGRIDVLVNNAGTTLIGAVEETSVTEAAALFDTN
FT                   VLSILRTSQAVLPHMRAQRGGRIVNISSVLGFLPAPYMGLYAASKHAVEGLTETLDHEV
FT                   RQFGIRATLIEPSFTRTNLDVNAPQVSSKIAAYDRERALASSAVVNSVKGAPTPDRVAD
FT                   TIVEAALGGWRMRFTPAGQASLLRKLRRFMPAAPVDASLRKTFGLA"
FT   sig_peptide     complement(487792..487857)
FT                   /locus_tag="Bphy_3545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.718 at
FT                   residue 22"
FT   gene            complement(487893..491022)
FT                   /pseudo
FT                   /locus_tag="Bphy_3546"
FT   gene            complement(491019..492134)
FT                   /locus_tag="Bphy_3547"
FT   CDS_pept        complement(491019..492134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3547"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bam:Bamb_6578 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72687"
FT                   /db_xref="GOA:B2JLZ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ7"
FT                   /protein_id="ACC72687.1"
FT                   /translation="MFSRRLATSALACALPFALAACGEKTLSDPRIEAPLVRMSVVQRA
FT                   VPASRSFTGTIAARVQSDLGFRVSGKVLERLVDAGQTVKRGQPLMRLDPVDLKLAAQAR
FT                   QEAVAAARARAQQTAQDEERYRDLRGTGAISASAYDQAKAAADAASAQLNAAEADADVA
FT                   RNATGYAGLVADGDGVVMETLAEPGQVVSAGQPVVRLAHAGHREAVIQLPETLRPAIGS
FT                   VAQATLFGNSGLSVPATLRQLSDTADSHTRTFEARYVLQGALADAPLGATVTIEIPDAR
FT                   VALQDGLQVPIGAVLDAGKGPGVWVINGEPAKVAWRPVTVLHLDDDSARVSGTLKQGER
FT                   VVALGAQLLREGEPVRVSGQAVAMASEGARP"
FT   sig_peptide     complement(492069..492134)
FT                   /locus_tag="Bphy_3547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 22"
FT   gene            complement(492217..492840)
FT                   /locus_tag="Bphy_3548"
FT   CDS_pept        complement(492217..492840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3548"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bam:Bamb_6577
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72688"
FT                   /db_xref="GOA:B2JLZ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ8"
FT                   /protein_id="ACC72688.1"
FT                   /translation="MPMKNTTIPSAPARGPADHEVRDQIVAAATEHFSRYGYDKTTVSD
FT                   LAKAIGFSKAYIYKFFESKQAIGEMICGNCLHEIESEVRAAVADTDLPPEKLRRMFKVF
FT                   TDASLRLFFRDRKLYDIAASAATENWQAVQAYEARVQKLLQEVLQEGRQSGDFERKTPL
FT                   DETATAIYLVLRPYLNPLLLQYNRDTTDVAPAQLSSLVLRSLSP"
FT   gene            492911..494371
FT                   /locus_tag="Bphy_3549"
FT   CDS_pept        492911..494371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3549"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bam:Bamb_6576 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72689"
FT                   /db_xref="GOA:B2JLZ9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ9"
FT                   /protein_id="ACC72689.1"
FT                   /translation="MLPRHLLAAVIVTSLSTGCAVGPDYVRPAVAMPDSFQGQAAVDHR
FT                   QAAASADLATWWTGFGDPQLTRFVTLALEQNLDLAQAAARVSQARAGLGAANAALLPSG
FT                   NVNGQAARVYQSVETPLGRVLNSTPGFDRYGNDYEANFSASWELDVFGGLRRGREAALA
FT                   DYQASEAGEVATRLAVAAQTADIYITIRGLQARLQVARKQLQTQQDLLSTIKLLYGKGL
FT                   AADLQVSQAEGALAQVQASIPVLEAGLDAAMNALDVMLGSQPGTHRAELLEGGDIPTAP
FT                   QIAGTGSPGTLLRRRPDLIVAERRLAASNARIGVAIAEYYPKVSLSGLIGSATSVASDN
FT                   LFSSGASQGAGVLGLRWRLFDFGRINAQIKEAKGQEAEMLAAYRLAALHATEDVENSYS
FT                   ALVKREDQAAILAQGVSSLGRARAASFAAYQKGVVSLIEVLQADDNLLRASDGRVQAQT
FT                   ESARAAIAAFKALGGGWQPTGPEAVVSR"
FT   sig_peptide     492911..492973
FT                   /locus_tag="Bphy_3549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.503 at
FT                   residue 21"
FT   gene            complement(494485..495207)
FT                   /locus_tag="Bphy_3550"
FT   CDS_pept        complement(494485..495207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3550"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: reu:Reut_C6137 NAD-dependent
FT                   epimerase/dehydratase:short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72690"
FT                   /db_xref="GOA:B2JM00"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM00"
FT                   /protein_id="ACC72690.1"
FT                   /translation="MFKRTFLVTGASKGIGRALSNRLAADGHQVVGLARGADDSSFPGI
FT                   LVSVDLTDRNATARALAGLAERYAFDGVVNNAGFVRLAGVEAIDLDDLEASFRHNLTSA
FT                   VQTVQALLPGMRNRGWGRIVNLSSLVVLGVANRTAYAAAKAAMMSFTRTWALELAQTGV
FT                   TVNSVAPGPTETELFRQNTPVGGEAEQRFLSLVPMKRFGKPDELAAALAFFLSEDAGFI
FT                   TGQTLFVDGGASVGKAAF"
FT   gene            complement(495260..495919)
FT                   /locus_tag="Bphy_3551"
FT   CDS_pept        complement(495260..495919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3551"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: reu:Reut_C6136 metal-dependent
FT                   phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72691"
FT                   /db_xref="GOA:B2JM01"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM01"
FT                   /protein_id="ACC72691.1"
FT                   /translation="MKHDKTAPANDMPGVVIPDSQLAREVAQLIRDTESELLFNHSTRV
FT                   YLWGALLGKRNGVAFDSELLYVASMFHDIGLTSAYRDSELRFEVDGANAARDFLRSHHV
FT                   DEADVAKVWTAVALHTTPGIPEHMHGEIALVQAGAGTDVAGRGFDTFSEEQRAAVIAAW
FT                   PRGADFGGRMIDAFYDGMKHRPATTFGTFNDDFLAYKDPGFERVNLCSIILNSRWG"
FT   gene            496100..497509
FT                   /locus_tag="Bphy_3552"
FT   CDS_pept        496100..497509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3552"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: reu:Reut_C6135 regulatory protein
FT                   GntR, HTH:aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72692"
FT                   /db_xref="GOA:B2JM02"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM02"
FT                   /protein_id="ACC72692.1"
FT                   /translation="MTKLSIGLDRAGRISLSAQIYGSIRDTIESGQLAAGARLPSWSDL
FT                   AAQLGVSRGTVRAAYERLIDEQFAIGLGAAGTRVTARPSPATTGWSPEAPPLPDLFYDF
FT                   NAAPLAFQMGVPSQDAFPFKLWSRIQARAARRAAAAPVGYPDPRGEPDLRQEIAAYLGV
FT                   SRGLRCSPSQVFVTVGFSGALNLAIRALRVEGRQAWMEDPGFPLTRTALELAGMTVAGV
FT                   PVDADGLDIDAGTRIAPKAVLAVVTPGQQAPLGMTMSLARRISLLGWARQHEAWIVEDD
FT                   YLGELQLKGRAAPALASLDQDGRVLHIGTFSKTISPALRLGFLVVPPAMARHFGDVAAC
FT                   LAPAPAASVQHAVTEFMHDGHYLRHLRRMKRLYAARQEALVHCLKEQASESLRVQGAAG
FT                   MTVVAALSQSVSDVEIALRARAFGLAPVPLSPWYTGDPGQQGLLLGVTNLSEKTLPANC
FT                   HRLLELARGRY"
FT   gene            497629..498072
FT                   /locus_tag="Bphy_3553"
FT   CDS_pept        497629..498072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3553"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   reu:Reut_C6134 cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72693"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM03"
FT                   /protein_id="ACC72693.1"
FT                   /translation="MNIQSIARAACTAMAFAIAVPAAAHGAAETVTPNFQHAIPNIPGK
FT                   SLTAVVVDYAPGAASSAHRHAGSAFIYAYVVSGEIESQVDEGPKRVYHAGESFFEEPGA
FT                   VHRMSRNASETEPAKLLAMFVADSNDKALTTPSSNPPPYGVTS"
FT   sig_peptide     497629..497709
FT                   /locus_tag="Bphy_3553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.670 at
FT                   residue 27"
FT   gene            498069..498524
FT                   /locus_tag="Bphy_3554"
FT   CDS_pept        498069..498524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3554"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bam:Bamb_6384 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72694"
FT                   /db_xref="GOA:B2JM04"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM04"
FT                   /protein_id="ACC72694.1"
FT                   /translation="MSKRLDYTQIAPAGVKALGGVYGYVLQSGLSPVLVDLVYLRVSQI
FT                   NNCAYCLDMHTRDLLKKGVKVEKLALVQAWREAGHLFDDRERAALAWAESVTLVAQTGV
FT                   PDEAYDAARAVFNDRELVDLTIAISLMNTYNRMAISFRNTPQAVMET"
FT   gene            499019..499792
FT                   /locus_tag="Bphy_3555"
FT   CDS_pept        499019..499792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3555"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: reu:Reut_C6131 metal-dependent
FT                   phosphohydrolase, HD subdomain; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72695"
FT                   /db_xref="GOA:B2JM05"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM05"
FT                   /protein_id="ACC72695.1"
FT                   /translation="MKIARFVSMACAVLLILVLGFVQTSNLRAAGRAPAPDHQSSDTAD
FT                   RTPNIAIPDSKLARDAARYIRDSEGEFLFEHSTRVYCWAALTAQRNGLPYDPELLYVAA
FT                   MFHDYGLTENYAQSHLRYEVDGANAARQFLRSHGVSEATSEQVWLAIALHTTNGIPAQV
FT                   SPLAALVAQGANMDLVGAGYDDFTAEQRDAIEMAYPHPQDFAEVFMRTLYDSLKHRPET
FT                   TQGTGLADVMAYEDPHFVRRDFSALMRNSHWAARK"
FT   sig_peptide     499019..499108
FT                   /locus_tag="Bphy_3555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.872 at
FT                   residue 30"
FT   gene            500461..500706
FT                   /pseudo
FT                   /locus_tag="Bphy_3556"
FT   gene            500832..502022
FT                   /locus_tag="Bphy_3557"
FT   CDS_pept        500832..502022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3557"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bxe:Bxe_B0560 putative heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72696"
FT                   /db_xref="GOA:B2JM06"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM06"
FT                   /protein_id="ACC72696.1"
FT                   /translation="MGWKNLLIETPVWLMSRFYPPRFDPCRDTPREILVLRPNDFGELL
FT                   TTTPLFEALRKRFPSTRLIAGIGSWGRPILENNPYIDEIVELNAPWNNKIVADRSHKSV
FT                   LRFLWKSPEVAALRARGGFDVAIDVLGSYMGTLLMMRLGARYRIGVRGYRGGDSGCQAH
FT                   VVYARRQCGRAALAQGELLGATDLPEVRPQLFLTNDERAQARQYWATNTLAGQRTVRIV
FT                   AGVGAGVPAKAWPAREVGAALLQIAQAFEQSGSACDIVITGSAADRSRAAEAIAAAGPG
FT                   VPVRSLAGEVPMRIMFALVEEADVVLTNSTMLMHVAAAFRRPTVAVLGGSITKPEVHDA
FT                   IWGYPSHYVSVTPELSAQGERLHEWPAVERVVEAVVQSAAQAQKPDEPRTRLGAAA"
FT   gene            502092..502880
FT                   /locus_tag="Bphy_3558"
FT   CDS_pept        502092..502880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3558"
FT                   /product="putative ABC phosphate/phosphonate transporter,
FT                   periplasmic ligand binding protein"
FT                   /note="KEGG: bxe:Bxe_B0964 putative ABC
FT                   phosphate/phosphonate transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72697"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM07"
FT                   /protein_id="ACC72697.1"
FT                   /translation="MNSVAALPMYGVSPALAAGWRALLADVLRRVEPAAEIVEPHDLHA
FT                   FWRRPDLLLAQTCGYPYVLGLHEYVQLIATPHFDAPGCEGAHYSSLIVTRSDAPFDSIE
FT                   ACRGARAAFNATDSNSGYNAFRHTVAPYARNGRFFGSTLETGSHLGSLHAVAADRADVA
FT                   AIDCVTMAFARDAYPELTSRLREIGSTRSSPGLPLIASKHVSREQADALRAALDETLHV
FT                   QPERAQRLKLKGFSYLTAAAYDSIRQMENEARIANYARLA"
FT   sig_peptide     502092..502145
FT                   /locus_tag="Bphy_3558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.791 at
FT                   residue 18"
FT   gene            complement(502917..504929)
FT                   /locus_tag="Bphy_3559"
FT   CDS_pept        complement(502917..504929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3559"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bxe:Bxe_B0963
FT                   putative biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72698"
FT                   /db_xref="GOA:B2JM08"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM08"
FT                   /protein_id="ACC72698.1"
FT                   /translation="MFNKILIANRGEIACRVAATCKRLGITSVAVYSDADANAKHVAAC
FT                   DEAVHIGGSTAAQSYLRVERIIQAAIATGAQAVHPGYGFLSENEDFAHACEKAGIAFIG
FT                   PPVEAIAAMGSKAAAKALMHSAAVPLVPGYHGDDQSADLLHRQADQIAYPVLLKASAGG
FT                   GGKGMRVVERTEDFAAALASCKREAASSFGNDRVLIEKYLTRPRHVEVQVFADKHGGAV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLQPHVRRAMGEAAVAAARAVNYVGAGTVEFIMTEG
FT                   GEFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLAQDQLRVEGHAIEARIY
FT                   AEHPARGFLPSTGTLKHLRMPEGVEFTLGVGGERAPVRIDSGVREGDTITPFYDPMIAK
FT                   LIVHGASREEALKRMSQALRGCEVVGPHTNVEFLQRIVTSVPFSTGDLDTGLIERHHAA
FT                   LFAPVAKPFVEALALACGALLTREGGVAHGASPWDALSHWRLNSGYMQTLNWRDVETES
FT                   AFSVLFSRDGDTQTLTHEGRTEPFKWWTGAGRHEYGATIGDAHVTGRVFIDGDTFHVFC
FT                   RGEALAFEWQNLLAHAADAEHGEGRLTAPMPGKVIAVLVEQGAVVEKGQPLIVMEAMKM
FT                   EHTIGAPAAGKVAELLYGVGDQVADGAQLLVLDVE"
FT   gene            complement(504990..505775)
FT                   /locus_tag="Bphy_3560"
FT   CDS_pept        complement(504990..505775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3560"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bxe:Bxe_B0962 putative enoyl coenzyme A hydratase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72699"
FT                   /db_xref="GOA:B2JM09"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM09"
FT                   /protein_id="ACC72699.1"
FT                   /translation="MQYDTLTSAFDNGVATVTLNRPDVRNAFNEAMIAELTSAFRALDE
FT                   RDDVRAVVLAANGKAFCAGADLNWMKKMAGFSDDENRADALRLADMLASIYRCNKPVIA
FT                   RVNGDVYAGGMGLISACDIVVAVDTAKFCLSEARLGLIPATIAPYVIRALGEQASRRYF
FT                   MTAEAFDCATAHRLGFVSECVSADTLDETVGQLATTLCANGPHAVKACKQLVHDIAGRE
FT                   ISAALIEDTAVRIAKTRAGEEGREGVASFLEKRSPAWRA"
FT   gene            complement(505800..507407)
FT                   /locus_tag="Bphy_3561"
FT   CDS_pept        complement(505800..507407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3561"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: bxe:Bxe_B0961
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72700"
FT                   /db_xref="GOA:B2JM10"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM10"
FT                   /protein_id="ACC72700.1"
FT                   /translation="MPVIESKLNPRSDDFRANAAALEALVEDLKAKIGKLALGGGPAAR
FT                   DKHVSRGKLLPRDRIAQLLDPGTPFLELSQLAAFGMYGDDAPGAGVITGIGRIAGQECV
FT                   IVCNDATVKGGTYYPVTVKKHVRAQEIAQENRLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFYNQANLSAQGIPQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEEVSAEDLGGGDVHTRLSGVADHLAQNDPHALAIARSIVGNLNRRKNVPVAMQEPKP
FT                   PRYDVKSIYGVIPVDTRKPFDIREVIARIVDDSAFDEFKARYGTTLVCGFAHVWGHPVG
FT                   IVANNGILFSESALKGAHFIELCAQRKIPLVFLQNITGFMVGRKYENEGIARNGAKMVT
FT                   AVATAKVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVK
FT                   RDGIEAKGGTWTAEQEEAFKQPIREQYEHQGHPYYASARLWDDGVIDPAQTRDVLGLGL
FT                   SAAMNAPIEDTRFGVFRM"
FT   gene            complement(507427..508608)
FT                   /locus_tag="Bphy_3562"
FT   CDS_pept        complement(507427..508608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3562"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bxe:Bxe_B0960
FT                   isovaleryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72701"
FT                   /db_xref="GOA:B2JM11"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM11"
FT                   /protein_id="ACC72701.1"
FT                   /translation="MSNLPGLQFPLGEEIEMLRDSVASFAAKEIAPRAGEIDRTDQFPM
FT                   DLWKKFGDLGVLGMTVSEEYGGANMGYTAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTAAQKEKYLPKLVSGDHVGALAMSEPNAGSDVVSMKLRAQKKGDRYVLNGTKMWI
FT                   TNGPDCDTLVVYAKTDIEAGPRGITAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFDN
FT                   VEVPEENILGELNGGVKVLMSGLDYERAVLAGGPTGIMLAVMDAVVPYIHDRKQFGQSI
FT                   GEFQLIQGKVADLYTTLQACRAYLYAVGRQLDTLGSGHARQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEYPVGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETM"
FT   gene            508908..509672
FT                   /locus_tag="Bphy_3563"
FT   CDS_pept        508908..509672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3563"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0959
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72702"
FT                   /db_xref="GOA:B2JM12"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013570"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM12"
FT                   /protein_id="ACC72702.1"
FT                   /translation="MMGVARADGPASRRQPAGRKSQQRVKEILQAGRDVFSEKGYERAT
FT                   TAEIAQRLGISEATVFSYFRGKRELCARVIGDWYDEIIEAIESGLPRDGSIRQQFAFIV
FT                   RTHLRLMLVNGTGLCALVLSEGRTRQHELSEELTGLQRRYTAPLMRVLSQGQQTGQIRS
FT                   DIPLRLLRSLVFGPMEHVLWDAALGNRRTDIDATADRLIDVLWSALQPPDASLDALMQF
FT                   RQEVSEATRRLAEAEAAHKQRAPRLANTNDDA"
FT   gene            509976..510389
FT                   /locus_tag="Bphy_3564"
FT   CDS_pept        509976..510389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3564"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B1321
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72703"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM13"
FT                   /protein_id="ACC72703.1"
FT                   /translation="MQHAINRTCRIAFASMLLVGAWTSVSTAAYAQGAPQSITERHTEV
FT                   THTGSGFRASKLSGTTVYNRDKDKIGTIDDVIVSPSDQHAFAILSVGGFLGMGKHYVAV
FT                   PLGDLQITAKAVTMPDATKSSLEALPEFKYAPD"
FT   sig_peptide     509976..510071
FT                   /locus_tag="Bphy_3564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 32"
FT   gene            complement(510649..511233)
FT                   /locus_tag="Bphy_3565"
FT   CDS_pept        complement(510649..511233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72704"
FT                   /db_xref="InterPro:IPR025693"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM14"
FT                   /protein_id="ACC72704.1"
FT                   /translation="MNETQVARKVAVPTLVVGVLLALGGCAVAPPSGPSVVALPRKGEP
FT                   LEQFQQEDYACRDYAYHSTNANGAAQAATNNAAGSAAVGTLGGAAVGALFGAAAGNPGA
FT                   GAAIGAGSGLLIGGATGANGASYSAYGLQARYDAAYAQCMMSKGNSIAQPQAPVYATPP
FT                   AYYAPAPVYYGPPRPYYYGPPGVVYAPYPYY"
FT   gene            511443..511976
FT                   /locus_tag="Bphy_3566"
FT   CDS_pept        511443..511976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3566"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bxe:Bxe_B0948
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72705"
FT                   /db_xref="GOA:B2JM15"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM15"
FT                   /protein_id="ACC72705.1"
FT                   /translation="MTRRTENLLGVLALLVTDELDAQPSIPALSGITARAMLNAIGQYP
FT                   DSSIELLRDAVDLSHPAAVRATAGLVDAGLVEKKAGSDKRSVALVLTASGRREAKRMRS
FT                   ARGRMLKRIVARLDENEREVFERLLIKILWNETRDASHAMQLCRFCDDKPCLKAGCPVE
FT                   CRDHGLSMPGGSAS"
FT   gene            complement(512140..513633)
FT                   /locus_tag="Bphy_3567"
FT   CDS_pept        complement(512140..513633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3567"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bxe:Bxe_B0945
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72706"
FT                   /db_xref="GOA:B2JM16"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM16"
FT                   /protein_id="ACC72706.1"
FT                   /translation="MDKTTLAYWQKKAAVLAIEGRAFIDGEYRSAENGRTFDCVSPIDG
FT                   KVLVKAADCGETDVDAAVRAARRAFNAGVWSGLNPRQRKATLLKWASLMREHLDELALL
FT                   ETLDAGKPIGDTTSVDVPGAAYCVEWFAEAIDKVGGEVAPADHHLVGLVTREPLGVVAA
FT                   VVPWNFPILMASWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAREAGIPAGVFNVVPG
FT                   GGGPGKLLALHHDVDCLAFTGSTNVGKLIMQYAGQSNLKRVWLELGGKSPNIVLPDCPD
FT                   LDRAARTAAGAIFYNMGEMCTAGSRLLVHRDIKDVFLDKLVAAARSYAPGNPLDPKTSM
FT                   GAIVDQMQLDRVLGYIEAGRAEAKLLHGGARVQQESGGFYIEPTVFEVSKPDAKIAREE
FT                   IFGPVLSVITFDTVDEAVQIANDSDYGLAAAVWTANLTTAHEVSRRLRAGTVWVNCYDE
FT                   GGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLVRLR"
FT   gene            complement(513657..514001)
FT                   /locus_tag="Bphy_3568"
FT   CDS_pept        complement(513657..514001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3568"
FT                   /product="transcriptional regulator, XRE family with cupin
FT                   sensor domain"
FT                   /note="KEGG: bxe:Bxe_B0944 transcriptional regulator, XRE
FT                   family with cupin sensor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72707"
FT                   /db_xref="GOA:B2JM17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM17"
FT                   /protein_id="ACC72707.1"
FT                   /translation="MTFSLCITFRFRECIDIDRGAARLQYICKKHRLSQRELAKRAGVT
FT                   NGTISMSLAEFFTFEVEANRTVVSRRAEMPNLGNEQIDFYLAGASVKGRNMGIMREVRH
FT                   RLMRVPDELR"
FT   gene            514384..514608
FT                   /locus_tag="Bphy_3569"
FT   CDS_pept        514384..514608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_C7564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72708"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM18"
FT                   /protein_id="ACC72708.1"
FT                   /translation="MRVRGPLVWWDRSQFARCLRADNAIADGSNGRLAFRRFLSVFTTL
FT                   SRRSVRRHNAISARASIAVHTDEVASLLP"
FT   gene            514666..514911
FT                   /locus_tag="Bphy_3570"
FT   CDS_pept        514666..514911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3570"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72709"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM19"
FT                   /protein_id="ACC72709.1"
FT                   /translation="MRCVIGRARPQSGRAPLHARNCTQRSQPDRISDCHARRDALTALP
FT                   RKHASAALRSAHGRGIVPHAHDALFAVLPQSTTNTR"
FT   gene            514959..515702
FT                   /locus_tag="Bphy_3571"
FT   CDS_pept        514959..515702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3571"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: bxe:Bxe_B0943 putative
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72710"
FT                   /db_xref="GOA:B2JM20"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM20"
FT                   /protein_id="ACC72710.1"
FT                   /translation="MGLHASHVVGEKYIAAIVDGAQALAMLLPALGERQAPEDLFAHID
FT                   GLLFTGSYSNVEPHRYGGHASAPGTLHDAARDATTLPLMRAAIDAGIPVLAICRGFQEM
FT                   NVVFGGTLHQSVQTVEGYDDHRENKEDDLDQQYAPSHALHLVQGGMLQKLAGGASEVRV
FT                   NSLHGQGVERLGNGLTVEARAPDGLIEAIGVSHARAFTLGVQWHPEWKHAGDALSTAIF
FT                   RAFGAACRDRMRIRTGSAAAANAHV"
FT   gene            515735..517069
FT                   /locus_tag="Bphy_3572"
FT   CDS_pept        515735..517069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3572"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   bxe:Bxe_B0942 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72711"
FT                   /db_xref="GOA:B2JM21"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM21"
FT                   /protein_id="ACC72711.1"
FT                   /translation="MQEIDEFLKKHHITEIEAIIPDMAGIARGKIIPRSKFESGESMRL
FT                   PQAVMIQTVTGEYPDDGTLTGVTDPDMVCVPDPSTIRIIPWAVDPTAQVIHDCVHFDGT
FT                   PVAISPRRVLRRVLDLYKAKGWKPVIAPELEFYLVDMNKDPDLPLCPPVGRTGRAETGR
FT                   QAYSIEAVNEFDPLFEDIYEYCDIQELEVDTLIHEVGAAQMEINFLHGDPLKLADQVFL
FT                   FKRTVREAALRHHMYATFMAKPMEGEPGSAMHVHQSLVDEETGQNLFTGSDGKPTDVFN
FT                   QYLAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVQWGYDNRTVGFRIPHSGPQARR
FT                   IENRIPGVDCNPYLAIAGTLAAGYLGITQRLTPTEPLSSDGYELPYQLPRNLEEGLTLM
FT                   SACEPLAEIMGEQFVKAYLALKETEYEAFFRVISSWERRHLLLHV"
FT   gene            517129..518565
FT                   /locus_tag="Bphy_3573"
FT   CDS_pept        517129..518565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3573"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   bxe:Bxe_B0941 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72712"
FT                   /db_xref="GOA:B2JM22"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM22"
FT                   /protein_id="ACC72712.1"
FT                   /translation="MSFRTEEIAYAQPARPAATASTSQQQRSTAEYRALDAAHHIHPFS
FT                   DMGALNSAGSRVIVKAEGVYLWDSDGNKIIDGMAGLWCVNVGYGRKELADAAYQQLREL
FT                   PFYNTFFKTTHPPVIELSALLAEVTPAPFNHFFYCNSGSEGNDTVLRIVHQYWATQSKK
FT                   LKKFVISRKNGYHGSTIAGGTLGGMGYMHEQMPSQVEHIVHIDQPYWFGEGGDMTPEEF
FT                   GLARARQLEAEILELGAENVAAFIGEPFQGAGGVIFPPSTYWPEIQRICRKYDVLLVAD
FT                   EVIGGFGRTGEWFAHQHFGFEPDLITMAKGLTSGYIPMGAVGLHDRIAKAIIENGEFNH
FT                   GLTYSGHPVAAAVAVANLKLLRDEKIVERVKNETGPYFQQSLREAFASQPIVGEVAGTG
FT                   LVAGIQLAENPKTRKRFENGGDVGTICRDFCFNGNLIMRATGDRMLLSPPLVVTKSEID
FT                   EIVSKAKKAIDATAQQLGLA"
FT   gene            518798..519808
FT                   /locus_tag="Bphy_3574"
FT   CDS_pept        518798..519808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72713"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM23"
FT                   /protein_id="ACC72713.1"
FT                   /translation="MTALLTSEIASKFAGLALDHLTREYPNKLTHSLASPQDVQGPRAL
FT                   HPIFYGSYDWHSCVHGYWLLLHLIDRFPELPEAPRIVAVVDEHFTEHNVAGERAYLDLP
FT                   HNRGFERPYGWAWLLALSGQVAALKLPQGARWTRTIAPLTEAFVDRFETFLPIATYPLR
FT                   VGTHFNTAFALALTLDFAHRTQRDALAKLIVDTAKRWYLNDAGCQAWEPSGDEFLSPAL
FT                   MEAELMRRVLPPAEFDGWFTRFLPGLAQRQPATLFVPATVTDRSDGKIAHLDGLNLSRA
FT                   WCQRSLARALSNDDPRRAVLFEAADVHLESALQHVAGDYMGEHWLATFATLALEA"
FT   gene            complement(519902..520171)
FT                   /locus_tag="Bphy_3575"
FT   CDS_pept        complement(519902..520171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72714"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM24"
FT                   /protein_id="ACC72714.1"
FT                   /translation="MEQSLRNFALSHNGQSVTFDIVVQKRAIGCSITRDALERHFWLER
FT                   GADESHLSKAFGNGQRRITAVAERKALAKGSTHVLITADDFEYR"
FT   gene            complement(520626..521162)
FT                   /locus_tag="Bphy_3576"
FT   CDS_pept        complement(520626..521162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72715"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM25"
FT                   /protein_id="ACC72715.1"
FT                   /translation="MRTLLRAIVTVACVAAALGVLFVPLPGAFNLSTSIVTVMPIARSS
FT                   TAVFDYVTTLAHWPAWHPSSLSVTGAIDHPLDLGERTTEEFRVAGRRGHVVWTVVERRR
FT                   PEKWTIDGMIEGRPAGTVSYALTSDADGTQFERTFTYRSPTLWFALLNAVLLRAKIQAE
FT                   SDEAVERLKRVLEQP"
FT   sig_peptide     complement(521076..521162)
FT                   /locus_tag="Bphy_3576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.549 at
FT                   residue 29"
FT   gene            521338..521745
FT                   /locus_tag="Bphy_3577"
FT   CDS_pept        521338..521745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3577"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   bxe:Bxe_B2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72716"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM26"
FT                   /protein_id="ACC72716.1"
FT                   /translation="MQAHPLRLQPGQDLRDALEHTMHPVGATAVFVVQGIGSLSVARLR
FT                   FAGVEHPTELRADLEILTLAGTVARNGAHLHMSVSGPDGRVFGGHVAHGCIVRTTVEIL
FT                   LALLPDHVFSREPDPQTGFMELFIRNAPRRA"
FT   gene            521892..522788
FT                   /locus_tag="Bphy_3578"
FT   CDS_pept        521892..522788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3578"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: fructose-bisphosphate aldolase class-I; KEGG:
FT                   gox:GOX1540 fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72717"
FT                   /db_xref="GOA:B2JM27"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM27"
FT                   /protein_id="ACC72717.1"
FT                   /translation="MANEKMLAQISEKAGFIAALDQSGGSTPGALRQYGIPDDAYNGDA
FT                   EMFKLIHEMRVRIITAPAFTGEKVIAAILFEATMDGQAQGKPVPSFLWKDRGVVPFLKV
FT                   DKGLEAESDGVRLMKPIPGLDALLARAGKLGIFGTKMRSVIEQNSPAGIAAVVKQQFEY
FT                   GAQIDAGGLMPILEPEVSIKTPDKAGAEKTLRDEILKGLDALPAGKQVMLKLTIPDVAD
FT                   FYKPLIDHPRVLRVVALSGGYTRTEACKLLAKNHGMIASFSRALINDLKKSMSDSEFNA
FT                   KLSEAIDEIYDASALKV"
FT   gene            complement(522860..523327)
FT                   /locus_tag="Bphy_3579"
FT   CDS_pept        complement(522860..523327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3579"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: bxe:Bxe_B2570
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72718"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM28"
FT                   /protein_id="ACC72718.1"
FT                   /translation="MGSINPQSRKTGGAGIVGGGVGEGPGPEVMAAATLDGTKVYSSDA
FT                   EHVGKISDIMLDVRSGRIAYAVLSEGGFLGMGAKLHAIPWSALTLDTAQKCFHVDISAR
FT                   RLKEEPGFDKDHWPSMADLRWGESLHTYYNRDPYWISRSDYVDPDVPPTAH"
FT   gene            523599..523787
FT                   /locus_tag="Bphy_3580"
FT   CDS_pept        523599..523787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72719"
FT                   /db_xref="GOA:B2JM29"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM29"
FT                   /protein_id="ACC72719.1"
FT                   /translation="MALLNMMRMVLWSFFGVRRGAGHEADLATVKLPLLPVMAVVLALC
FT                   FGGLLFAFARIAVTVAH"
FT   gene            complement(523792..525213)
FT                   /locus_tag="Bphy_3581"
FT   CDS_pept        complement(523792..525213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3581"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_3927 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72720"
FT                   /db_xref="GOA:B2JM30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM30"
FT                   /protein_id="ACC72720.1"
FT                   /translation="MNRYEALANTMAAEIRSGSVAVGARMPSLRQVIAQHGVSQSTAFR
FT                   AYYLLEEWGLIRAQERSGYYVAPGAAVRDTREASPKRALTESAKVDISELVFSVLEAAK
FT                   HTGVVPLGSAFPSPVLFPLQRLSKSLAQTSRTMNPWSTVVDLPPGNEVLRQQIALRYLG
FT                   MGLSQPLDEIVVTNGALEALNLCLMAVTRPGDVVAVESPGFYAALQAIERLDLRAVEIP
FT                   VDPQTGLDLEALAQALETQPIRACWFMTNYQNPTGTTMPLEKKKALVELLARYEVPLIE
FT                   DDVYGELHFQAEYPLPAIAFDRKGLVMHCSSFSKTLAPGYRIGWAAAGRFAEKVQRTKL
FT                   MTTLAASIPVQAGIADYLQHGGYDRHLRKLRAALRVQLEAMNLALRRAMPEGVKWTTPS
FT                   GGYFVWLELPEHVDALALHRQAIEQGVSLAPGPIFSASRNFRNCVRLNFGHPWHADIER
FT                   AIRVLGDLIAQAVQQ"
FT   gene            complement(525283..526815)
FT                   /locus_tag="Bphy_3582"
FT   CDS_pept        complement(525283..526815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3582"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   oan:Oant_3069 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72721"
FT                   /db_xref="GOA:B2JM31"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM31"
FT                   /protein_id="ACC72721.1"
FT                   /translation="MMSSISTSRSASHGTPLLLIASMGCAMTVLDTNVVGIVLPGIARD
FT                   LNASFADIEWVISAYVLCFAALLLPAGSLADRYGRKRVFLLGIALFAAASLACSVVRSA
FT                   TLLYIARSAQGVGAAFLLAPALAIIGHAFHHEHERTRAWAVWGGIMGLTMVLSPLIGGL
FT                   ISAWLGWRWAFAINVPICGLLATGVVRIVDESRDPTTRALDLPGIALFAAAMFSLTWAL
FT                   ILGPEHGWFSAAVALRACAGVVLFALFVWMERRRAHPMLDLALFRSLPFVGAIVAMFAY
FT                   ASSAQVMASLLPLFLQNAHGETALSAGVGMLPFALAMLLLPQLGRKLAERMDSRQILTL
FT                   GLAVVACGNLAMTLAARSTDHVWLMVAMALLGSGGGLLNGETQKAIMGTVPRERAGMAS
FT                   GISTTSRFTGILLGFSGLGAVLAEGVRSTLTARMAQTHLPFIHGFAERVMAGDFARAFA
FT                   LYPPASFDALVDVARSSYGEGFAHAFYAAASVAAVSAAIVFLSMRRKTGQSG"
FT   sig_peptide     complement(526729..526815)
FT                   /locus_tag="Bphy_3582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.642 at
FT                   residue 29"
FT   gene            526938..527816
FT                   /locus_tag="Bphy_3583"
FT   CDS_pept        526938..527816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3583"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: oan:Oant_3071 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72722"
FT                   /db_xref="GOA:B2JM32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM32"
FT                   /protein_id="ACC72722.1"
FT                   /translation="MELRHLRYFVAVAERLHFGQAAEALGIAPPTLTVQIQAMERALQA
FT                   QLFRRTRRSVALTSAGEAFLAEARETIAQFERTVNVGERAGRGELGRIRIGYVGSAAFS
FT                   GVLQKQLRAFRKSRPNVLVQATEHPMGELPALLEEGRVDIAFVRLPVDLPPALRAHVLV
FT                   RDAFCVALPAEHSLAAVPGPVKARWLAGESFVVPEQDLGTREVARRGRFSPRIVSTPGS
FT                   LLAVLTQVSVGVGVAVVPNLLTRVVNLPNVVFKTLAGEPIVSEVAAVFRKFEHAPATKK
FT                   LIAQITGAPDQ"
FT   gene            528035..528295
FT                   /locus_tag="Bphy_3584"
FT   CDS_pept        528035..528295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72723"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM33"
FT                   /protein_id="ACC72723.1"
FT                   /translation="MTIEFTSRRHVVAASRVAFEATVEGKEVWCSVSIDALNDHFGNTG
FT                   TSSHDLIAAFEGNRRKIEDAARRVLQRNGGQSVELETRDFH"
FT   gene            complement(528523..529098)
FT                   /locus_tag="Bphy_3585"
FT   CDS_pept        complement(528523..529098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3585"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bxe:Bxe_B0144 histone-like
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72724"
FT                   /db_xref="GOA:B2JM34"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM34"
FT                   /protein_id="ACC72724.1"
FT                   /translation="MATLEALQARIKKLQAQAEAIVSKKSTAALETIRALMAKHDLTTA
FT                   DIDAHLGHKKRGRPALKSAGVQKKGVARYIDPKTGATWTGHGRAPAWIAGAKDRSKYLV
FT                   AGASVPAATHAAVKGGTGNGQPKGPQPAKYRHPETGATWSGRGPAPAWLAGEKDRNKFL
FT                   IAGANAAGTNGIARKKTTAKKAGRKARA"
FT   gene            complement(529570..529917)
FT                   /locus_tag="Bphy_3586"
FT   CDS_pept        complement(529570..529917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72725"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM35"
FT                   /protein_id="ACC72725.1"
FT                   /translation="MRDGPVCLEGTSQRFCCRIALNKEPLTRAQVREELVQLHDAGYSP
FT                   LDDRNSYPTDIPECRGPHRGSTSRVVAAKRIWQRVEWRVAGGCAQGCGRHCVRASLTAC
FT                   WLAHERVLRVP"
FT   gene            complement(529972..530337)
FT                   /locus_tag="Bphy_3587"
FT   CDS_pept        complement(529972..530337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3587"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bxe:Bxe_B3007 response regulator receiver domain
FT                   protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72726"
FT                   /db_xref="GOA:B2JM36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM36"
FT                   /protein_id="ACC72726.1"
FT                   /translation="MAKVLVVDDSSTVRDEVAGFLRKNGLDVDTAVDGKDGLAKLKASP
FT                   GIRLVVSDVNMPNMDGLTMAEKIRGELSNASVNIIMLTTESSPAMKERGKAAGVKGWIV
FT                   KPFKGDAVLETFRKLAS"
FT   gene            complement(530430..530969)
FT                   /locus_tag="Bphy_3588"
FT   CDS_pept        complement(530430..530969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B3009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72727"
FT                   /db_xref="GOA:B2JM37"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM37"
FT                   /protein_id="ACC72727.1"
FT                   /translation="MISQQAKESIERIFLHSARTRLPIDSADACAIAPLDAQHANEALA
FT                   AHIVVLTISSIAFRFLLVLHFDDDKTTRDYYLRESEDRSLAEALMEVGNLCCGAINQKM
FT                   VEFFPDLGMSTPYQLSGACVPYLTELKPDYLAAFRVTIGANVQLGATLCVCASSHVDFV
FT                   ASIDEAEESTGELELF"
FT   gene            complement(530966..531706)
FT                   /locus_tag="Bphy_3589"
FT   CDS_pept        complement(530966..531706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3589"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   bxe:Bxe_B3010 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72728"
FT                   /db_xref="GOA:B2JM38"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM38"
FT                   /protein_id="ACC72728.1"
FT                   /translation="MVDQYVIAAAVAGSAVGALAALYAHRWWYGRRAVALQATVLDSHN
FT                   EALAQAEARHAGEIRQHEQRAHELHALVETLRDDVAQQSQSAEEARTALNALQQHRDEW
FT                   LQQARRLATEAGRLRHLSTTFERWHEQMISLMSQNHDMHAKNNELSSIVRHVLIVSLNA
FT                   SIEAARAGAAGRGFSIVASEVRTLAARSQELSKSYHDSLNRNDLITTATFQDIQAGGKM
FT                   IAASLASVESLAGQIQSRLEQATT"
FT   sig_peptide     complement(531644..531706)
FT                   /locus_tag="Bphy_3589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.958 at
FT                   residue 21"
FT   gene            complement(531723..534113)
FT                   /locus_tag="Bphy_3590"
FT   CDS_pept        complement(531723..534113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3590"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   bxe:Bxe_B3011 CheA signal transduction histidine kinases
FT                   (STHK)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72729"
FT                   /db_xref="GOA:B2JM39"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM39"
FT                   /protein_id="ACC72729.1"
FT                   /translation="MTIRHRITLLVVLMLVALSAIGGYAVYQTRGSAADVKQVTQGVVP
FT                   SALASADLVSQVKDVQLATMTLVYAPDANLVEQAQKELAAKQKSLGAALDMQAKAAASH
FT                   AQEGLVTQARDSLANYFSAINDTAKMKAEGKNDLAQAYLFANVAQYRDELEGIVETLRI
FT                   EKNRQKDEAIDALNTGLATTTTAIGSASGAAILVLIAIGLLLYRQITRPLSRMQEMMSE
FT                   IASSQDFTRRVPVGRMDEIGHSIVAFNGMIEKIQQSSAQLKQKTADIQAMLQNMQQGIL
FT                   TVVDGAVIHSEYSAYLEAIFETKDIANRPLMDLVFAGSDLGSDTVSQVEAAVLACLGED
FT                   SINFEFNQHLLVNELTRTMPDGREKTLDVSWSAITDESDTVMRLMLCVRDVTELRRLAA
FT                   EAGEQKRRLEMIGEILAVNEEKFHHFVDSATGFINENERIIRQHTHADGSAVAELFRNM
FT                   HTIKGNARTYSLQHLTSIVHDTEQRYDALRRPESAHEWDQEVLMAELARVKEALQHYAT
FT                   INEVSLGRRKAGRVHSAERYLVVDRDHIQESLRLLDAANPADMRDLLRARDAVRRTLRL
FT                   LGTEKLEDALAGVLQSLPSLAAELGKVAPQVRIDDNGYRVRSQAGATLKNVFMHLLRNA
FT                   VDHGIESIEQRIAFGKPQAGVIEIEVGVAEGALQITLSDDGRGLALSRIRGIAADRGWL
FT                   QPDSQMSDEAIAEFIFRPGFSTAQNVTEVSGRGVGMDAVRDFIRREGGRIELRFTDDRA
FT                   GADFRQFQTIVYLPENCAVDSVGTSMQDAEKTVSSIQANAHSE"
FT   sig_peptide     complement(534036..534113)
FT                   /locus_tag="Bphy_3590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.648 at
FT                   residue 26"
FT   gene            complement(534347..535282)
FT                   /locus_tag="Bphy_3591"
FT   CDS_pept        complement(534347..535282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3591"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bxe:Bxe_B1313
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72730"
FT                   /db_xref="GOA:B2JM40"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM40"
FT                   /protein_id="ACC72730.1"
FT                   /translation="MESVKRAQSRSHNRALVFVATHPARFALQVIKAFRKNQGLLLAGA
FT                   IAYYALLSIVPLLILVAIAFSHFVGEKLLLDTLTRLLEWLVPGQSRAIVNELANFLAHR
FT                   SVIGWFLVVTMIFFSSLAFTVLENALSIIFVHRVAIRRRHFLLSAILPYLFSLSLGIGV
FT                   LLVTLVSSSLQAVASDSVVLFGHVIPLTGATRVVLYLFGLAGEIFVLTAIYLVIPVGRT
FT                   TLRHALFGAVAAAVLWEITRRVLVWYFATLSQVSVVYGSLTTAIVVLFSLEALATLMLF
FT                   GAQLIAEYERLNAAPKEPAAQPFVTSEIRK"
FT   gene            535745..536773
FT                   /locus_tag="Bphy_3592"
FT   CDS_pept        535745..536773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3592"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0894 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72731"
FT                   /db_xref="GOA:B2JM41"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM41"
FT                   /protein_id="ACC72731.1"
FT                   /translation="MNPISRRPQRRASNLQPVVKGVAAACIAASALWCAGASLAADQPV
FT                   VGLITKTDTNPFFVKMKQGAEAAAQKDGAKLVTAAGKFDGDNAAQVTAIENMITAGAKA
FT                   ILITPSDTKAIVPSIKKARAAGALVIALDTPTDPQDATDALFATDNFKAGVLIGQYAKA
FT                   ALGGKPAKIATLDLAPGVSVGVLRHNGFLQGMGVKEGDPSIVCSQDTRGDQSKGQTAME
FT                   NCLQKSPDINVVYTINEPAAAGAYRALKSAGKEKSVMIVSIDGGCEGVRNVKAGAIAAT
FT                   SQQYPLKMASLGVEAGVEYAKTGKKATGYHDTGVTLITDKPQNGVDSKDTKFGLDNCWG
FT                   NK"
FT   sig_peptide     535745..535867
FT                   /locus_tag="Bphy_3592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 41"
FT   gene            536894..537883
FT                   /locus_tag="Bphy_3593"
FT   CDS_pept        536894..537883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3593"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0893 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72732"
FT                   /db_xref="GOA:B2JM42"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM42"
FT                   /protein_id="ACC72732.1"
FT                   /translation="MSTPTVPAHSHRRLADHLPTLAEAGPLIALVIACIFFISQSNRFL
FT                   SFQNLSLILQQTMVVAVIAIGQTLIVLTGGIDLSCGMVMALGSIVMTKFAVVMGVPPVI
FT                   AIVCGVGASTLFGLLNGVLITRIKLPAFIVTLGTLNIAFAVTQIYSNAESVSNLPDAIM
FT                   FFGNTFNLGPATVTYGTVLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSAQR
FT                   ILITVYTLSGAIYGIAALLAVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSIAG
FT                   TLLGALIVGVFRNGLTLMGVSSVYQVLITGILVILAVAADKLSRRGAR"
FT   gene            537907..538707
FT                   /locus_tag="Bphy_3594"
FT   CDS_pept        537907..538707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3594"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72733"
FT                   /db_xref="GOA:B2JM43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM43"
FT                   /protein_id="ACC72733.1"
FT                   /translation="MSTSPSSANGKTAVLQARGLIKRYGHVTALDGCDFEVMPGEIMAV
FT                   IGDNGAGKSSLIKALSGALVPDEGELLLDGKPVKFRSPIDARQQGIETVYQDLAVAPAM
FT                   SIAENLFLARELVKPGWRGKIFKMIDKRRMLEEATNAMKDLQIGIRSMRQAVETLSGGQ
FT                   RQGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVF
FT                   EIADRIHIQRLGRRAALVNKSDIHMSDAVAIMTGAKQADVRAIA"
FT   gene            538711..539961
FT                   /locus_tag="Bphy_3595"
FT   CDS_pept        538711..539961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3595"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bxe:Bxe_B0891 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72734"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM44"
FT                   /protein_id="ACC72734.1"
FT                   /translation="MSTTSQKTSMDTGTRSPLKRTVGSNQVGMRQFNERIVLQAIRLHG
FT                   PLPKADVGRLTRLSMQTVSMIVERLIDDGLLEKQARVRGRIGQPSVPIALRAEGAYTIG
FT                   VKVGRRSLDVLAMDFLGRVCCREVQEYAYPDPRTLFASLDSKLARINDALGARREKVVG
FT                   MGVAAPLWLGGWRDFLGAPPEALDAWNDIDIRTRIASMTGLPVEFAKDTTAACAAELVM
FT                   GQGRGIHNFLYLFVGTFIGGGLVIDGRLHGGPHDNAGAVGSIPIMSGNARRPARQLLHA
FT                   ASGFVLEKLLVDAGAPAAAAHDHRALSADLWRLTEQWLDTACPAIAGALTNAAALLDLE
FT                   AVVIDGEVDRQLVREIIRRTERVLDSFEWEGIVRPQLLEGTIGADARAMGGAILPLYAH
FT                   FAPVHELFLKPAEGVMA"
FT   gene            complement(540048..543107)
FT                   /locus_tag="Bphy_3596"
FT   CDS_pept        complement(540048..543107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3596"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; KEGG:
FT                   bxe:Bxe_B0890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72735"
FT                   /db_xref="GOA:B2JM45"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM45"
FT                   /protein_id="ACC72735.1"
FT                   /translation="MNRPLRFPLRAIGTTSVWKWFKWLFFAAFLVAVAFGVRFLQIEMD
FT                   TSRLQARYLSELTRDVGFTVSEGPSDNIRFPTDGPYDIRLGYALLPAFERRLKERGFAV
FT                   ASQARDSERMASLADDGLFIPYDEKDQAGLTLYDATGTRLFGAQYPARVYDDFEAVPPL
FT                   VVSALLFIEDRHLLDSDQPNRNPAIDWGRFSRALMDQGLRVFNHTQPQPGGSTLATQIE
FT                   KFRHSPGGRTATPKEKLRQIASASVRAYLDGPRTMPAREQIVVRYLNSVPLAAQPGIGE
FT                   VNGIGDGLAAWYGRDFAEVNRVLKAPPTPENLPEQGLAFRQVLSLMIAQRGPSHFLLRK
FT                   NDELNALTESYLRIFATNGVITPQLRDAALAQQLVLTRAKVATPEGSFIERKAVTSLRT
FT                   HLLSSLGVSNLYDLDRLDVRVTSTMNNQVQQAISDRLAAATTKDGAQAAGLYGFNMLQP
FT                   KDDPSKIAFSFTLFEKRDGVNLLRVQTDSVNRPFDINSGARLNLGSTAKLRTIITYLQI
FT                   MSELHARYGQMSVDELRAVKPEREDALTRWAVDYFMHTNDRSLPAMLDASVERKYSANA
FT                   GETFFTGGGAQTFTNFEADENSRILTVHQAFQHSVNLVFVRIMRDIVHYETIKTSGPSS
FT                   QWLSDPDTRKMYLTRFADQESRVYMNRFYTKYHGKTQDEMLAVLLRGVRKSPPKVATVL
FT                   RSVRPDAPQAWFNSQMRAALKNTPKANPPDDALAELYAKYAIDKFNLNDRAYISSVHPL
FT                   ELWLVNYLRERPEASANDVMEASREVRADAYKWLFKTRYHATQDRRIRRMVEQHAYDAI
FT                   GKSWQALGYPFAHLTPSYAAAIGASGDRPAALAQLIGVIANKGNQAPTQSLSELEFAKG
FT                   TPYETRFVRATPQPNEAISPEIARVAQAMMRDVVAGGTAKRLAGGMTFPNGTTLEVYGK
FT                   TGTGDQRLNIYAKGRRLIESRKVNRTATFVFAIGDRFFGTLTAVVHEPYAKRYDFTSAL
FT                   AVQLLKSMAAELQPLLDPSTDAGGSTTASR"
FT   sig_peptide     complement(542985..543107)
FT                   /locus_tag="Bphy_3596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.286 at
FT                   residue 41"
FT   gene            543438..544715
FT                   /locus_tag="Bphy_3597"
FT   CDS_pept        543438..544715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3597"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_B0887 putative FAD-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72736"
FT                   /db_xref="GOA:B2JM46"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM46"
FT                   /protein_id="ACC72736.1"
FT                   /translation="MHSYYEATVERPVRPALHGQLSANVCVVGGGLAGLSTALGLAERG
FT                   VREVVVVEAKQVGYGASGRNGGFVFGGYSLDCADLLRILGPARARELYALTIDAVDLMR
FT                   ARIQRYAISCDATDAGVILANWFDDPSRLDSQRRLMKEAFDVEWEPLGAAELSARLKTT
FT                   RYHGGLFERNAFHFHPLKYVLGVARAAEAAGVRIVEQSPVTSLRRHGAGFAVETAHGTI
FT                   DARHVVMAGGGYARNVYRRVERAVLPVATYVMATEPLGAGLADAIACPSAVYDTRFAFD
FT                   YYRPLPDTRILWGGRISIREREPEVIARLLRRDLLKVYPQLRHVRIEHAWGGLMSYARH
FT                   KMPQIGRSGDGVWYAVGFGGHGMAPTTVSGELLAAAIAGERPVPEAFASFGLTHTFGAL
FT                   GLAAAQLSYTAMQTRDALADRPRRPR"
FT   gene            544833..545516
FT                   /locus_tag="Bphy_3598"
FT   CDS_pept        544833..545516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3598"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B0886
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72737"
FT                   /db_xref="GOA:B2JM47"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM47"
FT                   /protein_id="ACC72737.1"
FT                   /translation="MKKASRATVPEHIETLPETSHPRRKYDPEETKRNILEVATQEFSS
FT                   MGLTGARVDAIAERTNTTKRMLYYYFGSKEGLYEAVLEKVYGDIRALEQDLKISDMSPM
FT                   DGLRSLVEFTFDYHDKHRDFVRLVTIENIHGAKYIEQVKTFKNRNATVIHTIEDLLTRG
FT                   VASGDFREDIDAIDLHLLISSLCFHRIANRHTFGTAFGRDPSHARLRARHRAMIVDAIL
FT                   RFVKK"
FT   gene            complement(545768..548602)
FT                   /locus_tag="Bphy_3599"
FT   CDS_pept        complement(545768..548602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3599"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: psb:Psyr_2432 GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72738"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM48"
FT                   /protein_id="ACC72738.1"
FT                   /translation="MWNADLSADGTQAQLIDQAAHAAEAAGAPWAWYRAGQHLELVREG
FT                   AARFDWPRSIVPAMLHDACVEYGWFAWPTGRRDLALGWLLAPASCAGDSAFAAFARVIG
FT                   EQMQADALMRAQNVQRVLYDIAYLASSISERGEFLQAIHERLGTLIDAENFYLALYDRE
FT                   TGAVTYPYYIDLIDTEAVDTNHMDMVDRERLSLTGYVLTTGQPLLIDEKGIIEASARGR
FT                   FHCVGHRPKFWMGAPLKNASDEVFGMVTMQVYDATRIYSAEDRALFLVVARHVAMALDR
FT                   ILHRVGLEAEVARRTAELSRLNDTLRAEIAERERAQHLQAALFEIAELSSQSVEIGKFF
FT                   RSLHEIVGGLLYAKNFYVALFDPATAEVSFPYYIDETQQEVPTSRRRERGLTEYVIRQR
FT                   VPCLFDTSDAVRLVEAGEIKLDSENIRLRSWLGVPLFDGIVVRGVLVVQSYSSSVNYDR
FT                   RDQELLTFVSRHIDTALSRRRVAEAQQAANLELEARVLARTQELDAANARLLHENYHDA
FT                   LTGLPNRSHLYERLAAAWLGYSSRGEPLSVLFIDLDRFKVVNDSLGHLFGDALLVEVAG
FT                   RLRDCLRRDDLLARLGGDEFAVVVPGASLQTVLTLAERILAAFDTPFNIGEQTVFTSCS
FT                   VGVVSADSAHHREPADLLRDADAAMYRVKNRGRDSFAVFNQQMRRELSDQIETEGALRN
FT                   ALKRDGELVPYFQPIVDIASGELVALEALIRWQQPNGEVWAPGRFLPAVEGLKLIGRLD
FT                   MYMLTRVAEILAQREHIDWPPVQVNLSSYSMTRPEFAEELLELLKRYGVHPSRVSLELT
FT                   EGALVAEPDLARNTMQSLADNGMSVVLDDFGTGFSSLSYVHQYRFSGLKIDKSFVLELT
FT                   QSARSRAIVRAIVRMAESLELTVVAEGIEDQATLDLLRTIGAAHGQGYHLARPMSLEAL
FT                   MGSASAPRLRVLAQ"
FT   gene            548860..549402
FT                   /locus_tag="Bphy_3600"
FT   CDS_pept        548860..549402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3600"
FT                   /product="Cupin domain protein"
FT                   /note="PFAM: Cupin domain protein; KEGG: bxe:Bxe_B1308
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72739"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014500"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM49"
FT                   /protein_id="ACC72739.1"
FT                   /translation="MQAHTRGAVRADVFRLGPRDWVPNNARLPVILYRDVLDAHGTGNG
FT                   GKLAETFEAMFTRNGWPPKWRNGIFDYHHFHSSAHEVLGIAAGAADVIVGGPGGRVVHL
FT                   EAGDVLLLPAGTGHCLESSSGPLEVVGAYPPGQQWDIRRDALTEAERAAMEALPFPQSD
FT                   PVRGAQGPLLENWLKTA"
FT   gene            complement(549462..550340)
FT                   /locus_tag="Bphy_3601"
FT   CDS_pept        complement(549462..550340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3601"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0156 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3601"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72740"
FT                   /db_xref="GOA:B2JM50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM50"
FT                   /protein_id="ACC72740.1"
FT                   /translation="MSTPSTLLPPVRAEYERPLEPVGDLAVEAPLPIARRLANQSWLSK
FT                   TIIAIVLIAGWELAARAIDNDLLLPTFGATFAAFVQGIASGELLQKTAASMSVLLRGYL
FT                   LGVALAFLLTSLAVSTRIGRDLLSMLTAMFNPLPSIALLPLALLWFGLGTGSLLFVLVH
FT                   AVLWPLALNMYAGFRAVPATLRMAGRNYGLTGLHHVVLILVPAALPSILAGLRVGWAFA
FT                   WRTLIAAELVFGASSGNGGLGWYIFQNRNELYTDRVFGGLAAVIAIGLLVEHLVFDTLE
FT                   RMTVRRWGLQQ"
FT   gene            complement(550337..551176)
FT                   /locus_tag="Bphy_3602"
FT   CDS_pept        complement(550337..551176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3602"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_C0155 ABC nitrate/sulfonate/bicarbonate
FT                   family transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72741"
FT                   /db_xref="GOA:B2JM51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM51"
FT                   /protein_id="ACC72741.1"
FT                   /translation="MAANPSVLFGDHAATDTAQEAAHSSRLLAVDRVSLEYRTRERVVR
FT                   ATQDVSFDVYGGDRFVLLGPSGCGKSTLLKAVGGFIKPVSGTITLDGETVREPGADRIV
FT                   LFQEFDQLPPWKTVLENIAFPLRVAKKLSRAEAKERAQHYLDKVGLASFAAAYPHTLSG
FT                   GMKQRVAIARALAMQPRVLLMDEPFAALDALTRRKMQEELLRLWEEVRFTLLFVTHSIE
FT                   EALIVGNRILLLSPHPGRVRAELNSHQYTQDSFGRSDFQHRIAQIHRLLFEEMESSR"
FT   gene            complement(551445..552497)
FT                   /locus_tag="Bphy_3603"
FT   CDS_pept        complement(551445..552497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3603"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bxe:Bxe_C0154 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72742"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM52"
FT                   /protein_id="ACC72742.1"
FT                   /translation="MLFSIRPAAVRPSLARRFVSSLLALSLGAAGLGASLDAHAEGHIR
FT                   VAEQFGIVYLLLNVARDQQFIEKEGRKEGLDIKVDWVKLSGGSAVNDALLSGSIDVAGA
FT                   GVGPLLTIWDRTHGRQNVKGVASLGNLPYYLVSNNPNVKTIADFTDKDRIALPAVSVSV
FT                   QSRVLQFASAKRWGDKEYNRLDKITQAVPHPDAAAAIIAGGTEITAHFGNPPFQEQELA
FT                   ANPNAHIVLNSYDVLGGPSSATVLYATEKFRNENPKTYRAFVNGLSDAAQFITANPDAA
FT                   ADIYIRVNQAKTDRDLLLSVIRNPQVQFKVAPQNTLGLAQFMYRVGAIRNEPKSWKDYF
FT                   FEDPATASGS"
FT   sig_peptide     complement(552375..552497)
FT                   /locus_tag="Bphy_3603"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.744 at
FT                   residue 41"
FT   gene            complement(552543..553457)
FT                   /locus_tag="Bphy_3604"
FT   CDS_pept        complement(552543..553457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3604"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: bxe:Bxe_C0153 taurine dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72743"
FT                   /db_xref="GOA:B2JM53"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM53"
FT                   /protein_id="ACC72743.1"
FT                   /translation="MTTTVSPHRHAAPRVQSSGALQTFDIVAFDAPVGAEVLGLDLNEP
FT                   LSADDFARIHRAHLDYHVLVFREQRITPEQHVAFSRRFGPLQIHVLRQFQLPGHPEVLI
FT                   VSNIRENGQPIGLGDAGHFWHSDLSYKEKPSLGSLLHAQELPSEGGDTLFANMHLAWDT
FT                   LPEHLRKAVEGRTAEHTYLAKYAELQKRSPWRPNLSAEQVAEVKPVVHPVVRTHPETGR
FT                   KALFVSEHFTTHIVGLPEDESRDLLGALFVHSVRDEHIYRHQWAEHDLVFWDNRSLMHL
FT                   AAGTPDHLRRKLYRTTIEGDAPF"
FT   gene            553786..554232
FT                   /locus_tag="Bphy_3605"
FT   CDS_pept        553786..554232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72744"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM54"
FT                   /protein_id="ACC72744.1"
FT                   /translation="MTKVFIHSITVLAAVGAGLCSEPAFALELDGQLVCKSDAHTFIQP
FT                   LLDDQYIDPNPMRVEANSVNAFRPKRGRDLTAFGFHVYAVLGYQRDDAIFRQGSGAVEA
FT                   NSIYGVVVSGPSESVRVRVQQAGSEATVKQVLPFVLTAIVCSAG"
FT   sig_peptide     553786..553866
FT                   /locus_tag="Bphy_3605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            554540..555691
FT                   /locus_tag="Bphy_3606"
FT   CDS_pept        554540..555691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3606"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: bxe:Bxe_B1254
FT                   outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72745"
FT                   /db_xref="GOA:B2JM55"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM55"
FT                   /protein_id="ACC72745.1"
FT                   /translation="MKRIPAAVAVLGALVASTAHAQSSVTLYGIIDAGLMYTNNVQKSG
FT                   TRGPLWQATSGTINGSRFGLRGAEDLGGGYKAIFVLENGFNVQNGNLGQHSRLFGRQAY
FT                   VGLASSNYGQITLGRQYDSLVDFVAPLSGTAGTFGDTGFAHPFDNDNLNHSVRMSNAVK
FT                   YTSTNYAGFKFGALYAFSNSTDFAMNRAYSAGASYQWGPLNVAAGYLQINGSNSATNTG
FT                   GAIDTAESSANGVGGFQVGAGVQRVIGAGINYAFGPAVVGFVYTNSHYQQSAAFGMTNG
FT                   SMRFDNYELNAKYAFTPAISFGITDTYTDGHTSGSRTFGTDPKFNQVNAQAVYAFSKRT
FT                   DVYAEAMYQHAIGHGYVAFINTSGGASSTANQVVATIGMRHRF"
FT   sig_peptide     554540..554605
FT                   /locus_tag="Bphy_3606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            555906..556205
FT                   /locus_tag="Bphy_3607"
FT   CDS_pept        555906..556205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3607"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72746"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM56"
FT                   /protein_id="ACC72746.1"
FT                   /translation="MKSTVAAAVATLTAALFAAAPALVHAQEPSMRLTRAQVRQELADL
FT                   ASVGYNAGGGEDPTYPAKAQEAMQRLAAKRAAQSAYGAGTAGSSQAGAGHSAAQ"
FT   sig_peptide     555906..555986
FT                   /locus_tag="Bphy_3607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            556582..556920
FT                   /locus_tag="Bphy_3608"
FT   CDS_pept        556582..556920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3608"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72747"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM57"
FT                   /protein_id="ACC72747.1"
FT                   /translation="MFDAEIAATLLNRWTVKPPSAHGDSYLDLLREGNLNFTHQMGSVT
FT                   PGGVASASLFELESLEFVDGSRALRLKTPGSMSGWTQWAAFEPPARNMANAPAQRSEES
FT                   CTLEAPER"
FT   gene            complement(556940..557758)
FT                   /locus_tag="Bphy_3609"
FT   CDS_pept        complement(556940..557758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3609"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   pla:Plav_0607 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3609"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72748"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM58"
FT                   /protein_id="ACC72748.1"
FT                   /translation="MATPKKTVKATHIRVGIGGWTFEPWRGVFYPEGLAQKRELEYASQ
FT                   QLTTIEINGTFYGSQKPATFAKWHDETPEDFMFALKAPRFATHRRVLSEARDSIDRFVA
FT                   SGVLELKDKLGPINWQFPPTKQFDADDFGSFLELLPAQADGRTLRHAVEVRHKSFCDEA
FT                   FVALARKYNVAIVVAGDSKYPQIADPTAPFVYARIMGTEEAQPLGYAKKALDRWVERAR
FT                   TWASGGTPDDLDSYGRAAPKKARDVFLFVISGHKAHNPAAAMALIERIGA"
FT   gene            complement(557878..558666)
FT                   /locus_tag="Bphy_3610"
FT   CDS_pept        complement(557878..558666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3610"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc3138 probable oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3610"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72749"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM59"
FT                   /protein_id="ACC72749.1"
FT                   /translation="MDLKIKGKLALVTGSTKGIGHAIAVGLAREGVQVIINGRSQQSVD
FT                   HASGTLRAQVPDAIVQGFAGDVSDPAQVARLVEQFPHVDILVNNMGIFDPKPFEEISNE
FT                   EWLRFFNVNVMSGVQLSRAYLPKMKQKNWGRVVFISSESGIQIPTEMIHYGLTKTAQLA
FT                   LSRGLAETCAGTAVTVNSVLPGPTSSDGVEEFVEKLSGGASFESFEKQFFQEARPSSIL
FT                   KRFTTPEEIANMVVYVCSELSSATNGAALRADGGVVRSAF"
FT   gene            558958..560070
FT                   /locus_tag="Bphy_3611"
FT   CDS_pept        558958..560070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3611"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bvi:Bcep1808_5081 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3611"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72750"
FT                   /db_xref="GOA:B2JM60"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM60"
FT                   /protein_id="ACC72750.1"
FT                   /translation="MKASTRLAALLAFACPAAFAQNSVTLYGRIDGGIQYLNHIATPSG
FT                   GSTSSWTAEGGDWGTSMLGFKGSEDLGGGMSSVFDLETAFQVMNGTTGGGRLFSRRAYV
FT                   GLADKRFGQIQAGRNLFIDSDGVWEFDPFVQQAFASASLVRGRNWQQTSNNVEYHSPVF
FT                   YGFDVQGQYAFGNQADGFNHGAPGEFGRSDGIMLTYHSDLFDVRGIYDELRDVNGRMTN
FT                   VFTSSREYFVGANVRVSSVKIQGAYTHLSAPDTPAGQADSADYYWLGATWDATHQLAVT
FT                   AAAFYVHLGEGAGDAAHDPGGHATMFVLGSTYHLSQRTFLYGTVAYLRNSSQSNFSLLA
FT                   NARDASGSANTNPLPGESQTGAYVGVMHVF"
FT   sig_peptide     558958..559020
FT                   /locus_tag="Bphy_3611"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 21"
FT   gene            complement(560368..561396)
FT                   /locus_tag="Bphy_3612"
FT   CDS_pept        complement(560368..561396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3612"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: reu:Reut_B4671 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72751"
FT                   /db_xref="GOA:B2JM61"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM61"
FT                   /protein_id="ACC72751.1"
FT                   /translation="MKICVYGAGAIGAYVGAQLALAGADVSFVARGPHLAAMQKNGVRL
FT                   LIDDTERLVNVRCSSDPRELGPQDYVIIALKAHSVPGVVDAMQPLLGPETAIVTAVNGI
FT                   PYWYFYKHGGEFANSTLESIDPGGTQWKKLGPERAIGCVVYPAAEIVEPGVIKHVYGKK
FT                   FPIGEPDGTRTPRVEALSQMMVAAGLEAPIRDNIRDEIWLKLWGNLCFNPISALTHATL
FT                   DVITSHVGTRAVAKTMMLEAKSVAERFGVHFRVDVERRIDGAGAVGAHKTSMLQDLEAG
FT                   RPMEIDPLLTVVQEMGRLVGHETPTIDTVLALIKLREDVAQHRDVAPAAKTEQAAQSAK
FT                   AA"
FT   sig_peptide     complement(561328..561396)
FT                   /locus_tag="Bphy_3612"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.844 at
FT                   residue 23"
FT   gene            complement(561555..562352)
FT                   /locus_tag="Bphy_3613"
FT   CDS_pept        complement(561555..562352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3613"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   reu:Reut_B4668 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72752"
FT                   /db_xref="GOA:B2JM62"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM62"
FT                   /protein_id="ACC72752.1"
FT                   /translation="MTSWIRFRQPQGHIGFGVLADGNIEEFEGDMFGSATASGKQWKLN
FT                   DVELLSPCLPSKVVALWNNFHALSQRLGKAAPSHPLFLIKPPMSVIGPGEPIRRPKGYS
FT                   GKIAYEGELGIVIGKRCTNVAPEEADGYIFGYTCINDVTAVDLLNEDPNFAQWCRSKGF
FT                   DTFSCIGPAIEQDFDWRNANVITRLDDVERQNYPLADMIFTPAEQVSMISHDMTLMPGD
FT                   VIACGTSVGVGSIKDGSTVIVSIDGIGALPNQLAVARQLEPAA"
FT   gene            complement(562434..563681)
FT                   /locus_tag="Bphy_3614"
FT   CDS_pept        complement(562434..563681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3614"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   bxe:Bxe_B2267 acyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72753"
FT                   /db_xref="GOA:B2JM63"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM63"
FT                   /protein_id="ACC72753.1"
FT                   /translation="MGKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERAGAGDIT
FT                   REQLRDIPDADSLYFTMLNHNKRSVTIDTKNPEGKLVLEALIQKCDVMVENFAPGALDR
FT                   MGFTWERIQELNPKMIVASVKGFGPGPYEDCKVYENVAQCVGGAASTTGFDDGPPVVTG
FT                   AQIGDSGTGLHLALGIVTALYQRTMTGRGQKVLAAMQDGVLNLCRVKLRDQQRLQRTGV
FT                   MKEYPQYPNGTFGEAVPRAGNASGGGQPGWILKCKGWEHDPNAYIYFITQAPVWVKICN
FT                   VIGKEEWATDADYATPNARLPRLKEIFAEIERWTMTKTKFEAMEILNRHDIPCGPILSM
FT                   KEIMDDESLRKTGTIVEVDHPVRGKYLTVGNPIKLSDSPTEVTRSPLLGEHTDEVMAEL
FT                   GYSPAQIEALRTAGAI"
FT   gene            complement(564529..564891)
FT                   /locus_tag="Bphy_3615"
FT   CDS_pept        complement(564529..564891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72754"
FT                   /db_xref="GOA:B2JM64"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM64"
FT                   /protein_id="ACC72754.1"
FT                   /translation="MRRASAPEVPVILLPEGGHVAGRFALRAVVYILFIAFAAIARRIS
FT                   MRVENFGPYQLELSAMQFIHNGGWAAFAEVRKLDDGAEVPIPVLPFQQVADHTVFATEA
FT                   AAIAAARGAVVAMISP"
FT   gene            complement(564869..565300)
FT                   /locus_tag="Bphy_3616"
FT   CDS_pept        complement(564869..565300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3616"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: bxe:Bxe_B2761 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72755"
FT                   /db_xref="GOA:B2JM65"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM65"
FT                   /protein_id="ACC72755.1"
FT                   /translation="MQAAIDYEQLVNAIGDAVVISDKSGAITLWNPAAERMFGFTQEEA
FT                   LGKSLDLIIPERLRGRHWEGYEKTMSTGQTRYGHELLRVPSVHKDGRALSIAFTVALLY
FT                   SPERELTGVVAVIRDETARFQEDRSLRKRIAELEARVGA"
FT   gene            complement(565423..566673)
FT                   /locus_tag="Bphy_3617"
FT   CDS_pept        complement(565423..566673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3617"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   bxe:Bxe_B2760 putative formyl-coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72756"
FT                   /db_xref="GOA:B2JM66"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM66"
FT                   /protein_id="ACC72756.1"
FT                   /translation="MSKPLEGVKIIDFTHVQAGPACTQLLAWFGADVIKVERPGAGDVT
FT                   RNQLRDIPDADALYFTMLNSNKRSLTLDTKTQEGKEVLERLIKESDVLVENFAPGALDR
FT                   MGFTWERINELNPKMIVASVKGFSDGHHYDDLKVYENVAQCAGGAASTTGFWDGPPTVS
FT                   AAALGDSNTGMHLAIGILTALIGRDKTGKGQKVAVSMQDSVINLCRVKLRDQQRLDRVG
FT                   YLEEYPQYPHGEFTDVVPRGGNAGGGGQPGWVLKCKGWETDPNAYIYFTVQGHAWEPIC
FT                   RAIGKPEWIDDPAYMTAQARQPHIFDIFNTIEQWLADKTKFEAVDILRKFDIPCSPVLS
FT                   MKEIANDESLRKSGTIVEVDHKARGKYLTVGSPIKFSDMKPEITGSPLLGEHTEEVLAG
FT                   LGYSFEQIANMREAKVV"
FT   gene            complement(566700..568439)
FT                   /locus_tag="Bphy_3618"
FT   CDS_pept        complement(566700..568439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3618"
FT                   /product="oxalyl-CoA decarboxylase"
FT                   /note="TIGRFAM: oxalyl-CoA decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; thiamine
FT                   pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   bxe:Bxe_B2759 putative oxalyl-CoA decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72757"
FT                   /db_xref="GOA:B2JM67"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM67"
FT                   /protein_id="ACC72757.1"
FT                   /translation="MADVLEIRPQESAEENAQQMTDGFHLVIDALKANDIDTIFGLVGI
FT                   PITDLARLAQAEGMRFIGFRHEQHAGHAAAIAGYMTQKPGICLTVSAPGFLNGLTALAN
FT                   ATTNCFPMILISGSSEREIVDLQQGDYEEMDQLNAAKPYAKAAYRVLHAEDIGIGLARA
FT                   IRAAVSGRPGGVYLDLPAKLLAQTIDAAKAKQSIVRVIDAAPRQLPAPDSVKRAIDLLK
FT                   SAKRPLVLLGKGASYSQADKEIRAFIEKTGIPYLPMSMAKGLLPDTHEQSASAARSFVL
FT                   AESDVVVLIGARLNWLLAHGKGKTWGKPKQFVQIDISAQEMDSNVAIAAPIVGDIGSCV
FT                   ASLLDQVGDDFPQPPKEWLDAVSQKKNTNLEKMAATLAKNPSPMNFHSALRVLRDIVKE
FT                   NPDINVVNEGANTLDYARAIIDMYQPRKRFDSGTWGVMGIGMGFAIGAAVTSGKQVLAI
FT                   EGDSAFGFSGMELETICRYELPVCTIIFNNNGVYRGTDVNPTGGKDVAPTVFVKDARYD
FT                   KMIEAFGGIGYNVTTPEELEKAVKEAIASGKPTLINAVIDEAAGTESGRLTNLNPQSAA
FT                   MKK"
FT   gene            complement(568670..569389)
FT                   /locus_tag="Bphy_3619"
FT   CDS_pept        complement(568670..569389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3619"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B2268 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72758"
FT                   /db_xref="GOA:B2JM68"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM68"
FT                   /protein_id="ACC72758.1"
FT                   /translation="MSTDTQENVRAVPLSLNLTPINATASLRDQAYARLKQAIANTDIY
FT                   HSREEVRLDEKELTEALGVSRTPVREAMTLLEQEGFLRTVPRRGVYILRKTKKEIVEMI
FT                   CMWAALESVAARLATQRASSDDIAKLRAMFDDFHSATPTDHIEEYSEVNIAFHQALVEL
FT                   SGSQIILDTIKNIFMHVRAIRRMTIAQSDRASRSIEDHMRIIEALEARDTEQVETLVRQ
FT                   HSLDLALYVETHCDFLD"
FT   gene            569671..570048
FT                   /locus_tag="Bphy_3620"
FT   CDS_pept        569671..570048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72759"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM69"
FT                   /protein_id="ACC72759.1"
FT                   /translation="MRNAHDQHRNDYDQAVERQLCAFNSAFADLGLRFRWDADTLTSLA
FT                   TIDGEHARVVAYLQAQQAHLLNAYSAEFLSAAILAKKSAHTAAVLPTRVQASDDAARAG
FT                   RPVFSISQYFADDGVPALAGA"
FT   gene            complement(570813..572132)
FT                   /locus_tag="Bphy_3621"
FT   CDS_pept        complement(570813..572132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3621"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2262 putative major facilitator superfamily
FT                   (MFS)oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72760"
FT                   /db_xref="GOA:B2JM70"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM70"
FT                   /protein_id="ACC72760.1"
FT                   /translation="MNGNTRQATGSGLLSNRWCQLVIGMLCMALVANLQYAWTLFVAPM
FT                   NARHHWGEASIQLAFSIFILTETWLVPVEGWLVDRFGPRPVVAGGAICAGLAWMMFAHA
FT                   TTLPELYIGSVIAGIGAGGVYGTCVGNALKWFPDKRGLAAGLTAAGFGAGAAVTVIPIA
FT                   NMITRSGYEHTFLFFGILQGVAIFVLALLLHKPVARATSNVKRKFAVSKVDYTPGQMIK
FT                   TPVFWVIYVSFVAVAAGGLMATAQIGPIAKDWGLAKLPMTMFGMTLPLLTMTLSIDNIC
FT                   NGFTRPLCGFISDKIGRENTMFAIFIGEGLALLGMMQYGQNPYAFMTFAALIFLFWGEI
FT                   FSIFPAICADTFGSKFAASNAGTLYTAKGTAALLVPLASVLSGAGGWSLVFIVSAVITI
FT                   AAGVSAKFVLAPMRARWILGSAASSSSAGSSSRLSASSGE"
FT   gene            complement(572587..573306)
FT                   /locus_tag="Bphy_3622"
FT   CDS_pept        complement(572587..573306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3622"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B2268 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72761"
FT                   /db_xref="GOA:B2JM71"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM71"
FT                   /protein_id="ACC72761.1"
FT                   /translation="MSSELGSQPAATPFTLSLQPIGTSASLRDRAYAMLRQAIADADIY
FT                   ASREEIRLDDRALSESLGVSRTPVREAMTLLEQEGFVRTIPRRGIYIVRKSKREIVEMV
FT                   QMWAALESMAARLATLHATDEEIARLRHMFDQFRDSTPAEHIAEYSDANIAFHQAIVEL
FT                   SKSQIILDTIKNIFIHVRAIRRMTISQSDRASRSIVDHLRIIEALEKRDTELAERLTRQ
FT                   HSLDLAAFIEANCDFLD"
FT   gene            complement(573873..574604)
FT                   /locus_tag="Bphy_3623"
FT   CDS_pept        complement(573873..574604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3623"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4803 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM72"
FT                   /protein_id="ACC72762.1"
FT                   /translation="MIRYSRAFFELQWQFAERVAVISGMPREQALMHYTNFYIRFGLGR
FT                   QFDANHDVWRIYIDGLSNAADPVDWSGRFYLARPDVPPPSLIAAFGCFSYSNAGNDAIR
FT                   LHFANTDSRDCSPLSRERIGERRGELRTLFDHVDYTRQTQPAIKRVLGASWLYNLPAYR
FT                   SLFPSSYIETARELSSRFQNMPLWGQFLDRHGNVRPDMRARFLERLARQTSLHELAQCF
FT                   PWRALAVDASIALFDGFYRAH"
FT   gene            574772..576124
FT                   /locus_tag="Bphy_3624"
FT   CDS_pept        574772..576124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3624"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bbt:BBta_p0030
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72763"
FT                   /db_xref="GOA:B2JM73"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM73"
FT                   /protein_id="ACC72763.1"
FT                   /translation="MAVEPESFRDQFVSLFQSAVDQVVRHTTPSTALVTRPGTDNALVN
FT                   AAAAIGSLTSQTQGQPPLPDAAPGGIAQDAWTCAKMAFALLQARARGDTAGASSIEDDL
FT                   RFNVCDPAWLKVIESYMAFFGPDGKRASIPYRRAAMIGPVTLPLKAGATVALIADWGTG
FT                   TQVAVDLLQQAALQNPDIVIHLGDIYYSGTPEECDANFRNIVDVVLARSTKDVPVYTLA
FT                   GNHDMYSGGAGYYGLIDTLNDHARRQPASFFCLRNDDWQFIAMDTGLHDYIPIVGNDML
FT                   TFLENDEEDWITERIAEFSGKTILLSHHQLFSALSQIGPLQPGNKLIAHNPKLLASFQR
FT                   FAQAARQPVSAWFWGHEHNLSIYQPYLGLTRGRCIGHGAVPVLVDGPENASDPRIVNPP
FT                   ALQSVLLKEANKVYMHGFTIIRLGQGTQHAQASAEYYESSDGTTPMFTEML"
FT   gene            complement(576141..576494)
FT                   /locus_tag="Bphy_3625"
FT   CDS_pept        complement(576141..576494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3625"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   lpp:lpp2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72764"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM74"
FT                   /protein_id="ACC72764.1"
FT                   /translation="MNYVDGFVLAVKAENRDLYRRHATTAAGVFKEYGALKVVECWGDD
FT                   VPEGKLTSFPMAVKREPDEVVVFSWVEWPSRAERDEGMKKVMADPRLQPDVMTMPFDGK
FT                   RLIYGGFEVIVDV"
FT   gene            576995..578464
FT                   /locus_tag="Bphy_3626"
FT   CDS_pept        576995..578464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3626"
FT                   /product="cyclic nucleotide-regulated small
FT                   mechanosensitive ion channel"
FT                   /note="PFAM: cyclic nucleotide-binding; MscS
FT                   Mechanosensitive ion channel; KEGG: bxe:Bxe_B2387 cyclic
FT                   nucleotide-regulated small mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72765"
FT                   /db_xref="GOA:B2JM75"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016846"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM75"
FT                   /protein_id="ACC72765.1"
FT                   /translation="MNNPLIFGFALVAFDVAIWRCAIPKNEVARLLVRLCVYAALSSLL
FT                   FNSGLSPFSKAPYADSKPLHVLGQVLEIIWWLMGARLLSLALDTLLLPKTWRRQRLFQD
FT                   VFGALVFLAAVVAALGFVLELPVRGLVATSGALAIVLGLAIQSTLSDVFAGIVINTTEP
FT                   YHIGNWVAIDGVEGKVLEMNWRATHLLTSQGNIVIVPNAVAAKAKITNSSRPPTLHGIT
FT                   ILLEITPEARPGTVLAALEAALAGVRAVIADPAPYALVKRTSAISVTYEATAYVDDMSK
FT                   KLAVTNELYDLCYRQLEAAGVALRPLGAGYAQPLAAAAPETDPRMHLLRRVEMFAALTQ
FT                   DELKRLAPLLSRRDYERGDTVVTPDKVLDQLTIVDSGVLSVVAEDASGPVEVTRLGPGD
FT                   ALGEAGLLAGMPARVTISALTASTVFQLNKDDLTPLLKDQPDVARLMCQMLSRRRDTLD
FT                   KLGTPTPVAQSEQSVFQWLLDGMRKLHDLTF"
FT   gene            578491..579207
FT                   /locus_tag="Bphy_3627"
FT   CDS_pept        578491..579207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3627"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B1640 ABC lipoprotein exporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72766"
FT                   /db_xref="GOA:B2JM76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM76"
FT                   /protein_id="ACC72766.1"
FT                   /translation="MHVSPTHKPSALECRSLSKTYTATRTVLDRLDVKLAAGEFVAIMG
FT                   DSGVGKSTLLNLIAGLDRADSGDVLIDGTPISTLDDDAATRLRRQKLGFVFQAFHVLPH
FT                   LTLEQNVALPLLLNGLAPQRAHDMLAAVGLAGRNDDLPRQLSGGELQRVAIARALVHRP
FT                   TLILADEPTGNLDPDTAHEVLALLREETKANGAATMMVTHSEAAAAFADRVLILSDGKL
FT                   HAADDPQAHAARPSHE"
FT   gene            579200..581776
FT                   /locus_tag="Bphy_3628"
FT   CDS_pept        579200..581776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3628"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bxe:Bxe_B1641 ABC liporpotein exporter, fused inner
FT                   membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72767"
FT                   /db_xref="GOA:B2JM77"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM77"
FT                   /protein_id="ACC72767.1"
FT                   /translation="MNDAALNATAPARHGLGTLTRWLLSAEWRSHKGRALIAIATIALG
FT                   VALGYAVQLINSAAFNEFSAAARSLSGQADLQVRGTQPTLDERAYPQLATLAGVALASP
FT                   VLELDVTVPDRTAPLKVLGIDVFRSSRIAPDLTGVPASDTTLDALADDAIFLSPAAQQW
FT                   LGVRSGDRLTLRSGTSDVRLRVAGSIVRARPGQRIAVMDIAAAQWRFGRVGKLSRVDLQ
FT                   LERGVDRERFRRDLQDRLGSRFVVGETRDVESRTDRLSRAYRINMNVLALVALFTGAFL
FT                   VFSTQALGVVRRRAQLAMLRVLGITRAQLLRQILLEGALLGTLGSIAGIALGFALAHAV
FT                   LRFFGSDLGGGYFPGVQPAVRFELLASAIFVALGIGVSLLGTLVPALEAARAHPAPALK
FT                   AGGEEAALGKLSTPWPALVCLALGVGLTQVPPVFDVPVAGYLAVALLLIGGIALMPRVT
FT                   SMLFRALSRAGNGRRRAPVTALALARLANAPGQASIAMGGVLSSFTLIVAMAIMVASFR
FT                   VSVEDWLAHLLSADVYVRVAANGDTGGLNLQQQTQLAATRGIRHAAFARTSQLLLDPSR
FT                   PSIALLAREIDAADPGANLQITGTPLPPSAWREGETPVWASEAMVDLYGYRVGQRLTLP
FT                   IGEHSGVRVVVAGIWRDYVRQTGALQIRLADYRRLTSDTSATEAALTLDPGISAAQAIA
FT                   ALRTLPFANALDFAQPGDIRARTLTIFDRSFAVTYLLEAVAIVIGLFGVAATFSAQTLS
FT                   RSREFGMLRHVGVTRGQILALLATEGGMLTALGIAMGCVLGFAISLILVFVVNPQSFHW
FT                   SMSLHVPWLLLSLLALVMLASSCTTAVAAGRQAVSVDAVRAVREDW"
FT   gene            581776..582879
FT                   /locus_tag="Bphy_3629"
FT   CDS_pept        581776..582879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3629"
FT                   /product="putative AttH"
FT                   /note="KEGG: bxe:Bxe_B1642 putative AttH"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72768"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM78"
FT                   /protein_id="ACC72768.1"
FT                   /translation="MPFRLFALAYVFSASLVFAAEPQFAAVSPGKAIELPRDAGAHPAY
FT                   RTEWWYATGWLDTPDHQPLGFQITFFRSATGHPATDPSAFAPTQLIIAHAALSDPKLGR
FT                   LVHDQKIAREGFGLAYAKPGNTDIRLDTWRMIRASDGRYDVYADAAGFALHLTFTPTQA
FT                   PLLQGDNGYSRKGPLAEQASYYYSEPQLRVTGSVTRPAADGVSRAAKPTPVTGSVWLDH
FT                   EWSSTLLAHDAAGWDWLGANLSDGAALMAFKVRGVDGHAVWAHAALRAADGRVTQYGPG
FT                   EVDFTPARQWRSPRTGTQYPVATVVRTGDTRWQLTPLLDDQELDSRESTGALYWEGAVT
FT                   VSRNGQQAGHGYLELTGYGKQLRLDRR"
FT   sig_peptide     581776..581835
FT                   /locus_tag="Bphy_3629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 20"
FT   gene            583037..583348
FT                   /locus_tag="Bphy_3630"
FT   CDS_pept        583037..583348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72769"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM79"
FT                   /protein_id="ACC72769.1"
FT                   /translation="MKSLIKAVAIAAVLAMPAVSFAQANQPVTRAQVRAELVQLEQAGY
FT                   RPGAGTEAHYPDELQAAQARVNAQNGAASGYGGVANGVSQAGRPGVSAADWNAMYGRP"
FT   sig_peptide     583037..583105
FT                   /locus_tag="Bphy_3630"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.735 at
FT                   residue 23"
FT   gene            complement(583371..584699)
FT                   /locus_tag="Bphy_3631"
FT   CDS_pept        complement(583371..584699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3631"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="KEGG: bxe:Bxe_B2746 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72770"
FT                   /db_xref="GOA:B2JM80"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM80"
FT                   /protein_id="ACC72770.1"
FT                   /translation="MRIHSTFIAALVVPLAACGTPSTAPEEASFGPSPTLPAPDTSLIP
FT                   TIHVAPVEARPKGTHPTAPPGFAVTPFAANLEHPRWLYTLPNGDVLVAETNTPEPHDTG
FT                   RGLIGWITKQFQKRAGAGVPSPDRIVLLRDTNGDGIADEQYAFIEDLHSPFGMALIGNH
FT                   LYVADTDALLRFEYDIGETHIPSPGVKVADLPAGPINHHWTKNILASRDGERLYITVGS
FT                   NSNAAENGVEAEADRARILEFDIASGTMRPFATGLRNPNGMAWQPESGVLWTAVNERDE
FT                   LGNNLVPDYMTSVKQGAFYGFPFSYYGAHVDTRVKPQNPEMVARAVVPDYALGNHTASL
FT                   GLAFYDGKLFPNRYRGGAFIGQHGSWNRKPYAGYKVIFVPFKKGEPAGGPEDFLTGFLT
FT                   PDGHALGRPVGVALDARGALLVADDVGNVVWRVAPATETAGAK"
FT   sig_peptide     complement(584628..584699)
FT                   /locus_tag="Bphy_3631"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.536 at
FT                   residue 24"
FT   gene            complement(585019..585983)
FT                   /pseudo
FT                   /locus_tag="Bphy_3632"
FT   gene            complement(585980..586318)
FT                   /locus_tag="Bphy_3633"
FT   CDS_pept        complement(585980..586318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3633"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   hha:Hhal_0617 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72771"
FT                   /db_xref="GOA:B2JM81"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM81"
FT                   /protein_id="ACC72771.1"
FT                   /translation="MEKEVPKMGRHRTPYPAEFRAHMVELVRAGRRPEDLEKEFEPTAQ
FT                   TIYNWVAQADRDAGVRHDGLTTAERQELTKLRRENRQLRMERDILSQAAAWFARETGAV
FT                   PPKGGTDS"
FT   gene            complement(586392..586496)
FT                   /pseudo
FT                   /locus_tag="Bphy_3634"
FT   gene            586555..586752
FT                   /pseudo
FT                   /locus_tag="Bphy_3635"
FT   gene            complement(586822..587892)
FT                   /locus_tag="Bphy_3636"
FT   CDS_pept        complement(586822..587892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3636"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72772"
FT                   /db_xref="InterPro:IPR028950"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM82"
FT                   /protein_id="ACC72772.1"
FT                   /translation="MSAFIYVAGKNDDDARDRAFYLLKKYTSATLLQRAIDLYREFLRD
FT                   FEREIKRPEVEIDYSDDLVRFMRFLQPMEYAEPLLTNPTRRAEAFDMLRDSVKFSSYIW
FT                   GRKYEELGAADPAALFYKLGYREDKTQSVGIFGKASLAGALLSLLFGTLNKKGKLFLSK
FT                   PLATARTSMCWTYESIFFDDLPINRIPAIRFPAHLSPCPPRNEDNTGEVWSGRQIPVTG
FT                   IWEPWAINPKIGVRCPNYYLAGDTASQYQFEGTDTLEDVRWRLIWKDSRYASGQTPYEE
FT                   DEYFAPDPSANLNAPIMRKASPGEVCPESGEWFAPNLNNKTFTMNAGEIMPGPELGSTG
FT                   AVIWYLKPRSDSGSAL"
FT   gene            complement(587904..589451)
FT                   /locus_tag="Bphy_3637"
FT   CDS_pept        complement(587904..589451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3637"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72773"
FT                   /db_xref="GOA:B2JM83"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM83"
FT                   /protein_id="ACC72773.1"
FT                   /translation="MSDITVSNPAESRIGAIETGKRIWANAAAAADWVGGALKGEFGQQ
FT                   QTTGQIVFDATISMFPVLGEGTAARDTIAIMMHMADNRQAVEDRWTWIKLVLCLIAVVP
FT                   IFGGVLKGVGKLVIRAFEKSEDLAKLAEELVLFVNRMCHGNAYEWLRKLDFTTYQGKVI
FT                   DGLTDALDRFSGACQYIVRNMGNVLPSHVVAYLSGMPAKLQPIRNAANRMIPQALRDMN
FT                   NCLARVRAHMVEGTWADISVGSGKITTREAEGQLSTLARDAGKAPHPPASLEDYHHVEG
FT                   WPDLREAPHVAINDETKDATYTVIESFSRLKPIEAVTLGPGQYVLARVLDNTERTTKSG
FT                   YKLKGVVSETTKRSKNWLPRMAKNGREWREKWAVKMDWNHNGAYITLDHIPTIEELRAA
FT                   GVPNIPQDWTGLRIWRGEVSSQFDEDLGRWLEGGETQFIIDFDDAYNKVWEEYVKRLPV
FT                   KPTNWTDVNFAPVDRAAVRPLDKDQTLPKTVPQGYTNRAPAVAGRALPGTDAAQPQH"
FT   gene            complement(589758..590825)
FT                   /locus_tag="Bphy_3638"
FT   CDS_pept        complement(589758..590825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3638"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72774"
FT                   /db_xref="InterPro:IPR028950"
FT                   /db_xref="InterPro:IPR028966"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM84"
FT                   /protein_id="ACC72774.1"
FT                   /translation="MSAFIYVAGKNDDDARDRAFYLLKKYTSATLLQRAIDLYREFLRD
FT                   FEREIKRPEVEIDYSDDLVRFMRFLQPMEYAEPLLTNPTRRAEAFDMLRDSVKFSSYIW
FT                   GRKYEELGADDPNDLFYKIGYRRNPEDSIGVFGKANLSSSLLSVALTTINKASVLYLSD
FT                   KHDARSIKRWTYESIFFDDLPSNAIPPIRFPAQFSKCPPRNEDNTGEVWSGRQIPVTGI
FT                   WEPWAINPKIGVRCPNYYLVGDTASQYQFEGTDTLEDVRWRLIWKDSRYASGQTPYEED
FT                   EYFAPDPSANLNAPIMRKASPGEVCPESGEWFAPNLNNKTFTMNAGEIMPGPELGSTGA
FT                   VIWYLKPRSDSGSAL"
FT   gene            complement(590837..592384)
FT                   /locus_tag="Bphy_3639"
FT   CDS_pept        complement(590837..592384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72775"
FT                   /db_xref="GOA:B2JMI1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI1"
FT                   /protein_id="ACC72775.1"
FT                   /translation="MSDITVSNPAESRIGAIETGKRIWANAAAAADWVGGALKGEFGQQ
FT                   QTTGQIVFDATISMFPVLGEGTAARDTIAIMMHMADNRQAVEDRWTWIKLVLCLIAVVP
FT                   IFGGVLKGVGKLVIRAFEKSEDLAKLAEELVLFVNRMCHGNAYEWLRKLDFTTYQGKVI
FT                   DGLTDALDRFSGACQYIVRNMGNVLPSHVVAYLSGMPAKLQPIRNAANRMIPQALRDMN
FT                   NCLARVRAHMVEGTWADISVGSGKITTREAEGQLSTLARDAGKAPHPPASLEDYHHVEG
FT                   WPDLRENSHVRKDRGSGARTYEVIESFSKLKPIEAVTLGPGQYVLARVLDNTERTTKSG
FT                   YKLKGVVSETTKRSKNWLPRMAKNGREWREKWAVKMDWNHNGAYITLDHIPTIEELRAA
FT                   GVPNIPQDWTGLRIWRGEVSSQFDEDLGRWLEGGETQFIIDFDDAYNKVWEEYVKRLPV
FT                   KPTNWTDVNFAPVDRAAVRPLDKDQTLPKTVPQGYTNRAPAVAGRALPGTDAAQPQH"
FT   gene            complement(592381..595206)
FT                   /locus_tag="Bphy_3640"
FT   CDS_pept        complement(592381..595206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3640"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bam:Bamb_5366
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72776"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI2"
FT                   /protein_id="ACC72776.1"
FT                   /translation="MKDERFPFLYRAPARTLSISGDALPTWTPPRVNIKFEESPKPVLI
FT                   PIYLHGREAIGELFSYTVRMRTDIDIPSFPDNTTIDLDSIVGTQVTIFIDVPGKATPIP
FT                   GMPGDTGRGNIGFYTREITGRVSAARFVRRDGRSMVYEFEVEPALAEAAKGSNYRIFMG
FT                   ETVTDVIGKILGNYPIAIDWRIGGPHYGKRVYPRRDLIRQHWEADMTSVQRLCEHYGLF
FT                   YWFEHENGFHRIVIADTMGAFHPHGEAYEQIRFSTNDRIDEEHVDRLDVTSRQTEGKIT
FT                   VVDHDYTEPRVAPSTVPLREDFRDPRDTARADQEVYTYANVSQPRLEEARFDSTPEDTR
FT                   DDARNVAMVRMQALRCQGLRAKGHGNIRGLTVGRTFHLTDHPYQKSNQEYLVVSATLTI
FT                   EENDQASGTGQAFRCETDFEIQPTREYFRMPHKTPWPSQAGFEYAIVTGPENQEIWTDV
FT                   YGRVKCQLIPDREGKLDQDAFIWVLPMQPWQNGQMGSAFVPRIGSQVLIGYVNGNPDMP
FT                   FIVASSANKRNTPGWKLPFNQWVSGFRSRMEGGHSANHLALVDTKNELQAQLSSDHGTS
FT                   QLSLGFIRRLLGNEGLKDARGEGFDLRTDFWGSVRAAMGIFITTHGRPNAEGKAKDAGE
FT                   TVTRLTQARDMHEGLVGLAQQHGAQIPDADQSDVTRSIKQQTADLRGTAKGGPNDFPEF
FT                   ATPLIALSSPAGIGTSTAGSTHIQSDEDTAITTGRSIGIAAGKSFHASVLERISLFVRK
FT                   AGMMLVAASGKIRIEAQGDDIDVIAKKDVQITSEDGWINLTAMKGIRFNGAGTTVELSA
FT                   AGLLGATNGKFLVHAADHSTDGPRSTPPAFAPKTYTDKSSLSHLYHDGEPVQGAKFDIR
FT                   YDDGKRYSGTLDNAGHADLSSAPVGAGRMKIGPDSRPVQVKANEPNPDYKPKWGESDFR
FT                   ASANKQNNGDA"
FT   gene            complement(595216..595467)
FT                   /locus_tag="Bphy_3641"
FT   CDS_pept        complement(595216..595467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3641"
FT                   /product="GP29"
FT                   /note="KEGG: bam:Bamb_5365 GP29"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72777"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI3"
FT                   /protein_id="ACC72777.1"
FT                   /translation="MKDVQGRDVARFGDSTDHGGKIIQAADNLTHMGIRVALDGHLTEC
FT                   PKCGGTYPIIATGKRTHRGTRVAYLGDKTACGATLVRA"
FT   gene            complement(595804..596127)
FT                   /locus_tag="Bphy_3642"
FT   CDS_pept        complement(595804..596127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0131 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72778"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI4"
FT                   /protein_id="ACC72778.1"
FT                   /translation="MSVPAVITTVIDVDPDRPRRRISNGALLVHIRAVHTESKGEYGWP
FT                   RVWKKLLAQRIRVSKDRIQRLMKLHGIKARMRLAAQLFGRQREAGEDEEEWRMLALTKP
FT                   VRH"
FT   gene            complement(596252..596479)
FT                   /locus_tag="Bphy_3643"
FT   CDS_pept        complement(596252..596479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3643"
FT                   /product="transposase"
FT                   /note="KEGG: bxe:Bxe_B0132 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72779"
FT                   /db_xref="GOA:B2JMI5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI5"
FT                   /protein_id="ACC72779.1"
FT                   /translation="MGNPRARYTLEFKIEAVRMVRNGQSQAATAKILGISTQTLNAWIK
FT                   ADDAGKLNGTGKQVSAEQMELPGCAPSWPA"
FT   gene            complement(596886..597587)
FT                   /pseudo
FT                   /locus_tag="Bphy_3644"
FT   gene            complement(598003..599358)
FT                   /locus_tag="Bphy_3645"
FT   CDS_pept        complement(598003..599358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3645"
FT                   /product="putative TRAP-type uncharacterized transport
FT                   system, periplasmic component protein"
FT                   /note="KEGG: bxe:Bxe_A2081 putative TRAP-type
FT                   uncharacterized transport system, periplasmic component
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72780"
FT                   /db_xref="GOA:B2JMI6"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI6"
FT                   /protein_id="ACC72780.1"
FT                   /translation="MKGLRPHSPHFLRDHTHPVWRDLALTSLPFVALFAVLVWLVVWLV
FT                   DPAPPHTITISAGPQDSSFMQIAEEYRKVLGRNGVTLKVLVSDGSVQNLDRLLDPKQKV
FT                   DVALVQGGVTGGRDTSSLMSLGSVTYVPLVVFYRGSGMTQLSDLDGKRIAIGREGSGTR
FT                   MLSLKLLEANGIGPGGNTQLLPLDGLDAAKALVSNQVDAALLSGDSATRVLMLRLLGIP
FT                   GVSVMNFDEATAYTRVFPYLDELDLPPGALDLRRRIPPETIHLISPTAELVARTSLHPA
FT                   ISDLLIEAAQEVHGMAGLLQKAGQFPNPVVREFRISEDAMRYYKSGKSFLYRTLPFWLA
FT                   TVVDRLLVLLLPIAVLLFPALRLIPALFTWRVRSRIYRYYGSLIAIERDAMRDSSAEER
FT                   SKLLAELDRIEASLDTLRMPLAYADGFYVLREHVRFVRQRLEGARERAHASG"
FT   gene            599527..599603
FT                   /locus_tag="Bphy_R0076"
FT                   /note="tRNA-Val1"
FT   tRNA            599527..599603
FT                   /locus_tag="Bphy_R0076"
FT                   /product="tRNA-Val"
FT   gene            complement(599801..600142)
FT                   /locus_tag="Bphy_3646"
FT   CDS_pept        complement(599801..600142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3646"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: bte:BTH_I1785
FT                   ubiquinol oxidase, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72781"
FT                   /db_xref="GOA:B2JMI7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI7"
FT                   /protein_id="ACC72781.1"
FT                   /translation="MAHSNSHALDAEAGHGGIGGYVVGFVLAVVLTAAAFGIVMQGWLP
FT                   AAYAPLVLAALAVVQIVVHLVCFLHMSVSTSGQRWNTLALAYTVLAAMFLVFGTVWVMH
FT                   NVSMNMMSR"
FT   gene            complement(600142..600756)
FT                   /locus_tag="Bphy_3647"
FT   CDS_pept        complement(600142..600756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3647"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   bps:BPSL2380 cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3647"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72782"
FT                   /db_xref="GOA:B2JMI8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI8"
FT                   /protein_id="ACC72782.1"
FT                   /translation="MLQKVHAATLNEIDGHGHHGESQSVFGFWLYLMTDCVLFASLFAV
FT                   FAVMAHQFNAGPTGKDLFDIPGVAVETAALLLSSITYGFAMVAARRQNPRAVLGWLAVT
FT                   FVLGAVFLKLELNEFSHLVAEGAGPSRSAFLSSFFVLVGTHGLHVATGLIWMAVLAVQV
FT                   ARAPQLTQREITRLTCLSLFWHFLDVVWICVFTFVYLGSMY"
FT   gene            complement(600756..602768)
FT                   /locus_tag="Bphy_3648"
FT   CDS_pept        complement(600756..602768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3648"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: bmn:BMA10247_A0226 ubiquinol oxidase, subunit
FT                   I; TIGRFAM: cytochrome o ubiquinol oxidase, subunit I;
FT                   PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3648"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72783"
FT                   /db_xref="GOA:B2JMI9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMI9"
FT                   /protein_id="ACC72783.1"
FT                   /translation="MFGNLTLEAIPFDQPIIMGAGALMGLIVLAVAVLLTRTHKWRWLW
FT                   AEWLTSVDHKRIGVMYIVVAVLMLLRGFADAVMMRLQLALASGGATGYLPPHHYDQIFT
FT                   AHGVIMIFFMAMALMVGLFNIVVPLQIGARDVAFPFLNSLSFWMTAISAILMNISLVIG
FT                   EFAQVGWLAYPPLSELQFSPGVGVDYYIWALELSGVGTLITAINFFVTIIKMRAPGMSL
FT                   MKMPVFTWTALCSNVLIMATFPILTIALALLGLDRYADMHFFTNDAGGNAMLYLNLIWA
FT                   WGHPEVYILVLPAFGIYSEVISTFAKKPLFGYKTMVYASCAIMVLAFLVWAHHFFTMGS
FT                   GADVNAFFGIATMIIAIPTGVKIFNWLFTMYRGRLEFTAPVLWTIGFMVTFTIGGMTGV
FT                   MLAIPGADFVLHNSLFLVAHFHNTIIGGVVFGYLAGVSYWFPKVFGFKLNDRLGKAAFW
FT                   FWFVGFFVAFTPLYVLGFMGATRRLNHYDNPAWQPLMIIAACGAALIAIGVVCQVTQFV
FT                   VSIINRNKPEYRDVTGDPWGGRTLEWSISSPPPVYNFATIPVVEELDAFAHMKETGKGL
FT                   GIQAAYRDIHMPSNTSAGFFIGVFSLAFGFAAVWHIWWLAIVALAAIAATVIGRSFGRD
FT                   DGYYIPSDVVRTIENKGRTPLPQRADVAPALAEVE"
FT   gene            complement(602772..603671)
FT                   /locus_tag="Bphy_3649"
FT   CDS_pept        complement(602772..603671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3649"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: bvi:Bcep1808_2823 ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3649"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72784"
FT                   /db_xref="GOA:B2JMJ0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ0"
FT                   /protein_id="ACC72784.1"
FT                   /translation="MLARKTLRGCLVPVSAGLTACLAGCQLEVLDPKGSVGVAEKSLIA
FT                   TATWTMLIVVIPVILLTLLFAWRYRASNKSAVYAPKWAHSTAIELIVWTIPALIILFLG
FT                   ILTWRTTHELDPYKPLESSVKPIDVEVVALDWKWLFIYPDLGIASVNQLAMPVGTPVNF
FT                   HITSDSVMNSFFIPQLGTQVYAMAGMQTRVHLVADEPGDYAGVSANFSGKGFSDMKFRT
FT                   LAVSQADFNSWVQKVKASAERLDMDGYYAVAKPSEKNPVRYFSSVDPKLFHNVIAKYNS
FT                   GHVVDFRDANCATNASKE"
FT   sig_peptide     complement(603600..603671)
FT                   /locus_tag="Bphy_3649"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.238 at
FT                   residue 24"
FT   gene            complement(603989..604192)
FT                   /locus_tag="Bphy_3650"
FT   CDS_pept        complement(603989..604192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_2658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72785"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ1"
FT                   /protein_id="ACC72785.1"
FT                   /translation="MGILDTLGEIAGAAAAVEALEKADPNASLLTKGVAAVAGFKGAGA
FT                   LEELVGQKTEDDSADNAESGQT"
FT   gene            complement(604202..604609)
FT                   /locus_tag="Bphy_3651"
FT   CDS_pept        complement(604202..604609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3651"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3651"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72786"
FT                   /db_xref="InterPro:IPR022016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ2"
FT                   /protein_id="ACC72786.1"
FT                   /translation="MSIFGTIVSKIFGKAKPAETLPADPVAPAPVDAPAGAPLTPVTPV
FT                   STALTDVDVAAVMDQLAASSPLQLDWRRSIVDLMKLLDVDSSLEHRKQLASELKYGGDT
FT                   NDSASMNIWLHKQLMTALAANGGKLPADLTS"
FT   gene            604908..605408
FT                   /locus_tag="Bphy_3652"
FT   CDS_pept        604908..605408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3652"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: aav:Aave_4592
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72787"
FT                   /db_xref="GOA:B2JMJ3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ3"
FT                   /protein_id="ACC72787.1"
FT                   /translation="MKKLLTLAACAVSLSMLAACGGLDRSKEETLNKQAGIEVTQTKEG
FT                   VQVRLPEKVLFNFNESSLRPDAATALSRVVVVLNRTHKPMIIEGHTDNVGTREYNQQLS
FT                   EARAKSVADELERRGISASRITLKGYAFDRPVADNNTPEGRARNRRTEIVVMGESLEAV
FT                   MGK"
FT   sig_peptide     604908..604973
FT                   /locus_tag="Bphy_3652"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.662 at
FT                   residue 22"
FT   gene            605582..606109
FT                   /locus_tag="Bphy_3653"
FT   CDS_pept        605582..606109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3653"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: bxe:Bxe_A4315 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3653"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72788"
FT                   /db_xref="GOA:B2JMJ4"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ4"
FT                   /protein_id="ACC72788.1"
FT                   /translation="MSSLRIVGLLAIFGLCTGCAQIHQELQASNPTNTVAMPSKLAVTD
FT                   GVSDETPLTSGHIAVQPKSGALQTGYASWYARKFQGRRTASGERYDNRLLTAAHRTLPL
FT                   GSYVRVTSLATEKSVVVRVNDRGPFIKGRIIDLSLAAASELGLTRSPSMQVELQRVEKA
FT                   ANSRALSDGSES"
FT   sig_peptide     605582..605656
FT                   /locus_tag="Bphy_3653"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.600 at
FT                   residue 25"
FT   gene            complement(606479..607678)
FT                   /locus_tag="Bphy_3654"
FT   CDS_pept        complement(606479..607678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3654"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A0821 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3654"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72789"
FT                   /db_xref="GOA:B2JMJ5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ5"
FT                   /protein_id="ACC72789.1"
FT                   /translation="MNNLAKLTLVGISLTSLTLMGCGRKEQPSQHATQDEAGSAEEVVK
FT                   IGHVGPLTGGSSHLGKDNENGARLAVEDINKTGLVIGGRKVRLELDGEDDAADPKTGTQ
FT                   IAQKFVDEHVVAVIGHLNSGVSIPASRIYNEANIAEISPSSTNPDYTKQGYRSAYRVVA
FT                   TDAQQGPALGGYALRSLGAKTIAVVDDATAYGKGLADEFAKAAQAGGARIVAREATTDK
FT                   ATDFRAILTAIKSAHPDVIMFGGMDSTVGPFIRQAAALGLNTRVLSGDGACTEKVAELA
FT                   GDSVNILVCSEASLAVSRMPKGAEFQKRFEARFNGPILFNAPFAYDAVYVIADAMRRAN
FT                   TTDAAKVLAALPATDYNGVIGHIAFDAHGDMKAGAITLYHYQDKKKTLLDVVKYGNAST
FT                   "
FT   sig_peptide     complement(607613..607678)
FT                   /locus_tag="Bphy_3654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.747 at
FT                   residue 22"
FT   gene            607950..608240
FT                   /locus_tag="Bphy_3655"
FT   CDS_pept        607950..608240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3655"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: bxe:Bxe_A2831 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72790"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ6"
FT                   /protein_id="ACC72790.1"
FT                   /translation="MKKSSVALLVSLLALAGAASAQTDNNGILMTHDRDVASKIEQHAR
FT                   DVQAQPAVQNDMDAPAQHVEQKPAHQHHHGHGQGHHHTVKTRAAHSHVEAE"
FT   sig_peptide     607950..608015
FT                   /locus_tag="Bphy_3655"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            complement(608315..609907)
FT                   /locus_tag="Bphy_3656"
FT   CDS_pept        complement(608315..609907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3656"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="TIGRFAM: alkyl hydroperoxide reductase, F subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B1206 AhpF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72791"
FT                   /db_xref="GOA:B2JMJ7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ7"
FT                   /protein_id="ACC72791.1"
FT                   /translation="MLDANLKTQLKAYLEKVSRPIEIVASLDDGTKSQELLALLNDIAS
FT                   LSERVNVIERRGDDERKPSFSIGEPGKTTGIRFAGIPMGHEFTSLVLALLQTGGHPIKL
FT                   DDAVIQQIRELDGDFAFETYFSLSCQNCPEVVQALNIMALINPRIRHTAIDGALFQNEV
FT                   ESRQIMAVPTMFLNGEVFGQGRSGVKEILAKLDSNAGARAAKELEKKPVFDMLIVGGGP
FT                   AGAAAAIYSARKGIATGVVAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYE
FT                   VDVMDVQRAEALIPGKINEVRLAGGAVLKAKTIVLATGARWREINVPGEREYRNHGVAY
FT                   CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGVVNHVTLIEFGATLRADEVLQRKLRSL
FT                   PNVVVITQAQTTEITGDGKKVNGLTYTDRVSGESKHVELEGVFVQIGLVPNTEWLKGTV
FT                   ELSKHGEIVVDAKGATSVPGVFAAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRTSVE
FT                   DAEDAQAAAMAEV"
FT   gene            complement(610100..610663)
FT                   /locus_tag="Bphy_3657"
FT   CDS_pept        complement(610100..610663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3657"
FT                   /product="peroxiredoxin"
FT                   /note="TIGRFAM: peroxiredoxin; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Redoxin domain protein; KEGG: bte:BTH_II1926 alkyl
FT                   hydroperoxide reductase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3657"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72792"
FT                   /db_xref="GOA:B2JMJ8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ8"
FT                   /protein_id="ACC72792.1"
FT                   /translation="MPIINSQVKPFKATAFHNGDFVTVTDETLKGKWSVVVFYPADFTF
FT                   VCPTELGDLADRYEEFKKLGVEIYSVSTDTHFTHKAWHDTSDTIQKIKYPMVADPTLAI
FT                   SRNFDVLIEEEGLALRGTFVINPEGEIKLCEIHDNGIGRDAGELLRKVQAAQYIAAHPG
FT                   EVCPAKWTPGAETLSPSLDLIGKI"
FT   gene            610907..613285
FT                   /locus_tag="Bphy_3658"
FT   CDS_pept        610907..613285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3658"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bxe:Bxe_B0929 DNA polymerase II; PFAM: DNA
FT                   polymerase B exonuclease; DNA polymerase B region; SMART:
FT                   DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3658"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72793"
FT                   /db_xref="GOA:B2JMJ9"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMJ9"
FT                   /protein_id="ACC72793.1"
FT                   /translation="MNELEQGFLLTRHWRDTGTETEVEFWLATDDGPRHIRLRPQPNVA
FT                   FVPAAQRPRADEVLRQEKSTRGVELRPLDLRDFQHRPVLGLYCPQYRQLIGLEKRLKQG
FT                   GVDVYEADVFPPDRYMMERFITAPVLFRGEANPIGGPLLNGDMKPATGYRPKLRLVSLD
FT                   IETSAQAELYSIALEGCGQRQVYMLGPENGDASGLDFALEYCETRAQLIERLVEWLERH
FT                   DPDAIIGWNVVQFDLKVLHETAQRYGVPLRIGRGGAVLEWREHGLKQNHFFAGAAGRLI
FT                   IDGIEALRSATWSFPSFSLEYVAQSVLGEGKSIDNPYQRMEEIQRRFDEDKPALARYNL
FT                   KDCELVTRVFAKTDLLSFLLERATVTGLPADRSGGSVAAFTHLYMPRMHRLGFVAPNLG
FT                   DVAGAASPGGFVMDSKPGLYDSVLVLDYKSLYPSIIRSFLIDPVGLIDGLRHPDDADSV
FT                   PGFLGARFSRAQHCLPSIVAQVWEGREAAKREQNKPLSQALKIIMNAFYGVLGSTGCRF
FT                   FDPRLASSITMRGHEIMHRTRELIEASGYTVIYGDTDSTFVWLKHAHDEQDAVRIGREL
FT                   VGAINAWWREHLRERFDLESALELQFERHYRRFFMPTVRGAEEGSKKRYAGLTVMADGS
FT                   EEVVYKGLETVRTDWTPLAQRFQQELYLRIFKQQPYRDYVRDYVRRTLAGEFDDLLVYR
FT                   KRLRRPLSDYERNVPPHVRAARSADEFNRQRGRPLQYQNGGWISYVMTGSGPEPLETLR
FT                   SPIDHEHYLTKQLQPVADAILPLLKDDFVTLAAGQAQLF"
FT   gene            complement(613341..614366)
FT                   /locus_tag="Bphy_3659"
FT   CDS_pept        complement(613341..614366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3659"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bxe:Bxe_B0630 putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72794"
FT                   /db_xref="GOA:B2JMK0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK0"
FT                   /protein_id="ACC72794.1"
FT                   /translation="MGSRPRFIDDLSGARPAAASPGSPGDDALLDAYSRTVIDALERVR
FT                   AAVVFITVERRVPGARERHAPAGTGSGFLFTPDGYLLTNSHVVHGATHIGVQLADGTKF
FT                   DADLVGDDPHSDLAVLRIGSREPLPHVALGESGKLRVGQIAIAVGNPLGLEQTVTAGVV
FT                   SALGRSLRSNSGRMIYDVIQTDAALNPGNSGGPLINSAGQVIGVNTAIIPGAQSISFAT
FT                   AIDTAKWVIMQIFAHGRVRRAYIGVAGTTTALPRRVQRYFELDSVSGVRVIEIVKGSPA
FT                   AVGGLRVDDTIVAVDGEVVEGVDALQRALDGSKIEREVVVSVLRGAKRVELVVLPAEQV
FT                   V"
FT   gene            complement(614498..614689)
FT                   /locus_tag="Bphy_3660"
FT   CDS_pept        complement(614498..614689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3660"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72795"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK1"
FT                   /protein_id="ACC72795.1"
FT                   /translation="MDYRVTYEHSLATAPDDYIVNVPSQLVSDVPPNIPKALLPEVIEK
FT                   LILERSPRIGRIRNLRLI"
FT   gene            complement(614916..615107)
FT                   /locus_tag="Bphy_3661"
FT   CDS_pept        complement(614916..615107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3661"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3661"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72796"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK2"
FT                   /protein_id="ACC72796.1"
FT                   /translation="MKKLLTLAAVALVTIGLAGCVVAPPYGYGYAPAYGYAPGYYAGPS
FT                   VSVGVGYSCCWGHGGWHR"
FT   sig_peptide     complement(615039..615107)
FT                   /locus_tag="Bphy_3661"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.404 at
FT                   residue 23"
FT   gene            615445..615729
FT                   /locus_tag="Bphy_3662"
FT   CDS_pept        615445..615729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3662"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72797"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK3"
FT                   /protein_id="ACC72797.1"
FT                   /translation="MSSRHDRSDPSEPNACDAQDWSSPRAYPEADLMRGLQLASDTVLR
FT                   LATQTHAAVARGDPASAEAARESLEKQLALTTRLIDELLFDGEVRHTTH"
FT   gene            complement(615792..616118)
FT                   /locus_tag="Bphy_3663"
FT   CDS_pept        complement(615792..616118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3663"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72798"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK4"
FT                   /protein_id="ACC72798.1"
FT                   /translation="MRRRADAQRGAVARGMARTRDRELMKEPDSRRARRLEGEGARPLP
FT                   DRARSSDRWRDYSAIEKREGRACFAFDGRSTRGLAPRMNSTAQSATIAQTERSIVKTFI
FT                   SNSS"
FT   gene            complement(616102..617664)
FT                   /locus_tag="Bphy_3664"
FT   CDS_pept        complement(616102..617664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3664"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: bxe:Bxe_A3224 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3664"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72799"
FT                   /db_xref="GOA:B2JMK5"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK5"
FT                   /protein_id="ACC72799.1"
FT                   /translation="MHTPPVSRLSNLRSDVFAGIVVFLVALPLCLGIATASGVEPFAGL
FT                   VSGIVGGLVVALLSGSHLSVSGPAAGLVVIVVSAIASLGSFSAFLAAVLIAGALQVGFG
FT                   LLRAGRLASFVPVAVIKGMLASIGIILIVKQIPLGVGLASGTDADMAHAGTLATPFGHV
FT                   SIVSVVLVVVSVAMLFAWETPRAKRYALVRMLPGPLAAVALGIGATLALGLLAPALALP
FT                   AEHRVSLVSLDSFAALTGAISMPDFTQLVDADVWRVALTLAVVASLETLLSLEAVEQID
FT                   PQRRRASPDRELKAQGVGNMVAAVLGGLPLTAVIVRSSANVHAGAQTRMSAVIHGVLLL
FT                   ASVFALTAVLNLIPLACLAAILIHTGYKLAKPALFAAMAREGVDRFVPFVTTIVGVLAT
FT                   DLLIGIGIGIATSALLAMRVNLSRTFTLTRHDDHYLLVLRKDATFLSKPMLTHCLGQIP
FT                   DSATVLIDAERADFIDRDIRDALDAFVGEAARRQITVERLRWPEPAAQEGRALLPSLRA
FT                   TTG"
FT   sig_peptide     complement(617554..617664)
FT                   /locus_tag="Bphy_3664"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.410 at
FT                   residue 37"
FT   gene            complement(617758..618411)
FT                   /locus_tag="Bphy_3665"
FT   CDS_pept        complement(617758..618411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3665"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: bvi:Bcep1808_2342
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3665"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72800"
FT                   /db_xref="GOA:B2JMK6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK6"
FT                   /protein_id="ACC72800.1"
FT                   /translation="MNHPKRLLLSNLAWSQEVAAREPEFFTDLARGQQPRILWIGCSDS
FT                   RVPAERITNAQPGELFVHRNIANLYTSDDGNASSVIEYAVHALKVEHVVICGHHHCGGV
FT                   RAALSPPSDALPVVNRRIAGLRDLAERHREELLAIADFDARVDCLAELNVIEQVRLLRE
FT                   SPIVRRAPRPPQVHGWIFGLREGLLTQLTDMDQAREIADSHADSHASIAVRDAA"
FT   gene            complement(618814..619191)
FT                   /locus_tag="Bphy_3666"
FT   CDS_pept        complement(618814..619191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3666"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   bxe:Bxe_A1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3666"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72801"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK7"
FT                   /protein_id="ACC72801.1"
FT                   /translation="MHKTVKIPGPDHPITIAKSGSRVVVSVAGRTIADSTDALSFHEAS
FT                   YPEVLYIPRKDVNMALLERTDHATYCPYKGECSYYSIPAGGERSVNAVWSYESPYDAVA
FT                   SIKEHVAFYRDRVDAIEVSAQ"
FT   gene            619707..620282
FT                   /locus_tag="Bphy_3667"
FT   CDS_pept        619707..620282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3667"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72802"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK8"
FT                   /protein_id="ACC72802.1"
FT                   /translation="MSRIGTATGTAAEPRPRAHANRRASGEPEVRRKETLYADVRSDHA
FT                   GGVAVAPPALHDPWTTTISRLGKAPAQDIKLGPSDKCDKGACAARAARRTATAERAQAA
FT                   SEYSGAVITFVERFGAKSISITWRDSTAGRYTEQLWVRRIARSRGVCALTGAEIVRGDA
FT                   VYGPFSRPTSRPRNMSQMILAELLDDLE"
FT   gene            620334..620717
FT                   /locus_tag="Bphy_3668"
FT   CDS_pept        620334..620717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3668"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bxe:Bxe_B0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3668"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72803"
FT                   /db_xref="GOA:B2JMK9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMK9"
FT                   /protein_id="ACC72803.1"
FT                   /translation="MEDCANTMVVRYKKDGCEHLAAIVTLGSLRLDVNGAVKGVLGAKR
FT                   ISFARREIATEQSAMEFGGITAFGLPPSWRVLVDAAVMERRQVVMGAGIREAKLLLAPS
FT                   VLPQLGNVEVAQLTLPVGEPDGA"
FT   gene            complement(620735..621334)
FT                   /locus_tag="Bphy_3669"
FT   CDS_pept        complement(620735..621334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3669"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric
FT                   oxide synthase; KEGG: azc:AZC_4089 flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72804"
FT                   /db_xref="GOA:B2JML0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JML0"
FT                   /protein_id="ACC72804.1"
FT                   /translation="MARVLVLYYSSYGHIEKMAEAIAEGARGAGAQVDIKRVPETVPEE
FT                   IAKKANFKLDQQAPIATVADLEQYDAIVVGTGTRYGRISSQMAAFLDQTGGLWMRGALN
FT                   GKVGAAFASTATQHGGQETTLFSIITNLMHLGMIIVGLPYSHQGMMNMTEIVGGAPYGA
FT                   TTIAAGDGSRQPSAIDLEGARHQGELVAKTAAKLFG"
FT   gene            621614..622189
FT                   /locus_tag="Bphy_3670"
FT   CDS_pept        621614..622189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3670"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3670"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72805"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML1"
FT                   /protein_id="ACC72805.1"
FT                   /translation="MIRLPSAFIVCASTASLLVLASTANAQTTQPAQQASATKPAEAVR
FT                   LHAADQTFINEGTRAVATQRDAARIATSRSTDREVKAFAEKVAADNLQIADSLRAASPR
FT                   GVDVPHNNPDTAVLDSIKTMRGAEFDKTYIEQIALADGQKTLSAFQAEIASGRNEQLKD
FT                   AARKALPVIQAQYASAQDLAKRKHLAAK"
FT   sig_peptide     621614..621694
FT                   /locus_tag="Bphy_3670"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            622619..623083
FT                   /locus_tag="Bphy_3671"
FT   CDS_pept        622619..623083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3671"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72806"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML2"
FT                   /protein_id="ACC72806.1"
FT                   /translation="MPNVCGLHIKFAVLVPTNRYSVNDFWERFVKQLAICMVLAVMTGC
FT                   AQLPANTASQADKAPVSNDVISFTIPPDALGARDPQLSAVLAKAGALAAAQKQPTTILV
FT                   TALGQDLPYLNQAIWRGVPSQHPAKLSLENLTAGANQPYSVSIRPTGGTP"
FT   gene            623080..623463
FT                   /locus_tag="Bphy_3672"
FT   CDS_pept        623080..623463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3672"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2895 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3672"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72807"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML3"
FT                   /protein_id="ACC72807.1"
FT                   /translation="MRGSHVMFRTAILAASLALAAFMSQAALAGQPATAGALSSSGSSA
FT                   APAPSAAADKVYPPLPTLAMLPPSAGDDDEPPLAPKPAAKKRKVRASVDVRPTAPAARL
FT                   VVSDTTRTYLRSVEKQLDLALAK"
FT   sig_peptide     623080..623169
FT                   /locus_tag="Bphy_3672"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 30"
FT   gene            623497..623991
FT                   /locus_tag="Bphy_3673"
FT   CDS_pept        623497..623991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3673"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   rso:RSc2896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72808"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML4"
FT                   /protein_id="ACC72808.1"
FT                   /translation="MSLDRLLAGPRSRRCVAHTLGALTLSLAALTSATARADDCFEQAA
FT                   VYQGVNPLILRAVAWHESKGDPAAVNRNSNGSVDVGQAQINSVHFSDLKRLGIPHRALT
FT                   DACVNIYVAAWLIKQKMVKYGNTWRAIGAYHSESPKERDAYARSIQKILVAWGELLPAA
FT                   R"
FT   sig_peptide     623497..623610
FT                   /locus_tag="Bphy_3673"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.954 at
FT                   residue 38"
FT   gene            complement(624025..624429)
FT                   /locus_tag="Bphy_3674"
FT   CDS_pept        complement(624025..624429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3674"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72809"
FT                   /db_xref="GOA:B2JML5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML5"
FT                   /protein_id="ACC72809.1"
FT                   /translation="MPPRNEALPTVMRRLAAGKMLMEGASVSDVAAQLHISENTVRKYR
FT                   ALMNEGGLESLRQMSVGGRSSVLDEAAMEWIAAALRGPASIHGFPSDAWTSNRLRELIR
FT                   SRFGVSYSRVYTWQIATNLGLGHRLTKSRK"
FT   gene            625063..625455
FT                   /locus_tag="Bphy_3675"
FT   CDS_pept        625063..625455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72810"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML6"
FT                   /protein_id="ACC72810.1"
FT                   /translation="MEVERVERIVVALRRAAEHERLVSYQRFHAMFGASDPLTARYDAL
FT                   ERAIASLGEVSNIDYGVLLALSNGLPGPDFFRRYQKHRYADYVAVMGPPIHRQSIKRKR
FT                   LLVEAERRRVYEDARRKASCHAAETA"
FT   gene            625546..626148
FT                   /locus_tag="Bphy_3676"
FT   CDS_pept        625546..626148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3676"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72811"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML7"
FT                   /protein_id="ACC72811.1"
FT                   /translation="MQRAARRSIRILTIAVSCAALAAPVLDASAQDNPVSSPDAVGTAA
FT                   VAEVTAHITHIDADNNEVTIRGPRGNSMIVDVDPDVGDVKKLKVGDEVHISYKGALLLS
FT                   ADKVDAKGVRSRVESQSTTPAQGGASTQVRHVEVVATVQKIDRKKREVTLRGPKHTVVL
FT                   EVAPDVPLEKIKVGDSIRADYASATAVHITRNGAPLQ"
FT   sig_peptide     625546..625638
FT                   /locus_tag="Bphy_3676"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.788 at
FT                   residue 31"
FT   gene            626199..626462
FT                   /locus_tag="Bphy_3677"
FT   CDS_pept        626199..626462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3677"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3677"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72812"
FT                   /db_xref="GOA:B2JML8"
FT                   /db_xref="InterPro:IPR021347"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML8"
FT                   /protein_id="ACC72812.1"
FT                   /translation="MSLLASARMVNPMPIEPWNSAKRRARRKMIWSKAHVVLAAIGTLS
FT                   AVAGIAVAINGGLEFNRTKVFVGVGIIIVSTILYVSMLFVDD"
FT   sig_peptide     626199..626360
FT                   /locus_tag="Bphy_3677"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.674 at
FT                   residue 54"
FT   gene            complement(626469..627725)
FT                   /locus_tag="Bphy_3678"
FT   CDS_pept        complement(626469..627725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3678"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: bxe:Bxe_B2239
FT                   putative diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72813"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2JML9"
FT                   /protein_id="ACC72813.1"
FT                   /translation="MKLRVRCIKRTSLRLVESKKQVATGVATVGLKQTHIEADNQTLGP
FT                   AAGRNATAPMSTTHTPHSVRLRALVDTVQRNERTLRRFQDVELHLIRAQDFQALCSVLF
FT                   DYLPREFGLERVMLWLNDTLPLLHEMASRHVTPPTAGSPAGSLNTSRETGDAATRLCAQ
FT                   GRPWLGACASMDDAARDALRAGDMPAASIALLPLAANGLLSGYLCLGSDNASRFAAGMA
FT                   TDMLERFAVIVAASLDNVAHREQLERLGATDALTGLPNRRYFDERLREETMRASRYRLP
FT                   LGCLFIDIDGFKPINDAHGHAIGDRALALVGACLRKQTRLGDTIARYGGEEFAVLLQGD
FT                   LKDSLAVAERMRTAVAQLELHDNGGARIPLTVSIGASAHAMQSGSDLDRLGRTLVDEAD
FT                   RAMYKAKADGRNRVVTLVT"
FT   gene            complement(627732..627926)
FT                   /locus_tag="Bphy_3679"
FT   CDS_pept        complement(627732..627926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3679"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II2151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72814"
FT                   /db_xref="GOA:B2JMM0"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM0"
FT                   /protein_id="ACC72814.1"
FT                   /translation="MRLLLALLLPWFQFFTIGRPFAGIICLVLQLTIIGWLPAAIWSVY
FT                   ALSQYKTDRKIEAALGRRS"
FT   gene            complement(627956..628291)
FT                   /locus_tag="Bphy_3680"
FT   CDS_pept        complement(627956..628291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3680"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   bte:BTH_I2656 domain of unknown function, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3680"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72815"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JMM1"
FT                   /protein_id="ACC72815.1"
FT                   /translation="MIERHMVSTTFDLPGHTVDASLGMVRGIIVRSRSVVGSIGAGLQT
FT                   IFGGNISLYTSLCERARQDAYERMLADAAMLGANAVIGMRYDATEIGAGVTEVLCYGTA
FT                   VHARRNV"
FT   gene            complement(628323..629045)
FT                   /locus_tag="Bphy_3681"
FT   CDS_pept        complement(628323..629045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3681"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bxe:Bxe_B2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3681"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72816"
FT                   /db_xref="GOA:B2JMM2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM2"
FT                   /protein_id="ACC72816.1"
FT                   /translation="MSYLLVLAVGLAAGTLSGVIGTGSSMLLMPVLVMLSGPQQAVPIM
FT                   AIAAIMGNFGKVLAWWREIDWRACGAYCSTAVPGAALGVRTLLALPPHAVEIALGLFFV
FT                   AMVPARRWLARRAVRFSRWHLAAIGGPVGFLTGIVVSTGPITVPVFIGYGLVKGAFLAT
FT                   EAAGSLAVYGAKVATFDHFGALPLHVVLDGLITGSALMAGAFCARRIVVRMSPGTFRLV
FT                   VDGLMLSSGLSLLWAAGR"
FT   sig_peptide     complement(628989..629045)
FT                   /locus_tag="Bphy_3681"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.356 at
FT                   residue 19"
FT   gene            complement(629166..629456)
FT                   /locus_tag="Bphy_3682"
FT   CDS_pept        complement(629166..629456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3682"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72817"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM3"
FT                   /protein_id="ACC72817.1"
FT                   /translation="MYLCKTQLLAGHCRDGRADSPTGRSAFMRRAVWRGRLRADVCVSE
FT                   QDTSPMQTGIAEARLQTAAAGAVPFVAYVGAGFRYSRVRALEPSPLACAMR"
FT   gene            629458..630612
FT                   /locus_tag="Bphy_3683"
FT   CDS_pept        629458..630612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3683"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pap:PSPA7_3642
FT                   probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3683"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72818"
FT                   /db_xref="GOA:B2JMM4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM4"
FT                   /protein_id="ACC72818.1"
FT                   /translation="MIRDQETLSILLDSLSRFVRERLVPAENEVAETDEIPADIVGDMR
FT                   ELGLFGLSIPEEYGGLGLTMEEEVLAAFEIAKASPAFRSLIGTNNGIGSQGLVIDGTDE
FT                   QKQYYLPKLASGELIASFALTEPGSGSDAASLRTTALRDGDHYVINGTKRFITNAPEAG
FT                   IYTVMARTSPDSKGAGGISAFIVEKGTPGLSLGKIDKKMGQKGAHTCDVIFENCRVPAS
FT                   NMIGGKEGVGFKTAMKVLDKGRLHISAICVGAAERMLDDALRYAMERKQFGQPIAEFQL
FT                   VQAMLADSRAEIYAARSMVLDAARRRDEKHDVSTEASCCKLFASEMCGRVADRAVQIHG
FT                   GAGYVSDYAVERFYRDVRLFRIYEGTTQIQQLVIARNMIRDASR"
FT   gene            631003..633288
FT                   /locus_tag="Bphy_3684"
FT   CDS_pept        631003..633288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3684"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72819"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM5"
FT                   /protein_id="ACC72819.1"
FT                   /translation="MNQSQPISALSGTFTAPTPFASMPGNLFAQGYAYAVDAWQRSVLF
FT                   ADVMRERGNQYHAHLQERVPNVLDFGAELVVDGRTLPRPVNYGLVRIAAPDDLKPDRDL
FT                   VEGRDPGRLRPFVVVDPRAGHGPGIGGFKRDSEIGAALRAGHPCYFVGFLPDPVPGQTV
FT                   EDVMLAEAAFLEKVIELHPDSPGKPAVIANCQAGWQVLMTASMRPDLFGPIVVAGAPVS
FT                   YWAGWRGKNPMRYSGGMLGGSWLTALTGDLGDGRFDGAWLVENFENLNPANTLWTKQYN
FT                   LYANIDTEGPRYLSFEKYWGGHVFLNAAEMQYIVDNLFVGNRFVSGEIVTSDGVRLDLR
FT                   NIRSPIVVFCSYGDNITPPPQALGWITDLYRDDADLLGHDQTIVYATHDSIGHLGIFVS
FT                   SSTGKKEHREFVSNIDLIDLLPSGLYEADMGAKTEATPHADLVEGQYVLSISPRTIADV
FT                   REIVQPNPESDRRFATAAYVSRFNLGMYRSFLQPWVRACTTPWTADMSSKLHPLRVTYE
FT                   LWSDRNPFASSVARAAASVKEARAPVAEDNPFMQMQTAMSNAIIASLDYYRDMRDAAVE
FT                   QAFETIYGAPWLQAFAGLPPQSDSAANAALTEPGDTEERDASIVAEHERLRNDMMQGGL
FT                   VEASVRALLYVRRTRGDADERRFNLAREMLSKLSDRGILYFKHVVREQAALLRLDSEAA
FT                   IDALPGLLSNAPHDNIRSAARDIDEISTMLPLEDSERADLARVLSIFESASKKKTARRA
FT                   EPARQQVE"
FT   sig_peptide     631003..631092
FT                   /locus_tag="Bphy_3684"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.942 at
FT                   residue 30"
FT   gene            633373..634314
FT                   /locus_tag="Bphy_3685"
FT   CDS_pept        633373..634314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3685"
FT                   /product="Phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   bvi:Bcep1808_6175 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72820"
FT                   /db_xref="GOA:B2JMM6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM6"
FT                   /protein_id="ACC72820.1"
FT                   /translation="MEHKREKYERLVAFAATLPPTPTAVAHPCDHDSLSAVVEAARMKL
FT                   IAPILVGPRAKIEAAAKEGNLDLGDLPIVDAPHSHAAAEIAVQLVHEGRAQALMKGSLH
FT                   TDELMGAVVSRSTGLRTERRVSHCFIMDVPGHDEALIITDAAVNISPTLDEKRDIVQNA
FT                   IDLAHALHVPVVRVAILSAMETVNSKVPSTLDAAALCKMADRGQIKGGILDGPLALDNA
FT                   INEEAAKIKGIDSPVAGRANVLVVPDLEAGNMLAKSLTFLAGADAAGIVLGAKVPVILT
FT                   SRADSVITRLASCAVASMVALARREQPASAIV"
FT   sig_peptide     633373..633453
FT                   /locus_tag="Bphy_3685"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.882 at
FT                   residue 27"
FT   gene            634333..635514
FT                   /locus_tag="Bphy_3686"
FT   CDS_pept        634333..635514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3686"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: bvi:Bcep1808_6166 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72821"
FT                   /db_xref="GOA:B2JMM7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM7"
FT                   /protein_id="ACC72821.1"
FT                   /translation="MDVILVINAGSSSIKFHAFHAQGAQLEPIAGGKLEEIYTNPRFTA
FT                   KRQNGEVIEDKRWPEGEQLGHDNAIAFLLDWLRSHGEGRATLLAVGHRVVHGGDKYAEP
FT                   VRVDAKVMEELEALVPLAPLHQPHNLAAIRSIMARNTNVPQIACFDTAFHHTQPAVATR
FT                   FALPPDITSRGVRRYGFHGLSYEYIASVLPQVDERAAKGKTVVMHLGNGASMAAFDGCK
FT                   SIASTMGFTAVEGLVMGTRSGSLDPGVVLWMLEEANMDARAIESLLYKRSGLLGVSGIS
FT                   SDMRTLLASDDPKAAEAVELFCYRISRELGSLAAALGGLDAIVFTAGIGERADAVRKRV
FT                   GQLAAWLGVSLDEAANQRHGPCISDAKSAVDVWVIPTNEELMIARHALSRLES"
FT   gene            635517..636296
FT                   /locus_tag="Bphy_3687"
FT   CDS_pept        635517..636296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3687"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bvi:Bcep1808_6177 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3687"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72822"
FT                   /db_xref="GOA:B2JMM8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM8"
FT                   /protein_id="ACC72822.1"
FT                   /translation="MERPTGQVLAGSKALIVGIANEHSIAYGCARAFRELGADLAITYL
FT                   NDKAKPYVEPLAQELGATLLLPLDVSKPGELEAVFDAVRTTWGRLDVAVHSIAFAPKAD
FT                   LQGGLLNSSPEGFSVAMDISCHSFIRMARLAAPLMDDGGSLFAMSYLGASRVVPNYDLM
FT                   GPVKAALEASCRYLAHELGPKRIRVHPISPGPLKTRAASGLKDFDLLLNEAAERAPIGE
FT                   LVDIMDVGYTCAFLATPYARRMTGNTVFVDGGVSIIG"
FT   gene            636302..636724
FT                   /locus_tag="Bphy_3688"
FT   CDS_pept        636302..636724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3688"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72823"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMM9"
FT                   /protein_id="ACC72823.1"
FT                   /translation="MACTELLAGGLPQNASLDEINTLVYRYSPADCSAIELVGGADEHT
FT                   AALIAINGANVTALNPALNPALNPIRRRPCEPACKPFSPTPRCTSAHLLPPALTLPPLC
FT                   HNMMDLSRGCPSQRHSSTHRITGSKETRSRNERCLA"
FT   gene            636705..637016
FT                   /locus_tag="Bphy_3689"
FT   CDS_pept        636705..637016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3689"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72824"
FT                   /db_xref="GOA:B2JMN0"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN0"
FT                   /protein_id="ACC72824.1"
FT                   /translation="MNDASHKIGSISSSSKAPAVPTPPTVPKPERAQDAWARKESAKHG
FT                   GMPWAMFALSAIGLLVGVFAVIGPEHVSVAVAKTLLTVGCMLVAALAGVVASDLSRNR"
FT   gene            637292..639286
FT                   /locus_tag="Bphy_3690"
FT   CDS_pept        637292..639286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3690"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: bur:Bcep18194_C7094 sigma 70 (RpoD)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72825"
FT                   /db_xref="GOA:B2JMN1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN1"
FT                   /protein_id="ACC72825.1"
FT                   /translation="MAKLDRDNSQFETTAAKTPKRAAKAKAQPAAPQDSALMESLAEER
FT                   QRQMRALIALGRERGYLTHADINDHLPDNFTETAAMETIVSTFGEMGVSVYETAPDAET
FT                   LLLNDGPSAAASDDQADEEAEVALSTVDSEFGRTTDPVRMYMREMGASELLTRAGEIEI
FT                   AKRIEGGLQDMVQAIAMCPSIIATILADVDRVVAGEIRIDELVDGISDTTEAAELDDDS
FT                   AEAAAEEELETSASDDDSDDEDGDLSDDGGEKANAARLEQLTADSLAIFERVRALFASV
FT                   PDMPVTDKRRATAIANLRESIQQELTPIRFTAKTIDRLCAEVQAQVAQVRAIERSILQI
FT                   AVDRCDMPRETFVESFPGNETDLDWTMRVAAKSKTYGPALERHLPAIQSEQQKLVDIEA
FT                   SIALPLQQLKQINKQLGSAESKMRQAKREMIEANLRLVISIAKKYVNRGMHFLDLIQEG
FT                   NIGLMKAVDKFEYRRGWKFSTYATWWVRQAITRAIADQARTIRVPVHMIESINKLNRIQ
FT                   REIVQQTGQEPHPSVLAERMDMPEAKIRSILKIAKNPASLDSPVGEDADTTLGDMIEDT
FT                   SATSPADAAVHANMRRAIDEALDALTPREAKVLRMRYGIDTASELTLEEVGRQFDVTRE
FT                   RIRQIEGKAIRKLNHPSRADKLRPFLERS"
FT   gene            complement(639421..639861)
FT                   /locus_tag="Bphy_3691"
FT   CDS_pept        complement(639421..639861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3691"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72826"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN2"
FT                   /protein_id="ACC72826.1"
FT                   /translation="MKAKWAAVLIAASTFGVMSSQASAQVAGSQTIGVSVEQEAIIING
FT                   WSAKKSLLGKPIYNEQGQKVGVLHDIIIAPDNAASFAIVAAHQFLGVSQHDVAVPLSQI
FT                   DYSNGKLVWAGATKDAVKAIPAFQYAKVRATPMARKEYSEHH"
FT   sig_peptide     complement(639787..639861)
FT                   /locus_tag="Bphy_3691"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 25"
FT   gene            complement(640008..640859)
FT                   /locus_tag="Bphy_3692"
FT   CDS_pept        complement(640008..640859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3692"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72827"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN3"
FT                   /protein_id="ACC72827.1"
FT                   /translation="MQVLNPVLASANRVLSAVGVALCVALASSGGTVVYAASTAAHKAS
FT                   EPKASNETQGAQQTQQASAASTPDRFTADDPVKVRDMFASQISTGETHSLTERIRKLAR
FT                   EPYDRFVHGRAATAGNAQRTFLFMIPAPHGILYRSSTHMLSVNVPLASDDDPDVIQLYQ
FT                   SIEGPRGRGLVIAPDAKAKGFIQKIDSIELATAGKKTTARGRLKLPQASFEQADDNFAI
FT                   VLVCTLEPPYLTETREHSDPTDEEPTDITRRTSTLHANVQAVWLVNKKDNTVLAKGLHL
FT                   AK"
FT   sig_peptide     complement(640749..640859)
FT                   /locus_tag="Bphy_3692"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.943 at
FT                   residue 37"
FT   gene            complement(641370..642560)
FT                   /locus_tag="Bphy_3693"
FT   CDS_pept        complement(641370..642560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3693"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C1358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3693"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72828"
FT                   /db_xref="GOA:B2JMN4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN4"
FT                   /protein_id="ACC72828.1"
FT                   /translation="MTASTQLTAANYLPDDLGHALLIGRVWRKTDHHEGPCVVAVRNGD
FT                   VYDITSSAPTTADLFERDDAVDVARNAPGERLCSAAELIAANLANDASATLRLLAPCDV
FT                   QPIKACGVTFAVSLIERVIEEQAGGDPAKAEEVRQTIATVIGTDLSKVKPGSDAAARLK
FT                   AELERRGAWSQYMEVGIGPDAEVFSKSQPMSSVGFGADVGLLAASTWNNPEPEIVLAVN
FT                   SKAVVVGAALGNDVNLRDIEGRSALLLGKCKDNNGSCSIGPFVRLFDGDFTLDAVRRAS
FT                   VSLRVEGVDDGFLLEGVSHMSEISRDPADLVAQTCGKHHQYPDGFMLFLGTMFSPIKDR
FT                   DAKGGGFTHHLGDIVTISTPQLGALRNTVQLCTEITPWTFGVRALYANLVARGLLG"
FT   gene            complement(642617..644413)
FT                   /locus_tag="Bphy_3694"
FT   CDS_pept        complement(642617..644413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3694"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bxe:Bxe_C1359 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3694"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72829"
FT                   /db_xref="GOA:B2JMN5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN5"
FT                   /protein_id="ACC72829.1"
FT                   /translation="MTDRTQASAGRRLRSQEWFDDPSHADMTALYVERFMNYGLTREEL
FT                   QSGRPIIGIAQTGSDLAPCNRHHIELAERTKAGIRDAGGIPMEFPVHPLAEQSRRPTAA
FT                   LDRNLAYLGLVEILHGFPLDGVVLTTGCDKTTPACLMAAATVDLPAIVLSGGPMLDGWY
FT                   QGKRVGSGTVIWHARNLLAAGEIDYEGFMELTTASSPSIGHCNTMGTALSMNSLAEALG
FT                   MSLPGCASIPAAYRERGQMAYATGKRIVAMVREDLKPSHVMTKEAFENAIVVASALGAS
FT                   SNCPPHLIAIARHIGVELSLADWQRVGEQVPLLVNCMPAGEYLGEGFHRAGGVPAVLHE
FT                   LKRAGLIHESCITVSGRTIGDIATDAATGDRDVIRTAEEPLKHGAGFIVLSGNFFDSAI
FT                   MKMSVVGDAFRQTYLSEPGSENTFETRAIVFDGPEDYHARINDPSLKIDEHCMLIIRGV
FT                   GPVGYPGSAEVVNMAPPADLVRKGITSLPCMGDGRQSGTSASPSILNMSPEAAVGGGLA
FT                   LLRTNDRIRVDLNARSVQLLVDDEELERRRASMKFDVPPAQTPWQELYRQTVGQLSTGG
FT                   CLEPATLYLKVIAERGNPRHSH"
FT   gene            complement(644569..645696)
FT                   /locus_tag="Bphy_3695"
FT   CDS_pept        complement(644569..645696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3695"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bvi:Bcep1808_5603 regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3695"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72830"
FT                   /db_xref="GOA:B2JMN6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN6"
FT                   /protein_id="ACC72830.1"
FT                   /translation="MRLSTNATAPIGMSSTPRTAKRASEARSPLAAPPRMSDVAALAGV
FT                   SKMTVSRVLAGRGVAAATRERVQRAIDQLGYVADAAAGALSSGRSAFAAVLVPSLASSN
FT                   FSDTVRGLTAALEPHGLQLLIGDTDYDLEREERLVRSMLRHQPRCIALTGAQHTSATRE
FT                   LLVRAGVPVVEMWDLPALPIDAAVGFSNAKAAREMVRYLAGRGYRRIGFIGGASELDRR
FT                   GLERLKGYRQEVKAQGMSERVVRLGDSPITMRHGAPALDALLQRWPDTDAVMCVSDMSA
FT                   FGAIMQCRRRGLSVPADIAVAGFGNFEVAECCTPTITTISVDAYGIGTRTGETLLAALR
FT                   ENDGANGMPRRAMSTRTPARNSVKIDYTVIARESA"
FT   gene            complement(645767..646657)
FT                   /locus_tag="Bphy_3696"
FT   CDS_pept        complement(645767..646657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3696"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: sde:Sde_3214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3696"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72831"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN7"
FT                   /protein_id="ACC72831.1"
FT                   /translation="MQTLECVLPAAAALGECPRWDERRAKLWWVDIQAPALHAFDPKTG
FT                   QDTMLPMPENIGCFSLTEDDGFIAGMRTGIFLLDAKGQVVRKLCANPENPATSRFNDGR
FT                   CDAHGRFWLGTLDEPKAGNAAALYCYGNGALTKVDAGLLTSNGMAFSPDYRWCYHSDTP
FT                   RFTIYRHSYDVDSGEVGPREEWVKFEPTPTDRGRPDGASVDSEGFYWAALYEGGRVVRI
FT                   SPDGKVVETHPLAARCPTMCTFGGDDLRTLYVTTARQGRSAEELEQYPQSGAVFAMRVS
FT                   VPGLIEKRSALRVAD"
FT   gene            647055..647819
FT                   /locus_tag="Bphy_3697"
FT   CDS_pept        647055..647819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3697"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: bpm:BURPS1710b_A0245
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3697"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72832"
FT                   /db_xref="GOA:B2JMN8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN8"
FT                   /protein_id="ACC72832.1"
FT                   /translation="MNTGKVTLVSAGPGDLDLLTFRAAKAIAAGDVLLIDDLVNEEITT
FT                   LKSAHARVVKVGKRGGCKSTPQAFIQRLMRRYALQGKHVVRIKGGDALLFGRAGEEIAD
FT                   LRHAGIAVEIVNGISSGFAAAAALGVSLTHRDHCQGVIFVTAHLRDNTEPDWAALAATG
FT                   MTLAIYMGASRIDSISEALSRTLTPDTPAAVVQWAGTSREKRLCATLGDIAACAAEQHV
FT                   ASPAVILVGGAIGEAMAQVSARSEPMLQRLSA"
FT   gene            complement(647825..648433)
FT                   /locus_tag="Bphy_3698"
FT   CDS_pept        complement(647825..648433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3698"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bur:Bcep18194_B1304 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3698"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72833"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMN9"
FT                   /protein_id="ACC72833.1"
FT                   /translation="MSISSVLHWCFGAQQHVGRDHGRSDGTDSPDDAERCSPQDERRAL
FT                   LGELQRQAYLHELLRLTCADVMRTPPVTVSVDETIGGALKTLDAHHIKLLPVVDTHGRL
FT                   KGVVTHVDLQPLDEVLPFLKLASDTTAPESERREWPVTTVMSAHVRYVDVLTPLTEIIP
FT                   LFTTNGHHHLPVVEEGGRVVGMLTQADILKLMCGRPGGI"
FT   gene            648623..649723
FT                   /locus_tag="Bphy_3699"
FT   CDS_pept        648623..649723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3699"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /note="TIGRFAM: tRNA 2-selenouridine synthase; SMART:
FT                   Rhodanese domain protein; KEGG: bte:BTH_I0620 YbbB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3699"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72834"
FT                   /db_xref="GOA:B2JMP0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP0"
FT                   /protein_id="ACC72834.1"
FT                   /translation="MHAIIELTSRRDRSLLLPLKSLLAPLDQIADFDEIVDVRTPLEFA
FT                   EDHIPGAINAPVLSNEERVIIGTMYKQVSPFEATRQGAAMVSRNIAAHLETTFADRPRN
FT                   WRPLVYCWRGGKRSGSMTTWFNLIGWRARQLDGGYKTYRRSVVELLETLPQQFRYIVLA
FT                   GHTGSGKTRLLNALAGADAQTLDLEALAAHRGSILGMLPDEAQPSQKAFDTALIGALRG
FT                   FDANQPVFVEAESRRIGAIALPVSLTEQIHRGTCIRVETERDERIRLLLQDYAHLFDNR
FT                   ALFKSQLARLVELHGHARIEEWHKLIDEDRRVELFEQLIDLHYDPAYARSTGKHFAKLP
FT                   ESTHFVLRPTDADLHEQACALLARLR"
FT   gene            complement(649764..652106)
FT                   /locus_tag="Bphy_3700"
FT   CDS_pept        complement(649764..652106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3700"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: bxe:Bxe_B2035
FT                   putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3700"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72835"
FT                   /db_xref="GOA:B2JMP1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP1"
FT                   /protein_id="ACC72835.1"
FT                   /translation="MLFSPTEQTSDAGFRSRFHRRSLEHQRPLSTVTMAFTVVAFIIFV
FT                   CARSLVAGPAVPLVWRLACALVLALLVAAIPRTRRIWVFGGIGVAYTLVLLAGLAVNVA
FT                   GLDEPLLWALPAIVVVSVCAAPLWLTPAHFCIGTALFYAAGTPFLLSLPHPHGDVSVVC
FT                   WMWVLIALPTAAVFHFGFYGLRRNHFLLEDRLARLAATDPLTGLQNRRAFLEQAALRLS
FT                   SLDPGAKTSAIFLDIDYFKSLNDQFGHAVGDQALSDVARVLKEMTGAGDIVSRIGGEEF
FT                   ALLHGAALRPAVQLAETLRAAIGRIARPDGQLGASFGVAEYRPGESVMALLDRADEALL
FT                   RAKYSGRNRVCAERATLVDPVRLARTHDDADGAASQPVRQQWDDFWLTSHFQPLYSLSH
FT                   QKQVGFEALLRGEREDGAQVPPAVLFSPKPFTDQGELDRVSHALHLGNARRLIPDDAWV
FT                   FLNILPSTFVADGYPDQLAQIARSAGISAGRVVLELLESHGGSVDEMSRVASQYRDHGF
FT                   LIAVDDFGAGHSNLDRLLRIRPDLVKLDGELIRAKSHGADQPILPKLVSLLHQAGMLVV
FT                   VEGVETTEQLILAVESNVDFAQGFLLGRPAPSITPPDAVHRRIDHAFDVIAEGRAHQHA
FT                   LFESEVRPYRQALDAGVDAWLKGTPLKDAFYDLAQLELCISCFVLDDAGRQIGHELPGK
FT                   ASAIDGGSLHPVANPRDARWDHRPYFRNAVLKPGVPITSSPYLSLASGRPCIAVTVALQ
FT                   SEGGRCVVGAELDWSLQRLPWPTAEHW"
FT   gene            complement(652462..652965)
FT                   /locus_tag="Bphy_3701"
FT   CDS_pept        complement(652462..652965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3701"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   maq:Maqu_2929 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72836"
FT                   /db_xref="GOA:B2JMP2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP2"
FT                   /protein_id="ACC72836.1"
FT                   /translation="MTTSFTPVTPNQVVPRIREAVLPADAGPLVAIIREYVRWLDMDLS
FT                   YRGFEEEMQSFEQTYTWPSGVFFIAQADGELAGCGGLLRHSDEVAEVKRLYVRPAYRGL
FT                   ALGEQLMMRVIGKARSSGYAKLVLDSVPQTAFAQRLYERLGFTETAPYYTNAVAGTRFL
FT                   ELRL"
FT   gene            653353..653973
FT                   /locus_tag="Bphy_3702"
FT   CDS_pept        653353..653973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72837"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP3"
FT                   /protein_id="ACC72837.1"
FT                   /translation="MKLNRTMLAALGLLAMSSAHATSFNCAIAHSTAETLICHDAGLSK
FT                   ADDELGKLFRLALKQTADRRAYRRDSDSKWTWREENCKDVACLTDWYSTRIGEIREHLR
FT                   KPAPGEEQARPVDSDLAAVSKPSAKRKAFESQAFARDVQQCTATTQDLVPPVQCSSVLE
FT                   KHAQWQTHGPATDGWFCGVAMIAPPPTDGGARKQAPNVLSESF"
FT   sig_peptide     653353..653418
FT                   /locus_tag="Bphy_3702"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            654061..654414
FT                   /locus_tag="Bphy_3703"
FT   CDS_pept        654061..654414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3703"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pfl:PFL_5193
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72838"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP4"
FT                   /protein_id="ACC72838.1"
FT                   /translation="MNTPDTPIVHLFSYGTLQDRNVQISSFGRELAGHADALPGYALTL
FT                   LAIADPKVVEISGKTHHPVVRPSGNPADEVAGTVFEITPEELTAADEYEVADYKRVLVT
FT                   LKSGIDAWVYIAA"
FT   gene            654520..655074
FT                   /locus_tag="Bphy_3704"
FT   CDS_pept        654520..655074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3704"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72839"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP5"
FT                   /protein_id="ACC72839.1"
FT                   /translation="MVSSVGYGMASTPSTHRASVSGEASAAVAQSAAGSAPRSEQNDAK
FT                   QDAASQAAQPGVTVSISPAGATAVSRMQRADSVVHKSNASANASAAADADLDADTDLDT
FT                   DVDTADIDGADGIEGGEPAGGTTASDDATPSDVSPVKAFAYGALGLERPDQPKDERNGF
FT                   YSAGKWLAAGLTIGGLISLLV"
FT   gene            complement(655103..655561)
FT                   /locus_tag="Bphy_3705"
FT   CDS_pept        complement(655103..655561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3705"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72840"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP6"
FT                   /protein_id="ACC72840.1"
FT                   /translation="MISSRHLPYSTAASYLPNAMISLKRLSSLAALVSLTFAAHAQVPP
FT                   SSGLPPPHDGPANDSPPPHGPGFAAVNDLEHLQRLYDISGRDSEMNAVYHDVLSKTRDP
FT                   ALRHYVYVALARNQLKPANVDQAIDTIRRSLDEDIEALDKRAAPPARR"
FT   sig_peptide     complement(655436..655561)
FT                   /locus_tag="Bphy_3705"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 42"
FT   gene            complement(655779..657200)
FT                   /locus_tag="Bphy_3706"
FT   CDS_pept        complement(655779..657200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3706"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rme:Rmet_1898
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3706"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72841"
FT                   /db_xref="GOA:B2JMP7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP7"
FT                   /protein_id="ACC72841.1"
FT                   /translation="MYTIDRIYIDGAFVTPHGEEWFDLFNPATERVTGRVRLADAKDAR
FT                   DAIAAAKRAFPAFARTSQRARIDMLRRMHAAVVAKEDELYEAIIEEYGAPVSRGRWMAQ
FT                   HASNVLSEAARALEQYGFTRQAGTAEVVMQPLGVAGLITPWNSNAGFICGKLAAALAAG
FT                   CTAVVKPSEMSALQTQIVTQALHDADLPPGVFNIVTGRGDSVGAQISSHPDVAKISFTG
FT                   STAVGKTILRTGADTLKRVTLELGGKSPVVVLDDAEFAQAVPLAIQAGFMNSGQACIAG
FT                   TRILVPRPRLAEFEALVRDEVARTQSGDPRDPRTTVGPMVSQKQWERVQRYIRIGIDEG
FT                   ARLIAGGEGRPDGVAAGWFIRPTVFSDVTNDMTIAREEIFGPVLAIIAYDDVEQAVAIA
FT                   NDTNYGLQAYVFSQDTTRARDVASRIEAGRVLVNTLAHEPAAPFGGFKQSGIGREYGTY
FT                   GIEAFLEPKAVLGVL"
FT   gene            657303..658277
FT                   /locus_tag="Bphy_3707"
FT   CDS_pept        657303..658277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3707"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rpb:RPB_4389 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72842"
FT                   /db_xref="GOA:B2JMP8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP8"
FT                   /protein_id="ACC72842.1"
FT                   /translation="MKTTGMTELEAVLAVARHRSFRAAANELGVSTSALSHAVAALEAR
FT                   IGVRLFNRTTRSVSLSEAGAQFVDSVAPALSSIRVALEQAGSFRDTPSGTLRINTSVGA
FT                   AHQAMPVFIAFLERYPEMKLDIVTEGRLIDIVVEGFDAGIRLAETVPQDMIAVPFGDRQ
FT                   RFAVVGSPAYFAQHTPPRTPHDLARHRCIRTRMPSGSIYQWEFERHGETVRIDGKGALT
FT                   LDESGLMLDAARAGVGLTYLSEWTVAADLEAGTLIRVLDDWTPPLDGLCLYYPGRRHAP
FT                   AGLRALVAMIRDWADTQRAEARVRRKRQPKTARADGAARRKKK"
FT   gene            658384..658821
FT                   /locus_tag="Bphy_3708"
FT   CDS_pept        658384..658821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3708"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: reu:Reut_B3488
FT                   DGPFAETKE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72843"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP9"
FT                   /protein_id="ACC72843.1"
FT                   /translation="MRVMVIVKATTDSEADKMPSTELLAAMGQFNEELVKAGIMQAGEG
FT                   LHPSSRGKRVRFSGAKRTVIDGPFAETKELIAGFWLWKVKSMDEAVEWVRRCPNPMEGD
FT                   SEIEIRQIFEAEDFGDEFTPELREQEERLRAEIEQQAGKAK"
FT   gene            complement(658828..659994)
FT                   /locus_tag="Bphy_3709"
FT   CDS_pept        complement(658828..659994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3709"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bur:Bcep18194_A3400 ABC efflux pump, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3709"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72844"
FT                   /db_xref="GOA:B2JMQ0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ0"
FT                   /protein_id="ACC72844.1"
FT                   /translation="MAIPLSYIARNLWTRRLTTALTAGGLALVVFVFATVLMLDAGLKK
FT                   TLVSTGEQDNVVVIRKGAETEVQSAIDRGQANVIEMHPAVAMGAGGMRMASKESVVLIS
FT                   LLKLGTGKPSNVVIRGVSPAGMSLRPQVKLASGRMFSPGSSEIVVGSSIAKGFGGTQLG
FT                   EHLHFAQRDWTVVGTFDAGGSGFDSEIWGDVDQLMQSFRRTSYSSMVVRLAQSDQFEQF
FT                   RADLDVDPRLAEEAKREQTFYSDQSKALSSFLNILGITLSTIFSIAAMIGAMITMYASV
FT                   ANRVAEIGTLRALGFQRANVLAAFLVEAMLLGLVGGLAGLGCAAFMQFASFSTTNFQTF
FT                   ADLSFRFVLTPSIVVKTLLFAMTMGLVGGFLPAMRAARMNIVDALRAR"
FT   sig_peptide     complement(659890..659994)
FT                   /locus_tag="Bphy_3709"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.869 at
FT                   residue 35"
FT   gene            complement(660019..661173)
FT                   /locus_tag="Bphy_3710"
FT   CDS_pept        complement(660019..661173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3710"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rme:Rmet_1793 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72845"
FT                   /db_xref="GOA:B2JMQ1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ1"
FT                   /protein_id="ACC72845.1"
FT                   /translation="MYLLKLIARNALRHKLRTTLTVLGLTIAVLAFGLLHTVVDAWYAG
FT                   AAAASNARLVTRNAISLTFPLPLSYEARIRGVEGVTMVARSSWFGGIYREPKNFFAQFA
FT                   VSDNYLDLYPEFLLPAQQRSDYERDRKGCLIGRQLATAYGFKVGDVIPIKGTIYPGTWE
FT                   FVVRGILDGRDESTITRQMIFHWDYLNESVRKMPGRKADQVGVYVVGIDNPDNAAEISR
FT                   RVDSVFKNSLAETLTETEQAFQLGFVAMSNQIIAAIQLVSYVVIVIIMAVMANAMAMSA
FT                   RERTVEYATLKALGFGPGFLALLMFGESLTICTVGAGLGMLATPPAAAFFKQVTGGVFP
FT                   VFAVSRDTMLQQAACALVVGVAAAVVPALQAARVRIVEGLRAIG"
FT   sig_peptide     complement(661060..661173)
FT                   /locus_tag="Bphy_3710"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.526 at
FT                   residue 38"
FT   gene            complement(661195..661902)
FT                   /locus_tag="Bphy_3711"
FT   CDS_pept        complement(661195..661902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3711"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_0222 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3711"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72846"
FT                   /db_xref="GOA:B2JMQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ2"
FT                   /protein_id="ACC72846.1"
FT                   /translation="MSAPNPATPPLVEIRHLVKSYRRGVQTVPVLSDITLAIREGDFIA
FT                   LMGPSGSGKSTLLNLIAGIDRPDGGQLSVGGLDITRLSESALAQWRAAHVGFIFQFYNL
FT                   MPVLTAFENIELPLMLTRLSRKERRERVSLVLDMVNLGNRAHHYPSELSGGQQQRVAIA
FT                   RALITDPTLIVADEPTGDLDRASAEEILAMMQRLNRELGKTIIMVTHDAHAAGAANALV
FT                   HLEKGELIDGSRS"
FT   gene            complement(661899..663251)
FT                   /locus_tag="Bphy_3712"
FT   CDS_pept        complement(661899..663251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3712"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bur:Bcep18194_A3403 secretion protein HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3712"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72847"
FT                   /db_xref="GOA:B2JMQ3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ3"
FT                   /protein_id="ACC72847.1"
FT                   /translation="MPFAYLARLCTAVFLRALLQRKRDTRRSQRRRGTALYCVPVSIRR
FT                   HNKLADHDLKRLKIDRPAVATGGRRRNWIGYGAVALIVIGALVFGLRLAGPQSVETTTV
FT                   VSAYPSQTYTLLNATGYVVPQRKAAVASKAQGRLEWLGVLEGTRVKKDEVIARIESADV
FT                   SASLAQAKAQVKVAQANLALQQAELKNAEINLRRSKILAPNGAIPATQYDADLARYDKA
FT                   VASIDNSRAAIVSAQANAQAAQVAVDQTVIRAPFDGVVIEKHANVGDNITPFSQASDSK
FT                   GAVVTIADMDTLEVEADVAESNIAKIAVNAPCEIQLDALPNVRLAGSVSRIVPTVDRSK
FT                   ATVLVKVRFVDHDARVLPDMSAKIAFLSKPVPPEDRKPVVAVQPAAIVERNGRKVVFVV
FT                   KDDTAREVPVTTAQTLGELVAVSGVRPGDVLVRAPNEHIKDGAKVSVAKKQ"
FT   gene            663329..664186
FT                   /locus_tag="Bphy_3713"
FT   CDS_pept        663329..664186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3713"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: bte:BTH_II1091
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72848"
FT                   /db_xref="GOA:B2JMQ4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ4"
FT                   /protein_id="ACC72848.1"
FT                   /translation="MKNDQTVAPDSTAVRVALWRAMHVQVDAAPHVLDDEIGLRLAAPD
FT                   AGWRDRPDMDARGTRGYRASIVGRARFIEDLVAQQRDRGVEQYVILGAGLDTFAQRQPE
FT                   LASRLTVFEVDRPGAATWKRQRLVELGYGVPDWLRLVPVDFEAGQSWWEQIAHAGFDAD
FT                   APAVIASTGVSMYLTRDANLATLRQIAKLAPGSTLAMTFLLPLDLVDPAERAQHESVYE
FT                   RARAAGTPFVSFFTPDEMLALGHKAGFRRVEYVSTGDLVGRYFARRRDDLRPSTGEAFL
FT                   VATT"
FT   gene            664545..665801
FT                   /locus_tag="Bphy_3714"
FT   CDS_pept        664545..665801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3714"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B1021 major facilitator superfamily (MFS)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3714"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72849"
FT                   /db_xref="GOA:B2JMQ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ5"
FT                   /protein_id="ACC72849.1"
FT                   /translation="MNFENTPSSRLQEVADGTSSPLRAWLAVASVTVGAFAFVTTEFLP
FT                   VGLLPQVAQTFDVLPGTAGLMVTIPGIMAAISAPGMMLAARRVNRRLILILLSVMLLAS
FT                   NLMSAFAPSFSVMLVGRAMLGAALGGFWTLALAAAGRLVKAHEAPRATATILAGVTCAT
FT                   VIGVPLGTFIASFASWRMSFVATAVLVTVALIAQFALLPSLPSKAALRFADLVTLVRRP
FT                   FPRKSLLMVALIFGAHFSSYTYIAPFLQDAHFNASTITAVLLGFGIIGFVSNFTVSTFV
FT                   ARRLRGSLASMTMLLLFALLTMPLLKDMAPVVTAVVLAWGVAFGAIPLCVSVWMQEAAP
FT                   DLPEAGSALFVGIIQVAIAVGSSAGGTIVDHAGIPVDFWFGSVLAILGLVTLASFRKRN
FT                   AGVPFDAPVKTADVQTECV"
FT   gene            666098..666379
FT                   /locus_tag="Bphy_3715"
FT   CDS_pept        666098..666379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72850"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ6"
FT                   /protein_id="ACC72850.1"
FT                   /translation="MTNEPRPVRRLQLLLRDTCSNDAAREAARRAAGQLGMQISGEGRA
FT                   TLSARMSDAAFRRLFPHSSSMSGTLAVPDSLEPYVASISEAPQHLSFD"
FT   gene            666523..668097
FT                   /locus_tag="Bphy_3716"
FT   CDS_pept        666523..668097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3716"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: xau:Xaut_1088 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3716"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72851"
FT                   /db_xref="GOA:B2JMQ7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ7"
FT                   /protein_id="ACC72851.1"
FT                   /translation="MKAYDPHDATTRPSRSDTEEALRVAITFNRPGQNIGPTKFGARMS
FT                   TDTVSSFIPDPAQADLALAELARRGFTLTGRGSLSASMRCTREQFEALFQTKLKRMKAP
FT                   CASAAQFGSVLYPPDNAPWNPDPSVQSLLDDVYIQWPHIYMARAAKAAKAAKSAKAKAS
FT                   ATAAKKRAAPKTREAIAPSATPPTVPYFHLAAPADVALKLNATPVHQQGITGKGVRIAM
FT                   IDSGFAHGHPYFKAHGYASSVVLAPGATDRRTDGNGHGTGESANIFAIAPGATFIGVKL
FT                   DNEADPSSGASVLEGLQEALKHDPQVISVSLGYDLRGPGNTPLKTLPNGLVALEAEIQA
FT                   AVKRGIVIVFSAGNGHYSFPGQMPEIISAGGVFVDQNGAMRASDYASAFTSLIYSGRSV
FT                   PDVCGLVGLLPHATYISLPVSPGCEIDRENAAFDGTTSNDGWGVFSGTSAAAPQLAGLC
FT                   ALLLQADPHLSPGDIKSILRRTARDVTKGHANPASDPKGAGVPAGVGQDGATGAGLADA
FT                   LAALRQV"
FT   gene            668219..669178
FT                   /locus_tag="Bphy_3717"
FT   CDS_pept        668219..669178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3717"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: bxe:Bxe_A2188
FT                   putative phosphohydrolase, MutT/NUDIX"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72852"
FT                   /db_xref="GOA:B2JMQ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ8"
FT                   /protein_id="ACC72852.1"
FT                   /translation="MIVPSSSIGFNLNHLDRRSDKRDDEAFVANLRNDSAARFLVFDGD
FT                   VPLLKRGERYDAWFVASEALAFGQALQSVFLGEDGDGSGHFALGFAPGLVQGDGKDEQQ
FT                   PRKQPYERIDLRSIAMQGLVPHEVLGVLGEAKSMLDWHNRHRFCANCGARSRPTAAGWQ
FT                   RLCDACGARHFPRVDPVVIMLTIDGERCLLGRQRQFAPGMYSALAGFVEPGETVEDAVR
FT                   REVHEEAHVNCAGVVYFASQPWPFPSSLMIGCFAQASDTDIVIDTTELEDARWFTRAEV
FT                   AAMLEGTHADGLSAPKPFAIAHHLLRAYVEHGAAVLRG"
FT   gene            669576..670040
FT                   /locus_tag="Bphy_3718"
FT   CDS_pept        669576..670040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3718"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72853"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ9"
FT                   /protein_id="ACC72853.1"
FT                   /translation="MRKQAVHYALVFACGCAVAIGARAADAIGVVKTVKGAVHIERAAQ
FT                   SVDALIGSEVYGSDRIVTGPASSVGITLRDNTLLSEGSSSVLELNHFAFNTTTHDGALD
FT                   ATIRRGSLAVVDGKLAKAHPEAVRFSTPTTTLGVRGTEFIIEVGDGENTR"
FT   sig_peptide     669576..669650
FT                   /locus_tag="Bphy_3718"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.919 at
FT                   residue 25"
FT   gene            670037..670660
FT                   /locus_tag="Bphy_3719"
FT   CDS_pept        670037..670660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3719"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: dar:Daro_1992
FT                   OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3719"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72854"
FT                   /db_xref="GOA:B2JMR0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR0"
FT                   /protein_id="ACC72854.1"
FT                   /translation="MKVFGFAASRAQLPSSVLAAALACLCGCSTPDKITLLPNPDGSVG
FT                   SVVVKSGNNTQVLDHAYATAEVAKSGKIEQAVGTPANVETRYGTLLAAQPPRPTTFTIN
FT                   FLFDSATELAPQSAVTVQQMKAVLATWPAPHLTVVGHTDLAGSPEYDDRLSMQRAQTVA
FT                   KFLIKAGIPARQIETAARGKREPLVHTADGVPNQMNRRVVITIQ"
FT   sig_peptide     670037..670096
FT                   /locus_tag="Bphy_3719"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.921 at
FT                   residue 20"
FT   gene            670713..672212
FT                   /locus_tag="Bphy_3720"
FT   CDS_pept        670713..672212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3720"
FT                   /product="putative Chase2 sensor protein"
FT                   /note="PFAM: CHASE2 domain protein; KEGG: dar:Daro_1993
FT                   CHASE2:stage II sporulation E"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72855"
FT                   /db_xref="GOA:B2JMR1"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR1"
FT                   /protein_id="ACC72855.1"
FT                   /translation="MKRLSAPWVTFFRKLLKAGQGRPVALAVLFGLSLLNLYSEWPGGI
FT                   ARPAVFDRFEDFIPDSFNSARQLLFDHYQRRFPRVPASQPVIIVAIDDKTLAAVGQWPW
FT                   PRNRLASLVDAIAAQKPLAIGLDVYMPEADQTSPDKVADNLPDSAATLAAGLRALPSHE
FT                   TILAAALRAAPSVLGAAAVDHAALDTSTDLHSAPILVHGVDPLNHVKRYGYVLASLPEL
FT                   QAAAHGQGMLNVALEQGAVRRIPLILGLGDKLVPCMPIEMLRVVTRSAAVDVYADAAGV
FT                   QSVGVADVQVPTQPDGDIWLHFASMRSTQHRYVSAGDVLQGQVDPERFRDKLVLVGLTG
FT                   TGLTDMRTTALGELVPGIEIQAQIIETIFEGRFLRRPVWVKWVETLFVLGFGLLIIWYL
FT                   PHTDSKLAAFVRAVPKGTAIIGVVLNLLLLATCLLLFKLFGLLVDAASIFIILSAVMGC
FT                   FFSTALLDSAQTLRDALLSRPTKANAPEKTAAAQPVRHPES"
FT   sig_peptide     670713..670832
FT                   /locus_tag="Bphy_3720"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.708 at
FT                   residue 40"
FT   gene            complement(672262..672543)
FT                   /locus_tag="Bphy_3721"
FT   CDS_pept        complement(672262..672543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3721"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72856"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR2"
FT                   /protein_id="ACC72856.1"
FT                   /translation="MKSKIIVAVLVASAASLAAPAFASGYGPAPYYRPDVGAPASQAGQ
FT                   TAQTLAAEAMQASAADESRASVGGDETMTTQSGRRAPAVRLDEVYSGS"
FT   sig_peptide     complement(672472..672543)
FT                   /locus_tag="Bphy_3721"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 24"
FT   gene            complement(673009..674172)
FT                   /locus_tag="Bphy_3722"
FT   CDS_pept        complement(673009..674172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3722"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72857"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR3"
FT                   /protein_id="ACC72857.1"
FT                   /translation="MSYGIVSRVVTFGAILMLASCGGGGGGSGSSPGSPSASNSQPTLA
FT                   KATALVDGTKVGDDYWAAGSTQSGGTGQTVSGLNCGARGNVYTYSHLSVYLNGRPLALP
FT                   TNIGTVAPTLAAQTGCAYPVHTDDESGKIRMDASTGASYTLGQFFAIWGQPLTSSNVAG
FT                   LTGMPITIYVNNGGQLSKYTGDPASLVLPPHGEVSIQIGTPLGQIPTFAWTDPPSFDPN
FT                   QTVLAFGGTVGTGHWQDGSTSTGGTGADVDGLVCASGMSETYHVHAHLAIINNGQWLAL
FT                   PQNIGILSQCNYEMHTHDHTGIIHIETPNAKNFTLGQFFDIWGQTLSRTNVAGVTGTVV
FT                   AYINDNGDVRRYEGELRDIPMISHRDITLQIGSPVNSLATYSWYEPQ"
FT   sig_peptide     complement(674059..674172)
FT                   /locus_tag="Bphy_3722"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.331 at
FT                   residue 38"
FT   gene            complement(674311..674649)
FT                   /locus_tag="Bphy_3723"
FT   CDS_pept        complement(674311..674649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3723"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72858"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR4"
FT                   /protein_id="ACC72858.1"
FT                   /translation="MSEELWCVHIEGPDDFVATSSREAAEREASAINAYLDSAKGRLQE
FT                   RAPTRMVRASAAVWPYTAAGHARSLETDWEDLQRMPHRRTKQETHEGMLSSVLRRMKTL
FT                   ASSARRKS"
FT   gene            complement(674782..676158)
FT                   /locus_tag="Bphy_3724"
FT   CDS_pept        complement(674782..676158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3724"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /note="TIGRFAM: Undecaprenyl-phosphate glucose
FT                   phosphotransferase; exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase; KEGG: bxe:Bxe_A3866 undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3724"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72859"
FT                   /db_xref="GOA:B2JMR5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR5"
FT                   /protein_id="ACC72859.1"
FT                   /translation="MRALTGLLARLFDVALIVAGALVASQIRFDDVSQRGFYLAFVAFA
FT                   AAFSLAIFPALGVYQSWRGRSKRVLASQVALGWLIVQGCAMALMFSLHRIDFVSRLWFV
FT                   YWTALSGSGLIVSRLVIHSLIGRVRHAGIDLQPVAIAACGDHCNDIIHKMESAAESGFR
FT                   PWAVYDVSPDSKKESSVPTFTEHEAFARYVREQNIGEVWLALPLTEERAILKLVDEFRN
FT                   DLINIRFMPDVRALALFEGSVTSLLDQPTINLAASPLPPNAMVKKDLFDRLFALAALLA
FT                   ISPILLACAIAVKLSSRGPVFFKQQRKGADGRVFTIYKFRTMRLHEQKAGVLKQATRND
FT                   PRITRVGGFLRRTSLDELPQFFNVLCGDMSVVGPRPHALEHDDLYQHVVSGYIHRYRIK
FT                   PGITGWAQINGYRGETDRLEKMEGRVEHDLYYLRNWSFALDLRIILATVFKGISHQNAY
FT                   "
FT   gene            complement(676200..677714)
FT                   /locus_tag="Bphy_3725"
FT   CDS_pept        complement(676200..677714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3725"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: bxe:Bxe_B1730
FT                   mannose-1-phosphateguanylyltransferase/mannose-6-phosphate
FT                   isomerase; TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase; Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72860"
FT                   /db_xref="GOA:B2JMR6"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR6"
FT                   /protein_id="ACC72860.1"
FT                   /translation="MDKRTTHAEQHNAAAAAEAAVESGRLVQVILAGGSGTRLWPVSRE
FT                   QYPKQLIDVVGDQSLLQATMKRMDGFAKTWDVAAQPVIVCGAEHFYVTSEQASDCGVKP
FT                   CVVVEPARRDTAPALTLAALTASSDGDDPILVAMPADHAIADVPALHLAIDVAARHAQA
FT                   GEIATLGVPPTRADTGFGYIRLGAQLQDGAHRIDRFVEKPAAELAAQYVASGGYWWNSG
FT                   MFVVRASVWLAALKIFQPDMYAACVQAYENAKRDDGYIAPGADAFAQSPSDSIDYAVME
FT                   HLGKPESPFTGVVVPLEAGWSDLGSWDAVWEAMEKDEFGNVANGRVLMEGATTTYARSQ
FT                   GGRLVACVGTSDIVVVETDDAVLVADRSHVQDVKGLVSRIRQTNSPEADIHRKVRRPWG
FT                   FYDSIDNGERFQVKRIVVNPGGRLSLQMHHHRAEHWIVVCGTALVTRGEEQFLLTENQS
FT                   TYIPIGVQHRLENPGHVPLQIIEVQSGAYLGEDDIVRFDDKYGRCN"
FT   gene            678448..679764
FT                   /locus_tag="Bphy_3726"
FT   CDS_pept        678448..679764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3726"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bam:Bamb_6488
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72861"
FT                   /db_xref="GOA:B2JMR7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR7"
FT                   /protein_id="ACC72861.1"
FT                   /translation="MAYISVLALFLTVTNLIPVSAVGFLPIAFCAWRFFGRSYPSFMGP
FT                   LTALTLFIVVSTLLYDPRSLTEFEFYRRDGNFFISYAPIFAGCVYSHRWDMNKMLRAFF
FT                   VFAVLINIPPYMLYLAQNGLLAIFKNPGDSFGSFFIARNAAGGFLAMMFCLGVACYLQR
FT                   RSKIMLLLIGLNGLMLFSTYSRGSLLGALAILPYLYFGRKRLILASLMSCLVVASLAMA
FT                   FYHLRGNVDYMGYPFSIQNADAKVANLDIRYEWLWPRALTYFRQSPIVGMGFGSFDDTI
FT                   RHVASYFGVFSVPSDIVIEHSDSHAHNSYLNFLAELGVVGLALVLSFFWKLITWSQNGA
FT                   ARAALVEHGQNFTAYRFIELSCVCLLVMAATEHRLVAPSNVLILSLVISLLLASRPVRV
FT                   ARPANNPQVVRPKPPYREHVPPAPPRYPAGATGRIAPGS"
FT   sig_peptide     678448..678513
FT                   /locus_tag="Bphy_3726"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.345 at
FT                   residue 22"
FT   gene            679791..680420
FT                   /locus_tag="Bphy_3727"
FT   CDS_pept        679791..680420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3727"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="KEGG: bur:Bcep18194_B2293 phosphoesterase,
FT                   PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3727"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72862"
FT                   /db_xref="GOA:B2JMR8"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR8"
FT                   /protein_id="ACC72862.1"
FT                   /translation="MWKIDPWTVYSNVGDAAVTLPVAIVCAIWLAWTDARLALRWALTL
FT                   GCAMLPVGASKIAYYAWHVSLPLADFRVISGHTMLSTAVWSVALALQFKWWRLPAMPGI
FT                   VIGLVVGALTGASRVHGHSHSVAEVVAGWTLGTIAATVFLRTALRAEYRPFRPVWSTLC
FT                   LLAVSMLAYGHTAPFQDLIEEHSPTLGAHTPGIVRALSHARFRNHG"
FT   gene            complement(680442..681635)
FT                   /locus_tag="Bphy_3728"
FT   CDS_pept        complement(680442..681635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3728"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bte:BTH_I0524 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3728"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72863"
FT                   /db_xref="GOA:B2JMR9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR9"
FT                   /protein_id="ACC72863.1"
FT                   /translation="MKVAIVHDWLVVSGGAEKVLQNIIECFPNADLFSLVDFMEDRACI
FT                   KGKPVNTSFIQRLPFARKRYRAYLPLMPIAIEQLDLSAYDLVISSSHAVAKGVLTGPNQ
FT                   MHVSYVHSPIRYAWDLQHQYLRESHLTAGLKSAMARVLLHYIRGWDSRSANGVDHLLAN
FT                   SKFIARRIRKAYQRDATVIYPPVDLSHMPLREKKEDFYVTASRMVPYKRIDLIVKAFSQ
FT                   TPERRLVVIGDGPEMKKIKAAAGDNVTILGHQPFDVLVDHLQRARAFVFAAEEDFGISV
FT                   VEAQACGTPVVAFGRGGALESVLGLPRERPTGVFFKEQTTESLLEAVDRFEKYSGLFDP
FT                   RQCRRNAERFSSERFKTALMSFIDARMPDSFVDPTQPYTVEEKASIKDDERERHLLV"
FT   gene            complement(681694..683010)
FT                   /locus_tag="Bphy_3729"
FT   CDS_pept        complement(681694..683010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3729"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   dra:DR_A0035 O-antigen transporter RfbX, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72864"
FT                   /db_xref="GOA:B2JMS0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMS0"
FT                   /protein_id="ACC72864.1"
FT                   /translation="MDRKKSASVIAFVYGGYLMRYVYLIIVVPFYGRVLGVAEYGRVLA
FT                   AMSLMNVIWMLASYGFTFVGMREISKAQNNSEYNAIFSLHTSARLTLCALGGLIGIIAT
FT                   YCSPILSERPLIGFLATALGVVSALNLGWLYQGRHHFRTPIMIEVFGFAVSLALVLVLV
FT                   RGPADSVWVVASLLTAGVLSLCISYGLAIYQIGRPHLSFAGITDLVKGSTMLFCYSSGS
FT                   VVLTASATYLLTLLSTPAQVGYFGAAERFATIGLSLMGPASQVFIPTISRQLAQGDKAG
FT                   AHVTTRRGATLLLGYGLLVFCGALALSPFVLPLILGEAFTPSAHVLQCFAWMFPFAAFN
FT                   EFAAFYVFVPRKKDRLLAIAGAASGVTNLLAALWLAPRYGAEGMAFARVIGELSLSMML
FT                   LTIMIRLELITLVPGAGRAIAMARVAWGARGGAGAGKDD"
FT   gene            complement(683044..684054)
FT                   /locus_tag="Bphy_3730"
FT   CDS_pept        complement(683044..684054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3730"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bam:Bamb_3627 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72865"
FT                   /db_xref="GOA:B2JMS1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMS1"
FT                   /protein_id="ACC72865.1"
FT                   /translation="MKQIAIVICNYNYERFLAEAIDSALAQDYPGTRVIVIDDGSTDGS
FT                   RAILEQYGSRVSTVLKENGGQVSAYNLGVEIADTEYVIFLDSDDVLYPGAVTEVMRIFE
FT                   EGDLAKVQFRLDVIDEAGNQTGAYVPNTEPPTDCGSLLRDGWLYPSPPASGNAYSVKAL
FT                   KAIFPVPEGGINRYGADFYAIYGAALVGPVASLTQSLGAYRVHHAATPSVSFANSEQIK
FT                   KAPKAFKERWVTLREVAKDRLSIELPPTFHDFAHEKAYMGSSLYHATLRARWRWMFNDS
FT                   SAYLHTIVANPFWGLKKKMGTLLLSCLCLVPYSPLSDFVVRYITNPLARRSTAGN"
FT   gene            complement(684152..685639)
FT                   /locus_tag="Bphy_3731"
FT   CDS_pept        complement(684152..685639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3731"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_6489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3731"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72866"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMS2"
FT                   /protein_id="ACC72866.1"
FT                   /translation="MCRRAERRAEQPMDRITYRPSRRRVLATLAALAYAGVRPFPAAAA
FT                   NSAGASGTTGSRAPRRITDLIGTNGWPGSAADIAMWQKMGISWGRGSVGPGQPEASTQA
FT                   MRVDKTGNAYDSDLPSVILRNNQNGIRSLLFLGYTPKWNASLPGDTKSAPQDVSAWERY
FT                   VEAVVRKYSAAPYGVRHFQIWNEAAGRLSGGLPQATFWHGPKFDKEEHRSRPYEQAMQD
FT                   YVERIHIPAARIVRRYGAYVVYGGWPDQGGLDTLDKWLDYRSPRLNARMADWVDYLDTH
FT                   YLSVSDLDGLYEKYVKQGPARGVWQTEIGDRYMIDEHYLPRYFFEFAVWALARNWDDPD
FT                   KYVSMVYHWDGYEPFRLTHRGPPARTYNVSGQSLIVLNQTAPGALAPLPQPLQFGPQVS
FT                   GSGLLSDKDIVIQVSAPSGWRTVQTSGIAPPSGGAQVLFVDALTGSTAAKEDATLDWNN
FT                   DGMSLRFRVPDNMNGADRKQPRHLAYLVVRAGQGKSA"
FT   sig_peptide     complement(685505..685639)
FT                   /locus_tag="Bphy_3731"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.884 at
FT                   residue 45"
FT   gene            complement(685623..686738)
FT                   /locus_tag="Bphy_3732"
FT   CDS_pept        complement(685623..686738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3732"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3712 putative glycosyl transferases group 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72867"
FT                   /db_xref="GOA:B2JN19"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN19"
FT                   /protein_id="ACC72867.1"
FT                   /translation="MAFAINGKFTSQPITGVQRVAYELTRAMQMRESPGSELEIFVPQN
FT                   AREPGASLKRQRRFPWLRGTLWEQITLPIAARGRTLVNLCNTNPVLKRRQVVMVHDMAV
FT                   YDMPHGFSKKFLLWYRLCFSILPRMEPLVLTVSAFSKRRISHHLKIDESRIAVIQPGAD
FT                   HLDRVVPESGVLERLQLKEDTYCVIVGSLDPRKNLQRVLEAISGLSHLRDVKFVIVGGR
FT                   NQRIFANEGLETMSRSKQVIWAGFVSDGELKALYQHAGCLVFPSLYEGFGLPPLEAMYC
FT                   GCPVIASSRTSIPEACGDAAMYCDAMSVADMAEKISLMMTHSAIRQQYRAKGMAHAREY
FT                   RWDRSAKRLLDLLYGKESEPVSEMSARVSAG"
FT   gene            complement(686800..689142)
FT                   /locus_tag="Bphy_3733"
FT   CDS_pept        complement(686800..689142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3733"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: bam:Bamb_6487 hypothetical protein; TIGRFAM:
FT                   capsular exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72868"
FT                   /db_xref="GOA:B2JN20"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN20"
FT                   /protein_id="ACC72868.1"
FT                   /translation="MIPVDYFPSNSLPVAPEVERGQLTGREMLNLMRDHIWEIVAATVV
FT                   VFLLAVAYQLIATPIYSADVLVRVDPPEPNALGLALQNQEQLPPPAPSPSTEMGVMRSR
FT                   SVLDPVIDKYRFDVSVKPRRLPILGDIADKFATPGEPNGAWLGLKSFAWGGEVVKFGYL
FT                   NVPQGLEEEKLSLVALGNGAYELLGPSGEFLVKGTVGTPAEGNGVSVMISQLAARPDTR
FT                   FEVIRWNEVDATKRFMDVVKITDKVKDSGLIQIEYSDKSPAKAAEVANALGQQYLASAI
FT                   ASRQVNDTQTLSFIKGELPRLLADLRKSEEALKTFRAKANSMQPTAEAQSYLQGGLDLD
FT                   KQIASLELQRTQLLDKYAPGSRWIQSIDAQLAQLKKTKSEFDGRFQGMPASERESVDLI
FT                   RAQKVAETVYMGMVQKAEQLTVRRASTTGGAHILDTAVRPHRPVKPDPLIVLPGGFVLG
FT                   LVSGVFLVFMRRHVLVGVTDPRYVERRLSVPVIGEVLFSHQQSLLDRSLPASARKPLQG
FT                   APGRNAVSVQRSTDGGDTSPDEKIDPSFGYSGNKILAERFPHDSSVEALRAVRTAMARD
FT                   LAHTRNNIVMVTGPTTSAGKSFVAANLATLHAEAGARVALIDADMRRGHLAAFFSQSNR
FT                   GGLSEVLAERMPLRDAMRNVGIENVTFMSCGARPENPAALLTRPRFREVLSRLSNHFDL
FT                   VIVDTPPFLAVTDASIIANEAGASLLVLRSGMQTEEEIADTVKKIERAGGRVAGAVFNG
FT                   IPLRRSTKNYGYATNYASDFGDVETTA"
FT   gene            690084..691121
FT                   /locus_tag="Bphy_3734"
FT   CDS_pept        690084..691121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3734"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reh:H16_A1853 transcriptional regulator,
FT                   AraC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72869"
FT                   /db_xref="GOA:B2JN21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN21"
FT                   /protein_id="ACC72869.1"
FT                   /translation="MNGIYQSHPLRADERPENSKLRKHIGLLIAPHCSMAAAGAISDAF
FT                   CLANKLEEELGVDAPYRFTVLSEGGGFVTGGASFPIWTQKLDRYQLSDFHAFFVACSGD
FT                   PTTESSEQLVAWLSRQGPGAPACTRQKTDLSSGSVQSAVPVFVLDDGLSATRPAGATPT
FT                   EMALVQIERDVSPDTVRRIAHSLQPHVRQRMRPDADDLSSATTTEKIRESARWIRENYS
FT                   KTISVSQAADSAAMSKRNYQRRFKVEFGMTPLEYLLRTRFEVVCSMLMDTDLPIDKIAR
FT                   RCGMGDGNRLGRIFKVRYGMSPTSFRALRHLGNANHGAPVPPAAANCRALQPTAAASSL
FT                   MKSAY"
FT   gene            691143..692159
FT                   /locus_tag="Bphy_3735"
FT   CDS_pept        691143..692159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3735"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spe:Spro_2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72870"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN22"
FT                   /protein_id="ACC72870.1"
FT                   /translation="MPTSEYAQADEQIRASIVGAEAAVPPANRAIRELPEDAVLKGPVP
FT                   SQSAMRRMKEKVKLMLPDTLFLSLLHRKCIGRYPRLSNPATFNEKILQRNLRPDPRYVR
FT                   LTDKLTVREYVASKLGEEHVVPLIAAPDAFTREVFDSLPDAFVMKANHGSTFVEIVRNK
FT                   SETTFEKLQQLAERWLSTSFYWVARERHYRRIKPRIFFEELLLDRNGHIPADFKIHCFN
FT                   GHSGHPLMYILLISDRFGNNTHGDVFDEQWRRLDVMIGPYTRSPSPPPRPENLEAVLKT
FT                   ASILARDFDYVRVDLYAPDNRVYFGELTFTPGAGVLPFTPDRIDYEWGKLLSAEAEV"
FT   gene            complement(692231..693781)
FT                   /locus_tag="Bphy_3736"
FT   CDS_pept        complement(692231..693781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3736"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN23"
FT                   /protein_id="ACC72871.1"
FT                   /translation="MNKRRQFLGALTALGGSYILTACGGGGTDISAGAGDAVAKATARA
FT                   STSASGTTIPSATSIIDNAGNTWTLSGGSVYKNGAKAGNTYNVSLVLFMGGVIYHQGSG
FT                   GQFYAWNGSAWNACNDPRLGGTSPDGTTIPSASYIIDKTGAMWTVVGGVIYRNNKTVGN
FT                   TYNVSMLLWYGGKIWHKGTGGQFYVNTDVGGWLPCSDPRIATAATAGMFYGINGHFDYT
FT                   YTPAQLVSILNGMGCKSYRVGCTDDPKQIAAVTKLAQAFQPAGITLLVLINQGVYDSNG
FT                   VVFSSESAAYNRGQQVAMTVANALKPYGVTIYECGNELTRQNATVLDFTNAGTKAVDFN
FT                   NANWPAMRGAMRGMIDGVKAVQPSAKCGINFCVADIGAADALWDGMQPDGSGGHPKVRW
FT                   DITTWHNYEVYGDIFNIGIDGAGPGFDLPTYCKARYGVPFIITEWNTGPEKTQTYRASY
FT                   ITSTLGKYYQARKSHNIQAVMYYVLDSGNNTYGVMTNGTALNPPYSAFTSFVSGNADI"
FT   sig_peptide     complement(693707..693781)
FT                   /locus_tag="Bphy_3736"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.807 at
FT                   residue 25"
FT   gene            complement(694616..695662)
FT                   /locus_tag="Bphy_3737"
FT   CDS_pept        complement(694616..695662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3737"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_A3868 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72872"
FT                   /db_xref="GOA:B2JN24"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN24"
FT                   /protein_id="ACC72872.1"
FT                   /translation="MFVENNLQWIPHKHFSATSTTQRIAFILTDACDLLGIGAIAEALE
FT                   CACSLESSAAARKYEMQFLSERGGHIQCDRSMFVSTEELPDSSETRFARVFIAGGAQAR
FT                   EACDAPRVAAWLQRVRAQGAPVRFLAAGVETSDLGAAMGSDGIGGVASGYELARRRRAQ
FT                   LGSAVKAAFEVIRADFGESIAHEALRRIAFVDSTEWLSPSVDATNTAADRIRAAARWLQ
FT                   DNCHRSVSIADAAEACAMSQRTLLRNFQAHMGASPSEYLQRVRLERACQLLAETSLPAD
FT                   KVARRVGLTNGDRLGKLFRRCVGKSPTEYRVWARGTPDTPHACGESSGKAQPDHAPSAC
FT                   KEEKVALA"
FT   gene            complement(695762..697171)
FT                   /locus_tag="Bphy_3738"
FT   CDS_pept        complement(695762..697171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3738"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_B1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72873"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN25"
FT                   /protein_id="ACC72873.1"
FT                   /translation="MFDAALLRKSFAPTVRQTTSSSSGMSHRSVGVVPCSLVYIEADSA
FT                   GSPNCTSVDPYCYVEQAITLNRSLKAVGLPALTVATNVAGQVMHYLEKVDADARPHVVQ
FT                   LSPSALTLPKITRFYSAHFKLDMMEQLGATLHEGELLMVLDTDMLALRPVDEELLLRCQ
FT                   TIGVGAFDISDQEFSAYGDARVIGDLETVAGARLQNPRWFGGEILLASAGFIAALVPRA
FT                   HACFERYTHAIHELNHNGDEAFISAALNLLADEGVPIIDLGAHRVVGRHWSGNTHRDLR
FT                   WFKGCSLLHLPGCKRLLERQARRQGFSAAHVWRSVVVRHEINRTVWPLRRWVRAQVRHR
FT                   MRRGAAQPAARVDVLVLDPDAGRLSQLVSRLTSHGVYVMSALSTEEARNEARRLNPRVI
FT                   VSSSPLGAVDARDLLDTVDARHRPVMIALSTDDARLDWAHWDTWFPGSADPSDVVQAVK
FT                   QALGSRQPHAS"
FT   gene            complement(697445..699232)
FT                   /locus_tag="Bphy_3739"
FT   CDS_pept        complement(697445..699232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3739"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72874"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN26"
FT                   /protein_id="ACC72874.1"
FT                   /translation="MRFAVALAAHPYRFVHRVHSRAVDSFFMVKRREFLGMVTAVGGSY
FT                   VLTACGGGGGGSRTGQGNTSSASATGTSAASGTTAATTNTSTTQNGRTSSAVNGTSPTS
FT                   NGTTSGSSTDPNAGSNSGTVGSPNGTEVPPAASITDNQGALWTLAQGSVYRNGVAAGNT
FT                   YNVTLLLWYGNGIYHQGTGGQFYGWNGTTWLACNDPRLGGTSADGTTVPSASYIIDKMG
FT                   ALWTVSTNGMVLRNNAYAGATSNVSLLLWYGGKLWYRSTSGQFYVCTDLDQWLPCSDPR
FT                   IAVAATRGSFHGINGHYDYRYTAAQIVQIMQNMGCSTYRVGCTDDPVQLGAVTRLAQAF
FT                   QAAGLTLFVLVNLGVRDANGALFANESAAYTRGRACGANVAAALSQYGVVMYECGNELT
FT                   RDSAIILDSTNAGTKVADFSNANWPVMRGVMRGMIDGVKSAQANAKCGINFCVADIGAA
FT                   DALWDGKQPDGTSGHPAVRWDLTTWHNYEVYGDIFDIGTDGAGPGFDLPTYCKARYGAP
FT                   FLLTEWNTGPEKSQSYRANYISARYATYYQARTTKNIQSVMYYELDSGDATYGVMIDGV
FT                   TLNLPYNALVSFVASHPDS"
FT   gene            699765..700820
FT                   /locus_tag="Bphy_3740"
FT   CDS_pept        699765..700820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3740"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bvi:Bcep1808_6193 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3740"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72875"
FT                   /db_xref="GOA:B2JN27"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JN27"
FT                   /protein_id="ACC72875.1"
FT                   /translation="MTSSANIATDSPANTDVLIIGAGPVGLFAAFEAGVIGLSSVIVDN
FT                   VERAGGQCIELYPDKPIYDIPAIPSCTARELVDRLLEQCRPFAPPLHLGHRVDTVEQLD
FT                   NGRWLARTDKGLTVESAAILIAAGNGSFVPQRLQLDDAAPLEGHYVHYSVSNLADFAGK
FT                   KMVVAGGGDSALDWALALRTVAQHVTLVHRRNGFSATDSSVANMRRAVEAGEMNFAVGT
FT                   IASLNAPGGQLESIELRQAEGSVQLATDHLLVLFGLVADLGPIQQWGVEVRGGRITVDT
FT                   SNYESSRPGIFAAGDIAGYPNKQKLILSGFHEASLALRKAYSYAYPDKKRVHIHSSYDA
FT                   KLAERVAASHT"
FT   gene            700896..702161
FT                   /locus_tag="Bphy_3741"
FT   CDS_pept        700896..702161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3741"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC3280 possible surface protein,
FT                   responsible for cell interaction; contains cell adhesion
FT                   domain and ChW-repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72876"
FT                   /db_xref="GOA:B2JN28"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN28"
FT                   /protein_id="ACC72876.1"
FT                   /translation="MSEMPPSSTNAAAEDPPASMWRRMTPWAMGGAVVLLLIVLFVAFN
FT                   PTRKSPDERALSELGFIKGTCSDSGTSTAKTESTCLALRAQPTLTASQVAAAVPHLKDS
FT                   DRNIELNLANTQIDNLDALKELDTLESLDLTGTPIWNIDALKDMHSLKRLVLHRTEVEN
FT                   IAALKGLTGLQSLTLWDTRVSNLDALKSLTDLRQLDLRDTQVRDLDPLEDLPRLDTLKL
FT                   GGARNVRDIDALGQLTSLKTLDLNETQVDSIKPLKKLRDMQALYLANTPLRDIDAIKNM
FT                   PSLKTLVLDGSRVDDIDGVRGLQQMDTLVLARTQIANIDALKGLTGLQRLNLADTRVDN
FT                   IDALRDLKNLRMLNLFRTRVRNVDALRGLTNLQELYLANTPIDDVDVLKGLSGLRELVL
FT                   YGTKARNVDDLKAALPKTRIVW"
FT   gene            702300..702578
FT                   /locus_tag="Bphy_3742"
FT   CDS_pept        702300..702578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3742"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72877"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN29"
FT                   /protein_id="ACC72877.1"
FT                   /translation="MLNWLANLISHHAPTPEKQAERALSELRMGLFQAEQRVLDAQLQA
FT                   DYYRSRIAFCEQVAKGGIEQVSDRRRSPPQEAAVDTLRPSLKLTAAQ"
FT   gene            complement(702658..702822)
FT                   /pseudo
FT                   /locus_tag="Bphy_3743"
FT   gene            702982..704412
FT                   /locus_tag="Bphy_3744"
FT   CDS_pept        702982..704412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3744"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B1202 major facilitator superfamily (MFS) multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72878"
FT                   /db_xref="GOA:B2JN30"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN30"
FT                   /protein_id="ACC72878.1"
FT                   /translation="MNDSSRSASLGPLPYVVAATFFMEYLDTTIIATALPQMAQSFRTS
FT                   PNALSLGMSAYMIALAIFIPASGWVADRFGSRSVFFSAIVTFTLASLLCGISQNVAEFT
FT                   AARVLQGIGGALMVPVGRLTVVRSIDKKQLMQAISTITWPGIVAPVIGPPVGGFITTYA
FT                   SWRWIFLLNLPVCLAVLVAVLKWVPNLRSAERRPFDALGLVLSALTLTAILYGADMASQ
FT                   PDTNPFVALGVLAIGLAFGCVAFCQARRHRHPLIDVSTLKIPTFSVTVVTGTITRIGIG
FT                   AVPYLMPLLFQIGFGLSAFKSGLLLLVSATGNLGMKALTTRILQRYGFRRVAIAASATC
FT                   GVFTILCGVLTPDSPLAWVLVVVFIYGLGRSLQFSTLATLAYADVPSQQTSAANTLWNA
FT                   AAQMSIGLGIAFGAVALRAASVVNGNDMGDSRSHTPIFTLGDFRLAFLCAGVLTIMSIY
FT                   GYVKLAHDAGNRLRAVSN"
FT   gene            704510..704758
FT                   /locus_tag="Bphy_3745"
FT   CDS_pept        704510..704758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3745"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72879"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN31"
FT                   /protein_id="ACC72879.1"
FT                   /translation="MKENELDKRFPEDPMWNVAQAIEGCVRAIRTARGKLNPEDCTPGT
FT                   LQYEAVTMDFIDDCIRSLGGDPDAEDDVDDFGIGAAG"
FT   gene            complement(705058..705732)
FT                   /locus_tag="Bphy_3746"
FT   CDS_pept        complement(705058..705732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3746"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_PF00545 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72880"
FT                   /db_xref="GOA:B2JN32"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN32"
FT                   /protein_id="ACC72880.1"
FT                   /translation="MSNQQTRSHAATATGRAKAVDMKLEVVVIPVSDVDRALQFYAGLG
FT                   WRLDVDIVRGDDFRVVHFTPMGSSCSILFGKGVTAEEPGSVQGLHLIVSDVEAARAELI
FT                   GRGVAVSEVFHDIGGVFHHAGEDGRVSGPHPERKSYGSFASFNDPDGNGWVFQEVTARL
FT                   PGRVDADATTFVSAADLAGALRRAAAAHGEHEKRTGEHDENWPDWYADYIIREQTGDSL
FT                   PT"
FT   gene