(data stored in ACNUC7421 zone)

EMBL: CP001045

ID   CP001045; SV 1; circular; genomic DNA; STD; PRO; 1904893 BP.
XX
AC   CP001045; AAUG01000000-AAUG01000055;
XX
PR   Project:PRJNA17409;
XX
DT   23-APR-2008 (Rel. 95, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 5)
XX
DE   Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence.
XX
KW   .
XX
OS   Paraburkholderia phymatum STM815
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Paraburkholderia.
OG   Plasmid pBPHY01
XX
RN   [1]
RP   1-1904893
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   "Complete sequence of plasmid1 of Burkholderia phymatum STM815";
RL   Unpublished.
XX
RN   [2]
RP   1-1904893
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Bruce D.,
RA   Goodwin L., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S., Shin M.,
RA   Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Bacher J., Blanchard J., Cohan F., James E., Lawrence J.,
RA   Lizotte-Waniewski M., Moulin L., Rainey P., Riley M., Souza V., Wertz J.,
RA   Young P.;
RT   ;
RL   Submitted (11-APR-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 516c1626c8992ccba9c57360d95ff795.
DR   BioSample; SAMN02598384.
DR   EnsemblGenomes-Gn; Bphy_R0081.
DR   EnsemblGenomes-Gn; EBG00001013653.
DR   EnsemblGenomes-Gn; EBG00001013655.
DR   EnsemblGenomes-Tr; Bphy_R0081-1.
DR   EnsemblGenomes-Tr; EBT00001536799.
DR   EnsemblGenomes-Tr; EBT00001536801.
DR   EuropePMC; PMC5732942; 29312183.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   StrainInfo; 302139; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002725
CC   Source DNA and bacteria available from Michelle Lizotte-Waniewski
CC   (mlizotte@bio.umass.edu)
CC   Contacts: Michelle Lizotte-Waniewski (mlizotte@bio.umass.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1904893
FT                   /organism="Paraburkholderia phymatum STM815"
FT                   /plasmid="pBPHY01"
FT                   /strain="STM815"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391038"
FT                   /type_material="type strain of Paraburkholderia phymatum"
FT   gene            complement(644..4231)
FT                   /locus_tag="Bphy_5543"
FT   CDS_pept        complement(644..4231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5543"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="KEGG: reh:H16_B1980 indolepyruvate ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5543"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74619"
FT                   /db_xref="GOA:B2JU97"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JU97"
FT                   /protein_id="ACC74619.1"
FT                   /translation="MNAPDRAVTSEQSDPLNVTLDDKYTLEKGRVYISGTQALVRLPML
FT                   QKARDLKAGLNTAGFISGYRGSPLGALDQSLWKAKKHLQANDIVFQPGVNEDLAATAVW
FT                   GTQQINLWPGATRDGVFGMWYGKGPGVDRTGDVFRHANSAGSDARGGVLVLAGDDHAAK
FT                   SSSVAHQSEHAFIAAGIPVLYPANVQEYLDYGLHGWAMSRYSGLWVAMKCVTDVIESTA
FT                   SIDLDPDRVDIVTPTDYAMPAGGLNIRWPDAPLAQEARLLDEKWYAALAYIRANRLNRV
FT                   VIDSDKPRFGIITAGKAYLDVRQALSDLGLDDDTCARIGLRVLKVGCVWPLDAQDARAF
FT                   ATGLEEILVVEEKRQILEYALKEELYNWREDVRPKIYGKFDERDNEGGEWSVPRGDWLL
FT                   PAHYELSPALIAKAIARRLARADLPKDVRARMLARVAIIEAKEREAAKPRVAVERKPWF
FT                   CSGCPHNTSTRVPEGSRALAGIGCHYMSMWMDRKTETFSQMGGEGVAWIGQMHFSGDRH
FT                   VFVNLGDGTYFHSGLLAIRAAIAANANITYKVLYNDAVAMTGGQPVDGVLTVPQIAHQV
FT                   HAEGAKRVVIVTDEPQKYRTGIVLPAGVDVHHRDQLDTVQRTLRDIPGTTVLIYDQTCA
FT                   TEKRRRRKRGTYPDPARRAFINDAVCEGCGDCSEQSNCLSVEPLDTPLGTKRKINQSSC
FT                   NKDFSCVNGFCPSFVTAEGAQLRKPKAAGGDKSAGAGKIDFDALPAPSLPALAKPYGIL
FT                   VTGVGGTGVVTIGGLIGMAAHIEHKGVTVLDMAGLAQKGGAVLSHVQLASAPEALHATR
FT                   IATGEARLVIGCDAIVSASNDVLSRTQHGVTCAAINSGATPTAEFVKNPKWTFPGTQTE
FT                   AELRDSIGDGCAFIDANALALTLLGDTIYSNPLLLGFAWQKGWLPLQLSSLLRAIELNA
FT                   VSVEKNQQAFNWGRYIAQHGDDAVRALGKPAAAPQAIVMRIPESLDHLIASREALLKSY
FT                   QNEAYARKYRRVIDGIRAKEMEFGGDSKLPLTRAIATNLAKLMAYKDEYEVARLYADPA
FT                   YLEKLRQQFEGEPGRDYKLSFYLAPPLFAKRDERGHLQKKRFGPWMLPAFRVLARMKGL
FT                   RGTAFDVFGKTVERRGERQLIAEYIALVDEFCATLTSDRLAVALQLACLPDDIRGFGHV
FT                   KERNLQAAAKKKERLLADYRTPERLTANA"
FT   gene            4334..5239
FT                   /locus_tag="Bphy_5544"
FT   CDS_pept        4334..5239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5544"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0362 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74620"
FT                   /db_xref="GOA:B2JU98"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JU98"
FT                   /protein_id="ACC74620.1"
FT                   /translation="MAFDLTLRQLRYFAAAAQTGNFSMAAANEHVSQSAITNAVLALES
FT                   GLGTRLFERLPQGVALTPEGQDFYNHARRVLDAARDAVHKPPFRSHDMRGTVRIAASYT
FT                   VLGYFLPELLARFRATYPFIEFDLRDMERVDIERAVHDGDVDIGVVLLSNIEKLSRFGS
FT                   QVLIRSRRQLWVAPSHPLALVDAPSLKDIAAHPYILITVDEGEQSTLRYWKKKGIAPNI
FT                   AFRTSSMEALRGLVAHGFGVTVLSDMVFRPWSLEGNRIEARPVLDAVPQMDAGMIWQKG
FT                   AQLNSPATALQQFLIHACGT"
FT   gene            5811..7349
FT                   /locus_tag="Bphy_5545"
FT   CDS_pept        5811..7349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5545"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bch:Bcen2424_6681 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5545"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74621"
FT                   /db_xref="GOA:B2JU99"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2JU99"
FT                   /protein_id="ACC74621.1"
FT                   /translation="MKVAIKLMLIVGTALAGVIAIAAVSLIQLDQALTESRTAQIKTLL
FT                   TKAEHLVLYYQGLEASGKLSREDAQAAAKTALSQLNANSQSYFWVTNTDSVNIVHPNPK
FT                   LIGTKAGGNKTRSGDLTDTQAYRQGLARDHFAMVDVLIKRSADGPLEAKLQGVVEIPGW
FT                   QWWIGTGFFYDDINATYWTLARTLIAISLVIFIAVGCMAWVMTRSLKRELGGEPAEAAA
FT                   FAAHIASGNLTANLKLTSSDRSSLLFALGEMRTKLIDLVRGIQGTSESIATGAGEIAQG
FT                   NIDLSQRTEEQAASLQETAASMEQLTATVKQNADNVQQASELAVLATEATRRGGQAVEE
FT                   VINMMQGIADGSNKIGEIIAVIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVRA
FT                   LAQRSATAAKEVKALIQSSAVRVDEGTTQVTVAGQRMHEIVQSIQRVSDIMNEIAAASV
FT                   EQSTGIEQVNRAVSQMDEVTQQNAALVEQAAAAATSLDEQAGRLREMVGAFRLR"
FT   sig_peptide     5811..5879
FT                   /locus_tag="Bphy_5545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.940 at
FT                   residue 23"
FT   gene            complement(7346..7696)
FT                   /locus_tag="Bphy_5546"
FT   CDS_pept        complement(7346..7696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5546"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74622"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA0"
FT                   /protein_id="ACC74622.1"
FT                   /translation="MRASIFCVIFAIFVCGFAVTSCDDSADDAVDDAVDSDRADYVAPT
FT                   TCMERLYYPLGLRTVALADFCYGAGGLQVLHDHYRFSFSYANVIDTGTTLPVEKLALGG
FT                   TRSSARDDKSDH"
FT   sig_peptide     complement(7631..7696)
FT                   /locus_tag="Bphy_5546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.671 at
FT                   residue 22"
FT   gene            complement(7836..8864)
FT                   /locus_tag="Bphy_5547"
FT   CDS_pept        complement(7836..8864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5547"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pae:PA2320
FT                   transcriptional regulator GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74623"
FT                   /db_xref="GOA:B2JUA1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA1"
FT                   /protein_id="ACC74623.1"
FT                   /translation="MATSTPRKTRSTGRPTLDAVAELAGVSSITASRVLRGVGSVGPEY
FT                   VQRVKAAAAELHYVTNPAARALASSRSGSVAVVIPSLSNTVFVDVLESIHNVLRPRGYE
FT                   ILIGNSHYSRNAEEDLIRHYLASPPSGLIVTGFDRTESARRLIEASGVPCVHIMELEKA
FT                   EGVHCVGFSQARAGEAVADHLIARGCRRNAFVAAQLDSRMMQRGEGFREALRRKGLYDP
FT                   ELEVLTPAPSSIGLGCDLFRQLLQRRPDVDGIFFGNDDLAQGALFEARRQGIDIPDQVA
FT                   IVGFNDLAGAADCVPRLTTVRTPRAEVGRVASNLLLSMIDNKPVASPVVDLGYELVVRE
FT                   SA"
FT   gene            9009..9551
FT                   /locus_tag="Bphy_5548"
FT   CDS_pept        9009..9551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5548"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: pfl:PFL_4580 gluconokinase, putative; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74624"
FT                   /db_xref="GOA:B2JUA2"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA2"
FT                   /protein_id="ACC74624.1"
FT                   /translation="MIKHISSLVVMGVAGCGKSSVAQALAARIGGVLIEGDAFHPQANV
FT                   DKMARGIPLTDEDRAGWLDRLSDEIERVANGGQRAVLACSALKQRYRNRLRTATASLGF
FT                   IFLDLPPAEALRRVAQRESHFMPASLVESQFATLERPVAEPLTLTVDGTLSLASIVREA
FT                   AAWCGTTQAHLNYLQPV"
FT   sig_peptide     9009..9077
FT                   /locus_tag="Bphy_5548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.499 at
FT                   residue 23"
FT   gene            9617..10969
FT                   /locus_tag="Bphy_5549"
FT   CDS_pept        9617..10969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5549"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cvi:CV_2958 D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74625"
FT                   /db_xref="GOA:B2JUA3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA3"
FT                   /protein_id="ACC74625.1"
FT                   /translation="MANTSEDSGKRIPNRRWVIGLLLGIGVLINYFDRINLSVAAPQMK
FT                   EAFNLSPADMGLLFSAFFWPYALLQVPAGLFLDRYGVTRVGRWGAFLWGLASAITVFAS
FT                   GFGGVFAARAVLGIAEAPGFPVSSKATGYWFPRKERALATAIFDAAAKFSNVIGVPLVA
FT                   VVVVNAGWRWGFGVTALLSFAYFVAFLLIYRDPSKDGKLSPVELDYIQKGGATPEGTSS
FT                   ASVFGMLGYLLTKTKVWGLTIGFAAYGYSFYLFLTWLPGYLVQTMHMSILKSAGFAAIP
FT                   WAVATVTDLVVGGWLIDHLIARGKDETRVRKAVLVTGMLFGLAVFGATQTVNPGWAIFW
FT                   ISIALGGLAAAAPVGWSLPSLIAPKGGVGTVGGIMNFANNLMGVAAPIVTGFIVGATNS
FT                   FTNAFLVAGVILAVGIVSFVFVMGRIEAIPEPTDRDEDARRTTSKTSTPAG"
FT   gene            11066..12295
FT                   /locus_tag="Bphy_5550"
FT   CDS_pept        11066..12295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5550"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_C7566 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5550"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74626"
FT                   /db_xref="GOA:B2JUA4"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA4"
FT                   /protein_id="ACC74626.1"
FT                   /translation="MKKNRQRRLIGLAAVASVATAAHAPAFAQNSVTLYGIVDNGIGYQ
FT                   SSSTTLGSTSGGHSAFKMITGVWAGSRFGLKGAEDLGGGTKAIFTLEEGFSANSGAMST
FT                   TNLMFSRQAFVGVTNPAYGTLTAGRQYASYYQLLSPYSPTTWLTGFYGAHPGDVDGLDT
FT                   IYRANNTLLYMSPSMSGFKFSGSYSFAGVPGSVYQGSTWSTAVQYQQGPVGLAVGFSRI
FT                   NNATAGGGAFSADSATSNAGAQTGVSAVTNGYRTAQAQQRFAVGAGYAFNSQFDITATY
FT                   TNVQYIPGAGSSFHNEAIWNTGGIVLHWKPAAAWDFATGYSYTRATKSNGITSSAQYQQ
FT                   FNLSEYYSLSKRTGLYALQAYQRANGQTLGNNGAGNIINATATLGDGFNSTPSSSRSMV
FT                   GVGVGVVHRF"
FT   sig_peptide     11066..11152
FT                   /locus_tag="Bphy_5550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(12617..13294)
FT                   /locus_tag="Bphy_5551"
FT   CDS_pept        complement(12617..13294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5551"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74627"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA5"
FT                   /protein_id="ACC74627.1"
FT                   /translation="MKKCFVVSAIAAALLTAGCATVAPMSPTTSMSSVDTAKNSYVLMT
FT                   VTLKNNYHTSYQPSPIVVNMERGAADTRQDRLNFKFDDDRTGTADAGGHYFVRLPLAPG
FT                   KYVMRGITGQSGIFPFHGMFFTPLHEVVDVKPNSIVYVGHIDATVVERKDGELRAGPMI
FT                   PLLDQAATGFSGGTWDISVSDQFDSDIAAFKKDFPALSNASIDREVLPAWDKQKATEWW
FT                   ASH"
FT   sig_peptide     complement(13196..13294)
FT                   /locus_tag="Bphy_5551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.485 at
FT                   residue 33"
FT   gene            14145..14597
FT                   /locus_tag="Bphy_5552"
FT   CDS_pept        14145..14597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5552"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bvi:Bcep1808_5654
FT                   UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74628"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA6"
FT                   /protein_id="ACC74628.1"
FT                   /translation="MYPRIMVAIDGSDTSKLALDEAIRIAKAGPSNVLAVLVFESEAEV
FT                   VGYGGLVIPNSQVEELRATALSILGEAKETLDQNGVAGGGELIEKPSEKIDIATLLQQQ
FT                   AERWEANLVVLGTHGRRGLQRMVIGSVAESFVRQSNCPVLLVRGKG"
FT   gene            14922..15254
FT                   /locus_tag="Bphy_5553"
FT   CDS_pept        14922..15254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5553"
FT                   /product="ABC-type metal ion transport system periplasmic
FT                   component/surface antigen-like protein"
FT                   /note="KEGG: bxe:Bxe_B0852 ABC methionine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74629"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA7"
FT                   /protein_id="ACC74629.1"
FT                   /translation="MLRRPPFHAPLITSRPQLERGDDSSCNPPRQIDALKIAAQGAEQQ
FT                   RLDAKIIEFTDWNTPNPALANKDIDVNYFQPIPFLENAKKPFSHCCATSTGVSVSRSCS
FT                   SRTKWK"
FT   gene            complement(15377..16732)
FT                   /locus_tag="Bphy_5554"
FT   CDS_pept        complement(15377..16732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5554"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG: nwi:Nwi_2853
FT                   Na+/H+ antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5554"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74630"
FT                   /db_xref="GOA:B2JUA8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA8"
FT                   /protein_id="ACC74630.1"
FT                   /translation="MQRDQPADTLSRPLRIAQKAFTALEHFLHVEAASGIVLLVAAAGA
FT                   LIWANSPFAHSYNSLWEMPLTFGAGDFVFSRPLHFWINDALMTIFFLVVGMEIRREIHE
FT                   GSLSDVRQAALPLAAAMGGVAAPALIFLAMNHGTAAANGWAVPTATDIAFAVGVLALLG
FT                   RNVSSGVRIFLLTLAIVDDIIAVLIIAAFYSRGLDYSGFALAAAGIGGVLLMQRLGIGT
FT                   APAYIMPGAIIWAGLLISGAHPTLAGVILGLLVPVTPTSRRERVLVELSRATHDVNSAS
FT                   NQQEDRHRAERLAKPLQTLRLAQRELLPPVVRVQWALHPWVAYGIMPLFALANAGVTLD
FT                   GIDLSQHDARWIAAGVTLALVAGKPLGVFCVTWVLVRLKLCRLPKDVSWSGVGLIALLA
FT                   GIGFTMSIFIATLAFGDDNALNVAKLGILAGSFVAGAVGLGWGVIGARRRAN"
FT   gene            17165..18850
FT                   /locus_tag="Bphy_5555"
FT   CDS_pept        17165..18850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5555"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: smd:Smed_1239 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5555"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74631"
FT                   /db_xref="GOA:B2JUA9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUA9"
FT                   /protein_id="ACC74631.1"
FT                   /translation="MQLPTFLAGLARPVTRAPFALVAASLLSVSVSGQAQTDSQQTQKP
FT                   NILLIVGDDVGWGDLGAYGGGEGRGIPAPNLDRLADEGMTFFDFYGQPSCTPGRAALQT
FT                   GRNPNRSGMTTVAFQGQGGGLPHAEWTLASVLKLAHYNTYFTGKWHLGEADYALPNTQG
FT                   YDDMKYVGLYHLNAYTYADPKWFPDMDQQTRDMFVKVTTGMLSGKAGQKAHEDFKVNGQ
FT                   YQNEPEKGVVGIPFVDAYIEKAALEDIDDAAQRGQPFFINVNFMKVHQPNLPHPDYIGK
FT                   SLSKSKYADSIVELDARVGHIMDKLREKGLDKNTLVFFTTDNGAWQDVYPDAGYTPFRG
FT                   AKGTDREGGARVPAIAWWPGKIKPHSRNFDIVGGLDCMATFAALAGVDLPKNDREGKPI
FT                   IFDSFDMSPVLFGTGKSKRNSWFYFTENEMTPGAVRVGQFKAVFNLRGDAGADTGGLAV
FT                   DSNLGWKGPDKYVATVPQVFDLYQDPQERYDIFMNNYTEHTWTLPTFGAAVKELMQSYV
FT                   KYPPRKAQSEAYSGPITLSQYERFKYIRDELQKNGFSIPMPSGN"
FT   sig_peptide     17165..17272
FT                   /locus_tag="Bphy_5555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.568 at
FT                   residue 36"
FT   gene            18932..19996
FT                   /locus_tag="Bphy_5556"
FT   CDS_pept        18932..19996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5556"
FT                   /product="putative nonspecific acid phosphatase, NapD-like
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A2133 putative nonspecific acid
FT                   phosphatase, NapD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5556"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74632"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB0"
FT                   /protein_id="ACC74632.1"
FT                   /translation="MRTVEPRTTSSRMLNRVAVFLVCACLALAGCAEHGASTADTKRTI
FT                   SSERSAAVLPSWQDGAARAAILKFVGDVTREGTATYVPPDARIAVFDNDGTLWSEQPLP
FT                   FQLSFMIEKLKAAAPQHPDWQRNPAYKALLAHDTAALAQNKKGLLQMLAIANSGMTTDE
FT                   YDRSIRQWLSTAEHPTLQRPYPQLVYQPQLELLDLLRANGFRIWIVSGGTAEFMRVWAS
FT                   EAYGIPPEQIVGTEEKLAYQVRDGRPALVRQPGFDFVDDGPGKPVGIFRAIGRRPILAF
FT                   GNSDGDREMLEYTASGPGATLALLLHHDDAGREFAYDRQSALARLDKAWDEALSRGWVV
FT                   VSMKNDWKAVYRTQ"
FT   sig_peptide     18932..19039
FT                   /locus_tag="Bphy_5556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.604 at
FT                   residue 36"
FT   gene            20048..21333
FT                   /pseudo
FT                   /locus_tag="Bphy_5557"
FT   gene            21355..22125
FT                   /locus_tag="Bphy_5558"
FT   CDS_pept        21355..22125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5558"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74633"
FT                   /db_xref="GOA:B2JUB1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB1"
FT                   /protein_id="ACC74633.1"
FT                   /translation="MAAFVDHPAILFVALLALFIGAVVFGAFVLRHALPLPTDERDDFN
FT                   LVQTSTLTLLALLIGFSLSMAVSRYDTRKNLEENEANAIGTEYARADLADTPLSTEMKA
FT                   ALVQYTRLRLAHFRTREPHEIASNESKTADLQAELWKMATKVAKATPTPIAATIVTGMN
FT                   DVLNSQDYSEAALINRIPIGTWCLMIVIALFGCVIQGYGAKGRLRRGLLITILPVTVAL
FT                   SLTLIADIDSPRGGIIHVQPQNLVRLLHSLGSES"
FT   sig_peptide     21355..21435
FT                   /locus_tag="Bphy_5558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.469 at
FT                   residue 27"
FT   gene            complement(22209..22985)
FT                   /locus_tag="Bphy_5559"
FT   CDS_pept        complement(22209..22985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_C6032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74634"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB2"
FT                   /protein_id="ACC74634.1"
FT                   /translation="MMDDPESLSLALPDGTKVSALLRVPEDARALYVFAHGAGAGMQHA
FT                   GMSSLADALAAANVATLRYQFPYMERGSKRVDSPAVAHAAVQAAVAEARRRLPALPLFA
FT                   GGRSFGGRMTSQAQAISPLDGVRGLAFVAFPLHPAGAPGVERARHLTHVTVPILFLQGT
FT                   RDKLAELPLLRSVVETLGPRATLHVVDDADHSFHVRASSGRTDAEVVLELARNACSRVG
FT                   TASRRSRRAALARSFPSLSADGRSHSHNKRRLSRQR"
FT   gene            23476..24297
FT                   /locus_tag="Bphy_5560"
FT   CDS_pept        23476..24297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5560"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: lpf:lpl0179
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5560"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74635"
FT                   /db_xref="GOA:B2JUB3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB3"
FT                   /protein_id="ACC74635.1"
FT                   /translation="MHGRDAQRFVTAKRLSNIQSCLRSALQDAVDDEVLESNPLAGFTF
FT                   TRNEPPRDADHADPLDAQEQAAVIAAARVPQIANLWQFLMWTVLRTSEVIALKWSDVDW
FT                   LRETVQVRKAITRAAKGVAEDTKTLSGRRDVKLLAPAMAALMAQKEYTFVAGEEIFNRP
FT                   SWRGREGGPWRHDHQIWDAWKTTLKDAKVRYRNPYQTRHTYASMMLSAGERKIWVANQM
FT                   GHSDTTSIKRNYGRWIPNSDPQAGSRAVELFAPENAGKFAGKKSGKQAKTG"
FT   gene            complement(24345..24429)
FT                   /locus_tag="Bphy_R0081"
FT                   /note="tRNA-Leu1"
FT   tRNA            complement(24345..24429)
FT                   /locus_tag="Bphy_R0081"
FT                   /product="tRNA-Leu"
FT   gene            complement(24543..24815)
FT                   /locus_tag="Bphy_5561"
FT   CDS_pept        complement(24543..24815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5561"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74636"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB4"
FT                   /protein_id="ACC74636.1"
FT                   /translation="MAEADNERSTDDRIRERAYHLWERDDDPKRHADEYWDTARRQIEA
FT                   EGMDGPAVEPPIEQSDKRQIESEDPQEASAASGEAAGKPRAKRTR"
FT   gene            complement(25127..27529)
FT                   /locus_tag="Bphy_5562"
FT   CDS_pept        complement(25127..27529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5562"
FT                   /product="membrane-bound PQQ-dependent dehydrogenase,
FT                   glucose/quinate/shikimate family"
FT                   /EC_number="1.1.5.2"
FT                   /note="KEGG: bxe:Bxe_C0173 putative glucose dehydrogenase
FT                   (PQQ-dependent); TIGRFAM: membrane-bound PQQ-dependent
FT                   dehydrogenase, glucose/quinate/shikimate family; PFAM:
FT                   Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5562"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74637"
FT                   /db_xref="GOA:B2JUB5"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB5"
FT                   /protein_id="ACC74637.1"
FT                   /translation="MKDESKAGTPSLGIGRWLSVLFAVLSGLYLLIGGVWLVAIGGSPY
FT                   YIVAAIILLVVAWLIYRGTGLALLLYALLLIGTVIWAVFEAGFDFWALAPRIDILVLFG
FT                   IWLLLPFVYRRLDASARRGAAALAVCLVLTGIALAYAAFNDPQELNGKVSQNSGVSPTQ
FT                   PDSHPGDWTAYGRTQAGTRYSPLAQINQDNAKDLQVAWTFQTGDKKGPNDPVEITNEVT
FT                   PLKVGALLYLCSPHQILFALDAATGKEKWRFDPGLKPDPSFQHVTCRGVSYHETTAAAA
FT                   AKDAAAQSALPACSRRVILPVNDGHLFELDAATGQRCTGFGNNGDLDLQHLQPVKTPGQ
FT                   YEPTSPPVVTDKIIVMAGAVTDNYSNHEPSGVIRGFDVESGRLVWAFDPGSDTPNTIPD
FT                   DQHAYTVNSPNSWAPAAYDSKLDLVYLPMGVKTPDIWGGDRTPQYERYASGLLALHAST
FT                   GKLAWFYQTVHHDLWDMDLPAQPTIADITDRNGNIVPAIYTPAKTGNIFVLDRRTGTPI
FT                   VPAPEQPVPQGAAKGDHVSPTQPFSQLTFRPQKNLTDADMWGATMYDQLACRVMFHRLR
FT                   YEGTFTPPSEQGTLVFPGNLGMFEWGGLAVDTDRQLAIANPIALPFVSRLIPRGPNNPL
FT                   EPPASGSGGTGTETGIQPQYGVPFGVTLNPFLSPVGLPCKQPAWGYVAALDLKTNQVVW
FT                   KKRIGTVRDSAPVPLPFKMGMPMLGGPMTTAGHVFFIGATADNYLRAYSTDTGEELWRA
FT                   RLPAGGQATPMTYEANGKQYVVIAAGGHGSFGTKLGDYVIAYALPNK"
FT   gene            27907..28749
FT                   /locus_tag="Bphy_5563"
FT   CDS_pept        27907..28749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_0953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5563"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74638"
FT                   /db_xref="GOA:B2JUB6"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB6"
FT                   /protein_id="ACC74638.1"
FT                   /translation="MQVQNARRWAPRGSRRWIAAIAALFMASGVRLLLHPLLGPVMPGT
FT                   AFAIAAVLIEYYFGLAPALTVMLAGLCIADYLFVPPYAVVSVINRSDVLFVVSYPLVAL
FT                   VVITLIERLRRAQFRAELVSSVAQSRYEMLLRHDNDRMLARRAVDETHRLLRHLSQHSN
FT                   SFVLIQALERTPDWSGSADAGAAKAAASAAHVFALPPAEIAPGPRFDDVEPEDARRLSK
FT                   ALRPGRHRVRLRRSAANAHAMPASANGAAGDGATQLVDCVCERFTTHAGDFLVLRIGD"
FT   gene            28755..29645
FT                   /locus_tag="Bphy_5564"
FT   CDS_pept        28755..29645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5564"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74639"
FT                   /db_xref="GOA:B2JUB7"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB7"
FT                   /protein_id="ACC74639.1"
FT                   /translation="MKTSVRTIFNEGDGHAVLMLHGLSSSPLELRYLARFLSDEGFTTC
FT                   VPVLEGYTAGSREQSMEQWLEAATREYDALAERYERVSICGLSIGAALALALVHRRPRA
FT                   QSVALLSLTLAYDGWAIPWYRFLLNWAYYSPLRSRYRYRESAPYGLRNDALRAKIARAM
FT                   ERDDFSEVGPSTISLPALHEASRLAACVRSQLRGIRNDCLIVHAIDDETSSPRNPRFVA
FT                   SSIGSAFLRTIWLDDSYHMITSDNEREIVARETALFLRESEIASRTGDAGGKPVVSKAL
FT                   ARRLRQLAAMGKGRA"
FT   gene            29645..30502
FT                   /locus_tag="Bphy_5565"
FT   CDS_pept        29645..30502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5565"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein; KEGG:
FT                   rso:RSc2284 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5565"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74640"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB8"
FT                   /protein_id="ACC74640.1"
FT                   /translation="MAKPVTFSAARCVCAAAAFALAIQSGSALADDLPDSTASPASSAS
FT                   ASTDSSAEAKPASKWKIGFGPGVVITPLYPGSRELRVFPYPALDISYDDRVFSQGPDVL
FT                   GVNVIRSENYHVGASLSFDFQSRQEKDDPHLHGLGNVDGGPKLRLFADYTFWAFTGSVA
FT                   LYQDIAGHGQGKTVVTDLYASLPTGGWLFSFGPGFTWADALYTRTFFGVSSQQSASSGL
FT                   PAYSTGAGIRDVHLNGYVSYDFSKHWAGSIAVTLGRLQHYAAASPITERRTELNTLASL
FT                   NYRF"
FT   sig_peptide     29645..29737
FT                   /locus_tag="Bphy_5565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(30689..31639)
FT                   /locus_tag="Bphy_5566"
FT   CDS_pept        complement(30689..31639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5566"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0927 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5566"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74641"
FT                   /db_xref="GOA:B2JUB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUB9"
FT                   /protein_id="ACC74641.1"
FT                   /translation="MLDATSVTSAFISSDMDRLQAMTTFVTVVEMEGFASAARKLNVSP
FT                   SVISRVMTELEEHLGVRLLTRTTRVVRMTDAGATFFEHCRRILADVEAAELSAVGVNTT
FT                   PRGQLTVTAPVLFGKMYVTPIAQDYLTRYPAVSLNCWFMDRVVNLVDEGADVAIRIGEL
FT                   PNSSLQAIAVGHVRRVLCASPGYLETHGVPQHPDDLASHIAIQATGLTPAPEWRFHVDA
FT                   KPLTVPIQPRLVTTTNDSAIAAAIAGLGLVRVLSYQIAEELANGTLRIVLADCEQATLP
FT                   VHVMHREGKHANQKVRAFLDLAIETLRAKASLWLA"
FT   gene            complement(31675..33747)
FT                   /locus_tag="Bphy_5567"
FT   CDS_pept        complement(31675..33747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5567"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   KEGG: bxe:Bxe_B0926 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5567"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74642"
FT                   /db_xref="GOA:B2JUC0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC0"
FT                   /protein_id="ACC74642.1"
FT                   /translation="MNTVSTDNASPWHAGEVALQEKVGVVEKMREAGRRVVRDYMPEQH
FT                   RTFFRQLPFVVAGSVTDDGDVWATFVAGRPGFMHAPNDKLLHIDLAADLPDPAASGLRE
FT                   GAAIGLLGIELHTRRRNRMNGFVRNRTAQGFDVAVAQSFGNCPQYIQARDYEFARDPDV
FT                   VSDIAPTAFAGLSGRAREMIEAADTFFVASYVGDGEHRQVDVSHRGGKAGFVRIGDDGK
FT                   LTIPDFAGNLFFATLGNFLVNPRAGLVFADFETGDVLQLTGDATVDLESPEIAAYQGAE
FT                   RLWHFTPTRIVYREAALPLRWTFQANGWSPNSLMTGSWDEAASRLKAAELANAWRPFKV
FT                   TNVVDESAVIRSFHLEPADGAGLVAHEAGQHLPIRVTLPAHDKPCIRTYTLSTAPADGL
FT                   YRISVKRGGSVSSYLHDTLKTGSVIEARAPAGQFTIDASARRPAVLLAAGVGVTPMLAM
FT                   LRHIVYEGLRTRRVRPTWLFHSARSLKERAFSREIERLAASANGAVKVVRALTDTAGAR
FT                   EEKDFDVAGRIDIDVLRESLPFDDYDFYLCGPSAFMQSIYDGLRDLNVADNRIHAESFG
FT                   PSGLRRKTGAAAATGPVRVAAQQPVPVAFVKSGKEARWSADSGSLLDLAEARGLNPEFG
FT                   CRGGSCGTCRTRIVEGAVAYAVAPEFHVPDDEALICCAVPASSETGGGDRLLLDL"
FT   gene            complement(33820..34437)
FT                   /locus_tag="Bphy_5568"
FT   CDS_pept        complement(33820..34437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5568"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bxe:Bxe_B0925 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5568"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74643"
FT                   /db_xref="GOA:B2JUC1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC1"
FT                   /protein_id="ACC74643.1"
FT                   /translation="MKLYYHPLSGHSHRARLFLSLLGIEHQLIDVDLAAAEHKSAGFLQ
FT                   LNRFGQVPVLVDGDVNIADSNAILVYIARKFGKTEWLPQTPALEAAVQRWLSVAAGEIA
FT                   FGPAAARLITVFGAKYNAEELIARAHRILKLIDEELAGRAYIAQDHPTIADVALYSYIA
FT                   RAPEGNVDLSFYPNVDAWLRRIEALPGFVEFQKTPVGLAANG"
FT   gene            complement(34584..36476)
FT                   /locus_tag="Bphy_5569"
FT   CDS_pept        complement(34584..36476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5569"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   aav:Aave_1081 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5569"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74644"
FT                   /db_xref="GOA:B2JUC2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC2"
FT                   /protein_id="ACC74644.1"
FT                   /translation="MKLTGSIAFKFSAASGAALAVTVLLLTAVGALNVRHQAVDEFEQS
FT                   SHARIVQADESLDVNFRDVEQNLTYLTQTAQLKAADQSITDYLNHGGQMTPDKNGEIEK
FT                   TIFALLKDFGDTHPNMRYLDIGTHWGGYVQWPIESLNGEHYDPRVRPWYQLAMTAPDRV
FT                   VRPAPYLSAAGSGGAIIPFARVVKDNKGEILGVLEGDISLDDFARLTSGIQFGKTGYLL
FT                   VTDSSGKVLIDPRDKRHEFKELKSLGGGYEQLSGAADGLARIQMDGVEYQSFVYTSPKN
FT                   GWKYYALVPESEMMAAANRLTWTLIAMGLLVLVVAVLIMIALGRRMTDPIRNLANSMHE
FT                   IAAGDGDMTRRLPQLSNDEVGHLAKQFNAFVEKLHGVLLKVMTNSRHLELAASEVSAGN
FT                   LDLSSRTEQQAASIQQTAASMEELAGTVRGTADQAKNANAVASGAVEVARRGNEAVSAA
FT                   AKTMNAAVEQSGRIVGIVGMIEGIAFQTNILALNAAVESARAGESGRGFAVVAAEVRNL
FT                   AQRSTSAAKEIKALLEASVGNVEAGAEQVNLAGKTIAELTDAISNVATITGEIADSARE
FT                   QSRAIGEVNQAVSLMDQSTQQNAALVEEIAAASESLSTQGKDLNATVGFFKLGG"
FT   sig_peptide     complement(36414..36476)
FT                   /locus_tag="Bphy_5569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.367 at
FT                   residue 21"
FT   gene            complement(36709..37326)
FT                   /locus_tag="Bphy_5570"
FT   CDS_pept        complement(36709..37326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5570"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bpl:BURPS1106A_A0609 DJ-1/PfpI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5570"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74645"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC3"
FT                   /protein_id="ACC74645.1"
FT                   /translation="MHIAILTFEGFNELDSFIALGVLNRIRKPGWRVSIATPQARVTSM
FT                   NGVTIEGQISLREANAADAVIVGSGTLTRDVVADPELMSQMRFDASRQLLGAQCSGTLV
FT                   LAKLGLLNDVPACTDLTTKPWVEEAGVEVLNQPFVARGNVATAGGCLASHYLAAWVIAR
FT                   LQGIDAAAGAIHYVAPVGEKEDYVARARRNITPFLPETIAAP"
FT   gene            37414..38748
FT                   /locus_tag="Bphy_5571"
FT   CDS_pept        37414..38748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5571"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: aminotransferase class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; regulatory protein
FT                   GntR HTH; aminotransferase class I and II; KEGG:
FT                   bte:BTH_II1967 aminotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5571"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74646"
FT                   /db_xref="GOA:B2JUC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC4"
FT                   /protein_id="ACC74646.1"
FT                   /translation="MAQLRYKALVDAYAADIRSGRLPAGTRLPTHRELAAKNGLALVTA
FT                   TRVYAELAAMGLVSGETGRGTFVREISLAPRQGIDQFALAAGMVDLNFNYPALPGQTDL
FT                   LRAALRQLAASGDLESLLRYQPHGGRQHERAAVARHLACRGLDVGWERVSLVNGAQAGL
FT                   AATVMALLRPGDVVAVDALTYPGFKVLADTFGLELAPIPAAAQGPDLDALERLCKNRRV
FT                   KAVYVMPTMHNPLGWVMSAHRRKQLASIARRHGLLIIEDAAYAFLVDKPPVPLAALAPE
FT                   ATVYVSGLSKNVATGLRVGFIVAPSESMRAIEQAVRATTWNTPGVMTAIACAWLDDGTV
FT                   KRLETEKRRDAKVRQAIAGDVLAGLGCVRHPASYFVWLPLSEDVRADQVAAALMREHIS
FT                   VSTAEPYATSHHVPHAVRLALGSVELDVLRASLKKVRQVIGNYAY"
FT   gene            complement(38769..40235)
FT                   /locus_tag="Bphy_5572"
FT   CDS_pept        complement(38769..40235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5572"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_C7406
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5572"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74647"
FT                   /db_xref="GOA:B2JUC5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC5"
FT                   /protein_id="ACC74647.1"
FT                   /translation="MSHSKARAAKRHSSSASLTLDDITVVDNALLKRAVGAMALGNAME
FT                   WFDFGVYSYIAVTLGKVFFPSSSPSAQLIATFGTFAAAFVVRPIGGMVFGPLGDRIGRQ
FT                   RVLAMTMIMMAVGTFAIGLIPDYGSIGILAPALLLLARLVQGFSTGGEYGGAATFIAEF
FT                   ATDRRRGFAGSFLEFGTLVGYIFGAGTVAVLTASLSQEALLSWGWRVPFFIAGPLGLVG
FT                   LYIRMKLEETPAFRKEAEAREADEKSRPKHSFMELLAQQWKPLLQCVGLVLIFNVTDYM
FT                   ALSYLPSYLSATLHFNESHGLFLVLAVMVLMMPMTLYAGHLSDTIGRKPVMLLGCVGLF
FT                   ALSIPALLLIRTGAVLPVFGGLLILGALLSTFTGVMPSSLPALFPTKIRYGALAIGFNV
FT                   SVSLFGGTTPLVAAWLVDRTGNAMMPAYYLMGASIIGIVSVLALRETARKPLPGSGPCV
FT                   ATRAEALSLIRGTETSHTSKKRLELVRERA"
FT   gene            40733..41401
FT                   /locus_tag="Bphy_5573"
FT   CDS_pept        40733..41401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5573"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74648"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC6"
FT                   /protein_id="ACC74648.1"
FT                   /translation="MNGRFDKRALAGCIVMGGLALAAVVLHIESNALSELWPFHHEDVS
FT                   VADDTQNPPPSTNDAPPAVAVHDDTSDADIAFVLQSVSDDLQRNDLTAAKVLLDEVLAV
FT                   HSDLPQALALKQELRARELRAAQTTTVVAAADAGNTQPSVATETRETETRATDRTQEKA
FT                   VRSRQVASHGTSHAKSQHAQRKHTAIVSNGRPKTRAEVIAELKRARVNGTMPNFGGRQR
FT                   "
FT   sig_peptide     40733..40801
FT                   /locus_tag="Bphy_5573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            41629..42531
FT                   /locus_tag="Bphy_5574"
FT   CDS_pept        41629..42531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5574"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4749 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5574"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74649"
FT                   /db_xref="GOA:B2JUC7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC7"
FT                   /protein_id="ACC74649.1"
FT                   /translation="MKVTLDELQTFATVVDTGSITAAAEQLEQTVSGASRTLARLEEKL
FT                   QTTLLRRTTRRLELTEEGKAFLQNAREIIDAVENAEEQLAARRERPSGRLRVDAATPFM
FT                   LHVIVPLVAGYRERYPQVELELNSNEGIIDLLERRTDVAIRIGRLKDSTLHSRPVGSSR
FT                   IRVLATPAYLKAHGLPKRVEDLERHSLLGFTQPEALNVWPLVGADNEPYRINPSIASSS
FT                   GETLRQLALESAGIVCLSDFMTGRDRREGKLVQLFARQTQDVRQPINAVYYRNTAISAR
FT                   IASFVDYLAEAAKTTEFAR"
FT   gene            42785..43990
FT                   /locus_tag="Bphy_5575"
FT   CDS_pept        42785..43990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5575"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bur:Bcep18194_B2936 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5575"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74650"
FT                   /db_xref="GOA:B2JUC8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC8"
FT                   /protein_id="ACC74650.1"
FT                   /translation="MSQKILIVGAGFAGVWGALGAARVLDGAGVRSSDVEVTLISPKPE
FT                   LEIRPRMYEAEPQNMAAPLLPLFDAIGVKYVAGSVDAISVQDKTVSVVSANGQKHSLAY
FT                   DRLLLTSGSKLSRPPIPGLEHAFSVDRIEDAVELDAHFDALAKLPASTARNTVAVVGCG
FT                   FTGIEVATELPKRLREKFGAHADVRVVVIGSQDSIGPDLGPNPRPFIAEAFESLGVQTV
FT                   LGSGVVSVDAQGVRTASGQHIEAGTVIWAGGMRASPLAAHVSSHIDPLGRAEVAADLRV
FT                   PEAPHVFVAGDVARALTDDEGHYALMSCQHAMVMGQFGGHNAAADLIGIPTLPYRQPFY
FT                   ATCVDLGDWGAVYSEGWDRQMKLTHAEGKARKQMINTKWIYPPAPNRAEALAAGNPQAS
FT                   FG"
FT   sig_peptide     42785..42847
FT                   /locus_tag="Bphy_5575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.498 at
FT                   residue 21"
FT   gene            complement(44220..44600)
FT                   /locus_tag="Bphy_5576"
FT   CDS_pept        complement(44220..44600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5576"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74651"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUC9"
FT                   /protein_id="ACC74651.1"
FT                   /translation="MSRVDPWSQIVTGLHDRPRFVPQWDPTAAMANASSIRRIEWQTSC
FT                   TILVSWSDSTLGRFEDQTWRAGFARTSGVCGLTGVPVRRGDPVFRPLQKGGVMPRNALD
FT                   MILARTLPHGSGDGNQSIETWG"
FT   gene            44869..45624
FT                   /locus_tag="Bphy_5577"
FT   CDS_pept        44869..45624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5577"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: reh:H16_B1406 predicted nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5577"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74652"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD0"
FT                   /protein_id="ACC74652.1"
FT                   /translation="MKIVIIGGTGLIGSKTAAILRQAGHDVASASPRSGVNTITGEGLK
FT                   EALAGADVLIDLSNSPSFEDKAVLEFFETSGRNLRAAETEAGVRHHVALSIVGTDRTPE
FT                   NGYFRAKVAQEKLIAASGIPYTIVRSTQFYEFLGGIADSSVVGDTVRLSPGLFQPIAAD
FT                   DVASFVADAALAAPRNGIVDIAGPERAPFDEIIARYLKTVGDRRKVVRDPEARYFGGLV
FT                   DEHSLVPLGDALIGRIGLDEWLRRSPGKA"
FT   gene            45837..46670
FT                   /locus_tag="Bphy_5578"
FT   CDS_pept        45837..46670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5578"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: ppf:Pput_2198
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5578"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74653"
FT                   /db_xref="GOA:B2JUD1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD1"
FT                   /protein_id="ACC74653.1"
FT                   /translation="MSIFNEEKIDCHCHIFDPVRFPYRADTMYRPALQEIGTAAQLMRV
FT                   MDAYGVRHALLVGPTSGYRTDNRCLLDALETCEGRFRGIAVVDNAIGRSELAALQRAHV
FT                   VGVAFNPAMEGVDLVLEAGALFASLADLGMIAQIQVCGEQMVALEPWLAQQEVQLVIDH
FT                   GGRPDIEAGIQQPAFQALLRLADSGRASVKLSGWQKYSRRPHPYEDAWPYAHALIRAFG
FT                   PQRCVWGSDWPFLRAPERLDYGPLLTLFEQIVPDAAVRRQIQWETPRRLFGFAAQ"
FT   gene            47137..48378
FT                   /locus_tag="Bphy_5579"
FT   CDS_pept        47137..48378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5579"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: rme:Rmet_2259
FT                   serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5579"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74654"
FT                   /db_xref="GOA:B2JUD2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD2"
FT                   /protein_id="ACC74654.1"
FT                   /translation="MHPVFSRFSRSSAQGDPRFAGDLCQEVPAVDAEDPNSRVMEIFSD
FT                   RSDMKSLAVLESGRPVGLINRDIFLSQMSKPFHRELYDKKSCIAFMDKEPLVVDAGMTI
FT                   EALTFKTVEVGEKALVDGFVVTRDGHFAGLGSGLQLLGAVAEMQAEKNRQIMQSIEYAS
FT                   VIQQAMLRASRETLAASLPEAALIWEPRDVVGGDFYHFAAFAHGWFGATADCTGHGVPG
FT                   AFMTLLASASLSQALEQIGPRDPAALLAAVNRNVKSLLGQVHSASEVSQSNDGLDAAFF
FT                   WFDARAGQLHFAGARIALHILVPDSDQFETIAADRMGVGYVDSLADYAWQLRKIAVPRG
FT                   SLLFICTDGLIDQIGGPRNISFGRRRALDLILKNRAESPAAICEKLRRALAEWQGVQAR
FT                   RDDLTLFCARITDQ"
FT   gene            48382..48945
FT                   /locus_tag="Bphy_5580"
FT   CDS_pept        48382..48945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5580"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74655"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD3"
FT                   /protein_id="ACC74655.1"
FT                   /translation="MSQLLEQDRAFFDLAQRRNVLFYHKGYFSHNIVAAMGEVVKLQLE
FT                   IAGVSASTRRKLFSSFVELSQNIVHYSSDSLQPDNEGGGSIREGAVCITTEDERHLMMC
FT                   VNPVATDDVEGLRNKLEPLRSMSVEEIKQAYKVSLRADTPEESKGAGLGFLTMARDASA
FT                   PLEFAFHPRADEPGTTLFCLKAII"
FT   gene            48964..49359
FT                   /locus_tag="Bphy_5581"
FT   CDS_pept        48964..49359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5581"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rme:Rmet_2261 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5581"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74656"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD4"
FT                   /protein_id="ACC74656.1"
FT                   /translation="MDNLYIAATATSPEVDFKFDQHQLLLRGESYPENAAAFYAPVIEQ
FT                   LRQYLGESTGAVVTVDVVLTYFNSSSTKMLFSVFGALDEAAQSGSRVLLNWYRDEEDET
FT                   IAEFGEELKTDFLAIEFTDRPVSHEGQ"
FT   gene            49362..50087
FT                   /locus_tag="Bphy_5582"
FT   CDS_pept        49362..50087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5582"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rme:Rmet_2262 diguanylate cyclase
FT                   (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5582"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74657"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD5"
FT                   /protein_id="ACC74657.1"
FT                   /translation="MLPISTLCAPVSDAPDLFQNENEALEKARAIHAAADADADDYRQS
FT                   LAELIGHYERLMRETRRLIGRSDRAEREMQALAQQLAHRATHDALTGVFNRSAVIERTT
FT                   KVLRHDSAVMIILDIDEFKRVNDDFGHPAGDAVIMGIVECLRRIVGERGFIGRVGGEEF
FT                   TVLLPAHEPAEALRQAEKMREAIGRHVFASPVDRRVTASFGVSANPPGTDFDTAYGFAD
FT                   AALYRAKRGGRNRVEFANP"
FT   gene            complement(50130..50267)
FT                   /locus_tag="Bphy_5583"
FT   CDS_pept        complement(50130..50267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5583"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74658"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD6"
FT                   /protein_id="ACC74658.1"
FT                   /translation="MTRGIRFRAKFKATQGVVAIAGALQIVLFPATKAALILTVICSRR
FT                   "
FT   sig_peptide     complement(50163..50267)
FT                   /locus_tag="Bphy_5583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.344 at
FT                   residue 35"
FT   gene            50449..51027
FT                   /locus_tag="Bphy_5584"
FT   CDS_pept        50449..51027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5584"
FT                   /product="NnrU family protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: bur:Bcep18194_B0785
FT                   membrane protein, NnrU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5584"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74659"
FT                   /db_xref="GOA:B2JUD7"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD7"
FT                   /protein_id="ACC74659.1"
FT                   /translation="MSILILGLLIFLGGHSVRIFAEGWRKATIERMGAKNWKAAYSVVS
FT                   LVGLVLIIWGYGIARREPVVLWTSPAWSPHLTGVLTLIAFILFPAAHAPGNHFKSIVKH
FT                   PMTAGVGLWALAHLFVSATLHAVVLFGAFLVWAVFDYAAARRRDRAEGVVYPGGTLSRD
FT                   VMPVVAGVVLWVAFVFFLHGWLIGVKPFV"
FT   sig_peptide     50449..50514
FT                   /locus_tag="Bphy_5584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.834 at
FT                   residue 22"
FT   gene            complement(51032..51928)
FT                   /locus_tag="Bphy_5585"
FT   CDS_pept        complement(51032..51928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5585"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xac:XAC0316 transcriptional
FT                   regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5585"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74660"
FT                   /db_xref="GOA:B2JUD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037410"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD8"
FT                   /protein_id="ACC74660.1"
FT                   /translation="MELRHIRYFLAVAEERNVTRAAERLGIGQPPLSQQIHALEDELGV
FT                   RLFRRTGHGVVLTEAGESFAADAKRILHDTRLAVENAQSAGRGEIGQFNIGFTGSAAFN
FT                   PVVSKLIRAYRQAYPNVTLTLAEGNTAQLLAYLDDDRVDVAFVRLGSQSPAGVQFHHIA
FT                   IEPMKIVLPATHRLAKKRKIALSALAEDPFVMLPREASPTLHDVIVGACREAGFEPIAG
FT                   QQAPQLSSVVNLVAAEFGVSLVPASVCQIQVEGVVYTDVLGSSISIRLALASRIESTPA
FT                   KTANFLEKALAFASPID"
FT   gene            52127..52543
FT                   /locus_tag="Bphy_5586"
FT   CDS_pept        52127..52543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5586"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: bxe:Bxe_B2895 putative succinate
FT                   dehydrogenase cytochromeb-556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5586"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74661"
FT                   /db_xref="GOA:B2JUD9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUD9"
FT                   /protein_id="ACC74661.1"
FT                   /translation="MADTLKKPRPEFRNIGIGQILTAYRLPLAGRVSILHRVSGGLLFV
FT                   FLPFLLYLFDQSLSSELSFEVFKGFLSNIIVKLITLVLGWAFLFHFCAGVRHLLMDMNH
FT                   DAVSKERGKRTSVVVLAVSSILTIAFALKLFGAF"
FT   gene            52547..52915
FT                   /locus_tag="Bphy_5587"
FT   CDS_pept        52547..52915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5587"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; PFAM: succinate dehydrogenase
FT                   cytochrome b subunit; KEGG: bxe:Bxe_B2894 putative
FT                   succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5587"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74662"
FT                   /db_xref="GOA:B2JUE0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE0"
FT                   /protein_id="ACC74662.1"
FT                   /translation="MSANNRVGSKRLVVGAHYGLRDWLAQRITAVIMAVYTLILLGWFF
FT                   GAQAFSYDGWAGIFATQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGTRLVLQALT
FT                   IVWLLACAGYAAQILWRV"
FT   gene            52920..54695
FT                   /locus_tag="Bphy_5588"
FT   CDS_pept        52920..54695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5588"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="KEGG: bxe:Bxe_B2893 succinate dehydrogenase,
FT                   flavoproteinsubunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5588"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74663"
FT                   /db_xref="GOA:B2JQD7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2JQD7"
FT                   /protein_id="ACC74663.1"
FT                   /translation="MVAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKT
FT                   TFFVEWMALDLIRDADGDVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFI
FT                   NTGDGLGMAARAGIPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALK
FT                   FANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTAKGHEDPINGFYAVGECSCVSVHG
FT                   ANRLGTNSLLDLVVFGRAAGNHIVRHVKEIKEHKPLPADAADFALSRLAKLDSSSSGEY
FT                   AQVVANDIRSTMQKHAGVFRTSALLAEGVERIREVAGRVGNIHLKDKSKVFNTARVEAL
FT                   EVENLIEVARATMVSAEARKESRGAHAQNDFEHRDDENWLRHTLWYSEGDRLDYKPVHM
FT                   NPLTVESVPPKARTF"
FT   gene            54727..55431
FT                   /locus_tag="Bphy_5589"
FT   CDS_pept        54727..55431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5589"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bxe:Bxe_B2892
FT                   succinate dehydrogenase/fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5589"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74664"
FT                   /db_xref="GOA:B2JQD8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B2JQD8"
FT                   /protein_id="ACC74664.1"
FT                   /translation="MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALVKLKAL
FT                   DETLSFRRSCREGVCGSDAMNINGKNGLACLTNLNELPQKIVLRPLPGLPVVRDLICDF
FT                   TQFFNQYHSIRPYLINDTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPD
FT                   KFVGPAGLLQAYRFIADSRDEATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAI
FT                   GKIKELMVRRTV"
FT   gene            55431..55703
FT                   /locus_tag="Bphy_5590"
FT   CDS_pept        55431..55703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5590"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   bxe:Bxe_B2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5590"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74665"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE3"
FT                   /protein_id="ACC74665.1"
FT                   /translation="MGDTPHQSDPLRRARLRWRARRGLLENDLIFERFFSRYEHDLSDA
FT                   DVGALTRLLELSDNDLMDLLLARKEPEGDLADADVRRVLEMLRTA"
FT   gene            55996..57555
FT                   /locus_tag="Bphy_5591"
FT   CDS_pept        55996..57555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5591"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bvi:Bcep1808_4374
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5591"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74666"
FT                   /db_xref="GOA:B2JUE4"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE4"
FT                   /protein_id="ACC74666.1"
FT                   /translation="MRNVTVRASLLALLVVFASMILLGGVVGIGALKITNGNAQNLRDM
FT                   ARQTILVNDAYKDTARTRSALMRAYTALKERNDTATRDSALQSAQRTLVLSAREMQAFE
FT                   KAPAFDGIDATLKQQVLESAAQLANALSRACDALRSGDTAAYATLNDTDITLSGQVYSA
FT                   NVEKFQKLANQLSDDSLANGNQRFQWIVGTVMLGIGIAVGLIVLAYLALQRTVTGPLAQ
FT                   AADVLDRIASNDLTVRVPQASKSEIGQLFAAMHRMQSSLTRTVSGVRESCEAINTAARE
FT                   IAAGNLDLSSRTEEQSASLEETAASMEQLTSTVRQNAENARQANKLATDAADLAQQGGE
FT                   VVERAVQTMAEISASSSKIADIIGMIDSIAFQTNILALNAAVESARAGEQGRGFAVVAG
FT                   EVRTLAQRSAGAAREITALIGASIDHVENGNGLVTKAGATMTEIVRSVRNVAGIMGEIT
FT                   TATSEQSDGIEQVGHAVSQMDQVTQQNAALVEQAAAAASALETQAQTMREAVSAFKLTK
FT                   SF"
FT   sig_peptide     55996..56070
FT                   /locus_tag="Bphy_5591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.776 at
FT                   residue 25"
FT   gene            57817..59520
FT                   /locus_tag="Bphy_5592"
FT   CDS_pept        57817..59520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5592"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bvi:Bcep1808_5457
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5592"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74667"
FT                   /db_xref="GOA:B2JUE5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE5"
FT                   /protein_id="ACC74667.1"
FT                   /translation="MKLSQLKVSTRLLVGFGLLTGLLLAIALISFYGLSALNDKLDEIA
FT                   RVNGTQARLANELRASIQDRAIAMRNVVLYTSAADRRAEAERIAKQNELYATAYQALDR
FT                   SFAEEAGVNPRERALMTALKQDEAAAAAPMNKVVELCLANDTIVATQLLLESARPTQRV
FT                   WLARATELAQFEDQANQVAQQDAVATYSRIRMLIALIVAASVALALITATLITRSILRQ
FT                   LGGEPATAQEVAAQIAQGNLAVKVDLSNSDADSLMGSLDAMRGRLTSTVADIKAAAESI
FT                   AVAAREIAQGNTDLSQRTEEQAASLEETAASMEELTSTVRQNTENARQGSTLAGNASQT
FT                   ASTGGDVVRKVVATMDDISSSSSRVSEIISVIEGIAFQTNILALNAAVEAARAGEEGRG
FT                   FAVVAGEVRTLAQRSAAAAKEIKELIVTSVSHVTTGSTLVHDAGATMDEVVRSVKRVTD
FT                   IMSEIAAASAEQSTGIEQVNTAVAQMDQVTQQNAALVEQATAAAQAMADQADSLKAAVA
FT                   MFRLDGGEPVVLATKARTVSSKQNAAPAKKAVLQHAPRDDSPTAVDWQTS"
FT   sig_peptide     57817..57924
FT                   /locus_tag="Bphy_5592"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.745 at
FT                   residue 36"
FT   gene            complement(59525..59818)
FT                   /locus_tag="Bphy_5593"
FT   CDS_pept        complement(59525..59818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_1384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5593"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74668"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE6"
FT                   /protein_id="ACC74668.1"
FT                   /translation="MKVIAIASIARPLTPEQRQHIMPNEVPATLKLYLDGKIEQFWYRQ
FT                   DAPGVIFLMNVESVDEAQAAVHALPLAVGGFATYQFIPVGPLAPLGLLIQNR"
FT   gene            59928..60893
FT                   /locus_tag="Bphy_5594"
FT   CDS_pept        59928..60893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5594"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bch:Bcen2424_5910 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5594"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74669"
FT                   /db_xref="GOA:B2JUE7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE7"
FT                   /protein_id="ACC74669.1"
FT                   /translation="MRIAVLALDGLFDTGLAVTLDSLGAANKLAARLPGVTPRFDVTVV
FT                   GVRKRVRSGHGFAIPVQAITPDLKPDWVIVPALGATTPDLLIPALARADVKQATAQLQT
FT                   WRAEGALIAASCIGTFLVAEAGLLDHREATSTWSLAPLFRQRYPKVSLDESRMLIASDI
FT                   GVTAGAAMGHLDLALWLIRRASPELATLVSRYLLADIRSLQAPYIIPNHLAQADPLMQR
FT                   FERWARDHLKEGFSLQQAANALATSARTLQRRCQEVLGKSPLAYFQDLRVERAQSLLHG
FT                   SGLDLEAIAAEVGYVDGATLRALLRQRLGRGVRELRADLR"
FT   gene            complement(60962..61903)
FT                   /locus_tag="Bphy_5595"
FT   CDS_pept        complement(60962..61903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5595"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_C1348 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5595"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74670"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE8"
FT                   /protein_id="ACC74670.1"
FT                   /translation="MFKRRLIGIAIGVGALAGASSLTYAEEPYIPLISKGFQHQFWQAV
FT                   KSGAEQSAKEHNVRITFEGPETEAMVDKQIDMLSAALAKKPQALGIAALDSKAAIPLLK
FT                   RAQSSKIPVIAFDSGVDSDIPLTTCATDNLAAAALAADKMAGMIGDSGEVGVIVHDQTS
FT                   RTGIDRRDGFVNEMKSKHPNVKIVSVQYGGGDHLKSAEIAKAMIQANPKIKGIFGANEG
FT                   SAEGAAIGIKESGKKLVLIGYDSGKEQKEDIMSGLMAGAITQNPVGIGKCVVDSAVKAL
FT                   KGEKLSKKVDTGFYWYDKSNMNDPKISAVLYD"
FT   sig_peptide     complement(61826..61903)
FT                   /locus_tag="Bphy_5595"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(62010..63035)
FT                   /locus_tag="Bphy_5596"
FT   CDS_pept        complement(62010..63035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5596"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_C1349 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5596"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74671"
FT                   /db_xref="GOA:B2JUE9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUE9"
FT                   /protein_id="ACC74671.1"
FT                   /translation="MTLQSDTAALSNERRTSGFRARLFSPTALQKLLAFTSLILLLVFF
FT                   SFASPAFMQMDNILGILQATAVNGVLAIASTFVIITGGIDLSVGTLMTFTAVICGVFLT
FT                   YWHLPMWIGVVAAIATGALCGTISGTLTAKMKIPPFIATLGMMLLLKGLSLVVSVDKPI
FT                   YFTDTENFYMISQDSLIAYFLPSVPVPNAVLILFVLAIASSITLNRTALGRYTFALGSN
FT                   EEAVRLSGVNVDRWKIAIYGLGGAICGVAGLLIASRLNSAQPALGQGYELEAIAAVVIG
FT                   GTSLSGGSGTILGTIIGAFIMSVLTNGLRIMSVAQEWQIVVTGLIIILAVYADILRRKK
FT                   R"
FT   sig_peptide     complement(62889..63035)
FT                   /locus_tag="Bphy_5596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.928 at
FT                   residue 49"
FT   gene            complement(63055..64566)
FT                   /locus_tag="Bphy_5597"
FT   CDS_pept        complement(63055..64566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5597"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_C1350 ABC sugar transporter, fused ATPase
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5597"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74672"
FT                   /db_xref="GOA:B2JUF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF0"
FT                   /protein_id="ACC74672.1"
FT                   /translation="MTPLISVNRLSKSFPGVRALHEVQFELMAGEVHALMGENGAGKST
FT                   LMKILAGVYMRDSGEILYDGKPVEFTTPREAQALGIGIIHQELQLMNHLTVAQNMFIGR
FT                   EPRGRLGLFLDEDKLNAQARDILARMHVNLDPRTVVGSLTVASQQMVEIAKALSFDSRV
FT                   LIMDEPTSALNDAEIAELFRIIRQLKERGVGIIYISHKMDELKQISDRVTVLRDGEYVA
FT                   TVGTPESSVPAIIGMMVGRKLADVEPHQNAHTAGEVALEVKNLNAGPLVRNVSFTLRKG
FT                   EILGFAGLMGAGRTEVARAVFGADPIESGEIFVKGAKAQIKRPSDAVANSIGYLSEDRK
FT                   RFGLATGMDVESNIVMSDLGKFLSLNIFLRRMQIRKRASHFINLLAIRTPSPTQPVRLL
FT                   SGGNQQKIVIAKWLERDCDVLFFDEPTRGIDVSAKSEIYKLLRALAAQGKAIVMISSEL
FT                   PEILRMSDRIVVMCEGRITGELSAGDATQERIMHLATQRESLKAA"
FT   gene            complement(64614..65375)
FT                   /locus_tag="Bphy_5598"
FT   CDS_pept        complement(64614..65375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5598"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: jan:Jann_2107 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5598"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74673"
FT                   /db_xref="GOA:B2JUF1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF1"
FT                   /protein_id="ACC74673.1"
FT                   /translation="MLACLLEIGRAVSSSSDVANAASNPYVALQKVKDGERGSLTDAVE
FT                   QALREAIVTLVLEPGMMIDKLAVCERMGVSRFPVSAALARLEHAGLVEVLPQRGTRVKP
FT                   IALHDIRQHLFIRSALEVETVRAVALMRDNATIDSLAANLKDQRSVFEDGNRLAFHVLD
FT                   LAFHEIMLDAVNLPRVKEIVAVSRNALDRARQLLASPERLVHTLDEHERIFAAIRAGNA
FT                   DTAAKAMHDHLDEVVAELHRSAKERPDIFAP"
FT   gene            65526..66824
FT                   /locus_tag="Bphy_5599"
FT   CDS_pept        65526..66824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5599"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_C1347 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5599"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74674"
FT                   /db_xref="GOA:B2JUF2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF2"
FT                   /protein_id="ACC74674.1"
FT                   /translation="MTTITRLSVRDIRFPTSRSLDGSDAMNAAPDYSATYVTLETDSPR
FT                   ELVGHGLTFTIGRGNEICVAAVNALAPLIVGKKLEDIAADMGAFWRSFTSDSQLRWIGP
FT                   DKGAIHLATAAVVNAVWDLWAKSAGKAVWKLLVDMSPEELVRCLDFRYVTDAITPYEAL
FT                   AMLHRHARTKGEREKEMLAKGYPAYTTSAGWLGYDDDKIRRLAREGVAQGWTHFKQKVG
FT                   GNLEEDVRRARILREEIGENLKLMMDANQVWDVDEAVANMRRLAEFDPWWIEEPTSPDD
FT                   ILGHAAIRERLGSIGVATGEHCHNRVMFKQLLQAQAIDFCQVDSCRLGGLNEVIVVLLM
FT                   AAKFGVPVCPHAGGVGLCEYVQHISLFDYICVSASLENRVLEYVDHLHEHFVDPVVIRH
FT                   GRYMPPQKPGYSIEMKADSLNMHVYPEGEAWQP"
FT   gene            66851..67573
FT                   /locus_tag="Bphy_5600"
FT   CDS_pept        66851..67573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5600"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bps:BPSS1869 dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5600"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74675"
FT                   /db_xref="GOA:B2JUF3"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF3"
FT                   /protein_id="ACC74675.1"
FT                   /translation="MNTSDVKALVFDVFGTLVDWRSGVAREAAAFLQRHGRTAQEADVF
FT                   ADAWRARYQPAMEKVRSGERPFMKLDVLHRENLDQIASEWGLDHTKVPAAELDALNQAW
FT                   HRLDPWPDTVEGLTRLKSRYIIAPLSNGNVRLMIDMAKHGGLPWDAILGAEVAQAYKPA
FT                   HEAYLRTVDVLMLLPGQVCMVAAHNSDLAAAQKCGLRTAFIPRPHEHGAMQATDLKPEG
FT                   NWDWVAQDLIDLAKQLGV"
FT   gene            complement(67629..68657)
FT                   /locus_tag="Bphy_5601"
FT   CDS_pept        complement(67629..68657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5601"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B2196 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5601"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74676"
FT                   /db_xref="GOA:B2JUF4"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF4"
FT                   /protein_id="ACC74676.1"
FT                   /translation="MKALKPLVLAAVLAANAVIASAATPAAQPAPDRVTTGFLKALNSG
FT                   TGPALNTLPPAKARQVLVDAQNSVKVDLSGIDVSNRTIEQDGISVPVTIVRPQGATGTL
FT                   PVFMFFHGGGWILGDFQTHERLVRDLVVQSGAVAVFVNYTPSPEARYPVAINQAYAATK
FT                   WVAGHGNEIGVDGSRLAVVGNSVGGNMAAVVSLMAKDKQGPQIRFQGLMWPVTDTNFND
FT                   GSYLAYRDKHFLTRAMMQWFWDAYTQDPSQRAQIYASPLRASEEELKGLPPALIQVAQF
FT                   DVLRDEGEAYGQKLDAAGNEVTTTRYNGTIHDFGLLNALAADTPTRAATKQLAIEIKTR
FT                   LK"
FT   sig_peptide     complement(68589..68657)
FT                   /locus_tag="Bphy_5601"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 23"
FT   gene            complement(68689..69114)
FT                   /locus_tag="Bphy_5602"
FT   CDS_pept        complement(68689..69114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5602"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bch:Bcen2424_6136
FT                   OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5602"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74677"
FT                   /db_xref="GOA:B2JUF5"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF5"
FT                   /protein_id="ACC74677.1"
FT                   /translation="MSIEKVLYRAHAHATGGRDGRAVVPEGKLDFKLVTPRELGGAGGE
FT                   GANPEQLFAAGYSACFLGAMKFVAARDKTPIPADVSVDGSVGIGAIPNGFGIEVELKIS
FT                   LPGMPHDAAQALIDKAHIVCPYSNATRGNIDVTLTLV"
FT   gene            complement(69308..69874)
FT                   /locus_tag="Bphy_5603"
FT   CDS_pept        complement(69308..69874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5603"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B2194
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5603"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74678"
FT                   /db_xref="GOA:B2JUF6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF6"
FT                   /protein_id="ACC74678.1"
FT                   /translation="MEPTNTVRDQILEHAITLMMLRGYNGFSYRDLSELVGVKTSSIHY
FT                   YFPSKDDLVLEAVNQYSNEILGTLSSIDASLPADQKLGKYTKLFGRTLGDGDQICLCGM
FT                   LAADIEALPDNVRAAVQAFFKANESWLAKVLAQGVKERTLHVNGKPENAARALYAAYQG
FT                   SVLASRLFKTKARLEDVEVSWKVSK"
FT   gene            70911..73229
FT                   /locus_tag="Bphy_5604"
FT   CDS_pept        70911..73229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5604"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74679"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF7"
FT                   /protein_id="ACC74679.1"
FT                   /translation="MNDLAGHLSGKTVFQRDQRTMMKYWKVVGVASATVLTSFGAQQAH
FT                   AQATSITVAGQSYTLCGKENGNCSFLGTGSVVFGAVPPDAPSVMLTAPSTFTNGVGCYV
FT                   GAVSQVDPAYGYGKACWVRAVAATPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP
FT                   TPTPTPTPTPSPAPSPSAGSTLSCGAPTQKAGGTASGLITADTPTTDGLRVFQNNTPFN
FT                   VTVTTNAPNADTVVWSIADSNGSIKTQGSFPVSAGVQTNTISCTSTWSGYGAITATLRA
FT                   NGGTLPNRGTRPTGIATFGVLPNLTSALGTVTYAHQDQHRFGMQGFNGNIAALHALGIT
FT                   WTIDDRQQSVMEPNGPNTYTPNVSDLDPFYKANPDQMRIVRLDGIPAWNSKTGQFTDSY
FT                   YAPKDLNEFQNFMAKVGTDTSLIRAANYPNQQKNYYQVTWEPSLGWADSDANFVAMYKA
FT                   AYQGIHSTDPNAIVMGTGNPFAANCDTCTAGYLKKFGALGLWNYIDAVSTHGYWNAGTY
FT                   PAHPPEQYDSDPSAANQANALDNQIAQLRQVMQAGKPNMKLFFTEAGTSYDPGLAYGPT
FT                   VPSQNQLFAHAAVGVRSHIITLGSGAQMTTLFYGPDYPGEVGYGSFFDLNNAQGSFGAS
FT                   NLSPKPEAMAFATMTRVLDGTNTLGRVNGSPSGVFAFAFQQLGNGKVVTAAWTHSNAQW
FT                   PVNGTYSQTYSQAYSLQVDNPGTSGNVTKIDGYGNVSTVAYSNGQVSLTLTEVPQYIVS
FT                   NNATVAKNNSTVPVGYTGQ"
FT   sig_peptide     70911..71051
FT                   /locus_tag="Bphy_5604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.970 at
FT                   residue 47"
FT   gene            73456..73578
FT                   /pseudo
FT                   /locus_tag="Bphy_5605"
FT   gene            73999..75456
FT                   /locus_tag="Bphy_5606"
FT   CDS_pept        73999..75456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5606"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: bur:Bcep18194_C7077 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5606"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74680"
FT                   /db_xref="GOA:B2JUF8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF8"
FT                   /protein_id="ACC74680.1"
FT                   /translation="MYSTLPAFVSALFLGFGVYVLLTEGVTRLSAPFALMCMTTFAWQG
FT                   AWAFLFQTTSPEAAGLLVKAGYFFILFLPTSFYHFVIELTERRDERPLLMASYALCVIL
FT                   AVLLMTSDEVVAGFGSHFFGDYPKAGRLHPVHVLQTVMLACRSGWLLIVSRRQARARHR
FT                   RHLLGLCLVSLCLYSVAAGDYAVNYGYVFYPPGVIFIAISLGILAVTIVRHGLMRQYFL
FT                   AATVAQEVAMPLEVIGMHADELGHALPELLRGYQLAVRHQLLVNGLYPGQSERLPTLTR
FT                   AIRRQIDSTSTVVEMSLASLTLDRLDRRAFGPQSVRHCVDSALDRYPFTPGERGRVSVI
FT                   PIDPQLRFSGMDSLFVFVLFALLKNALYAIEASGSGTITISAGRDGGFCVIHFNDTGPG
FT                   IADDVLPHIFDPFYSTKPHGQGGGMGLEFCRRVCDAFGGTITCTSTPGVLTTFTLRLPE
FT                   PGSVADRAANDPPVRSRRSRAGQGGIN"
FT   gene            complement(75453..75950)
FT                   /locus_tag="Bphy_5607"
FT   CDS_pept        complement(75453..75950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5607"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74681"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUF9"
FT                   /protein_id="ACC74681.1"
FT                   /translation="MLTREAIPQVLSRTSALLSTDMIEGSPQKTFHHVIDIYLKDSNAF
FT                   MNTYFARYFEWQGICRERWFHECIHNNLLAAGGTFVTKRAHQEYVQETFPFQRVDCYLN
FT                   TFQVRQCSAYLLFRFCVDGRPVSHGYQQILFAGMDKRIRRFPEGIIERVKEYEVILPPV
FT                   TN"
FT   gene            76150..76605
FT                   /locus_tag="Bphy_5608"
FT   CDS_pept        76150..76605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5608"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   slo:Shew_2794 CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5608"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74682"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG0"
FT                   /protein_id="ACC74682.1"
FT                   /translation="MMKVEDLMTKRVVTVGFDDTLETVKDIFEHSGFHHLLVVEDRSLQ
FT                   GVVSDRDLLRALSPFIDSVVETQRDIGTLSRRVHQIMSRKPITLRPDADVTDAIQLLLA
FT                   HPISCIPIVDGEFHPVGIVSWRDILKVCSELLGVARAADAQAEGHGQ"
FT   gene            complement(76633..77148)
FT                   /locus_tag="Bphy_5609"
FT   CDS_pept        complement(76633..77148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5609"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B2287 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5609"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74683"
FT                   /db_xref="GOA:B2JUG1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG1"
FT                   /protein_id="ACC74683.1"
FT                   /translation="MDHCATTFDVRCLPQDAIGAAWTPAYASRYLATPGLSGLQHDTAG
FT                   SEPRAVMVDQVLRYVQAHLCDDELSPESVLSALQLPRSTLYRLFRREGGLGAYIRHLRL
FT                   RHAADDLVRYPHALVVDIAFGLGFKSASVFTRAFRRVYGMAPQEYRALGGEGHAAMPSS
FT                   MAPAQQPA"
FT   gene            complement(77779..78522)
FT                   /locus_tag="Bphy_5610"
FT   CDS_pept        complement(77779..78522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5610"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   pst:PSPTO_2261 racemase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5610"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74684"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG2"
FT                   /protein_id="ACC74684.1"
FT                   /translation="MNAPIRICVLVPVATSQYNDRILKAIAPVVPPDVQVEIRNITNGH
FT                   PDIENRTNWLQNGMPVVELAQSIADDGFDGIWLTDFDMCGVEAAREVIDIPIIGGFPAS
FT                   AFAALMLSQRFSIVTILQSTLAMQRAHPQTYGIQDTFASIRAIDCPVAQLDNIDVVVVR
FT                   TFEAALKAIKDDGAQAILLGCTGFVDVASRVSTLLGEALGSYVPVIDPNQAGFSFLVSL
FT                   VRMRVRPSRLTYSKVSLQSQAAPGC"
FT   gene            complement(78519..79736)
FT                   /locus_tag="Bphy_5611"
FT   CDS_pept        complement(78519..79736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5611"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   pst:PSPTO_2260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5611"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74685"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG3"
FT                   /protein_id="ACC74685.1"
FT                   /translation="MAYEIRREDLEPLLLGGAFFGSGGGGTIESARHLAAHFVAGDYYP
FT                   ADTVKVVSVDEATEGAAVMVAYLGAPEAINQATYPIGPVTAVQNVAARLASQSTKLAYV
FT                   MPPESGALGFTVAVLVAAKLGLAIIDADGAGRAVPSLPMLTFAAAEIDPRPAFLVSQGG
FT                   LSVELDVTPRAGSNGGPTHQRDVSAIVEQMMRPVVADPEFGQFGGLAMWVMTPADIGRA
FT                   TPIRGTLTRALELGRAVQAGQIGTVPEMTRYLKEHCGLAARAISEPGELVSAEVDTAGG
FT                   FDVGKIRIRSGSHTYTVIYQNESLLVWDSQRAHPVVLSPDSVAYYVGGEGQSIYSNGDL
FT                   VQSDGSLNPDIGKRPVTLIAWRAEAEISKPGLNLDSFVQLLNSLGYLGPYVPLDKLASI
FT                   HRGDAS"
FT   gene            complement(79726..82044)
FT                   /locus_tag="Bphy_5612"
FT   CDS_pept        complement(79726..82044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5612"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   cvi:CV_3148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5612"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74686"
FT                   /db_xref="GOA:B2JUG4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG4"
FT                   /protein_id="ACC74686.1"
FT                   /translation="MSSTPAIPFAQNKPNPGAFIGAAPAFRQLVRLIDRVAPTDHALLI
FT                   FGPTGSGKELVARRVHLRSLRHDQPFVDVNCGAIPEHLVEAELFGHVKGAFTGAAENRQ
FT                   GLFQQVGKGTLLLDEIGELPLALQPKLLRVLETRTFRPIGSSTNLRFEGRVVASTHRDL
FT                   RELSREGRFREDLFYRLAVFVLAVPGLEQRAEDIPALVAHFASLQPRSLEFSPAAIRRL
FT                   SQHAWPGHIRQLRNLISQLSVLAENTMIDVDTLEPFLANEAAGPVSRASLADMLLQLDG
FT                   RDKLAVAEDLLIDRALERSAGNKSAAATLLGVGRKTIERRLKSRQEHHRVAHKCLEHAT
FT                   ALVAESRFAEAIPPLRRCLDVLQANNEQDSVRRLQFDAYRLLGMSLRSVHGWLYAEATA
FT                   CYAAALSIGEGICEPAEIAAIQFGVWTTQLTTLQLKQARATAQDMLQRAQNSGDRVSLD
FT                   EAHVAMTNTLFWLGDSEEALACLARGNLLGVGRHDTRTGSQGIDLASLALTFEGLAAYQ
FT                   IGAFAQARQAMEMLIARASEPGPHAFAHAVNLQGASWLATLFDDQDRLGRLASELETVS
FT                   IANGFAFYRGVGQILRAVHLSARGHSDEAETIMLDGYDNHVVCNGGALFYSFMAWQHGE
FT                   LLLRAGRAQNCNAMLASAVDETLARQERVYLGELLVTRARAQWALGDLTAAEQGLRAAL
FT                   STALAFGSVPARVDAARYLATLLRSTGRHAEAIDTLERGLRALPADPTPRIASAAALLA
FT                   ELRQEVSLDNDNEGIAHGL"
FT   gene            complement(82509..83792)
FT                   /locus_tag="Bphy_5613"
FT   CDS_pept        complement(82509..83792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5613"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   bur:Bcep18194_B2807 methionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5613"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74687"
FT                   /db_xref="GOA:B2JUG5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG5"
FT                   /protein_id="ACC74687.1"
FT                   /translation="MSYGSYHKRKIAGRDLHPETQMMSYGYDPFLSEGSVKAPVFLTST
FT                   FAFRTAEDGAEFFDRVSGRKPLPEGESAGLVYSRFNHPNLEIVEDRLALLDDSEAAVVT
FT                   SSGMAAIAAILLTFLRPGDCVVQSAPLYGGTETLVSKFLPEWGIASEVIEDGLSIAAIR
FT                   NALEAAAQRGKVRMCYVETPANPTNALFDLEGLRQEIDAFETRHGYRPLSVCDNTLLGP
FT                   LFQKPVNHGIDLSVYSLTKYIGGHSDLVAGGVTGNQGLITRVRAIRSMFGSQLDPHSCW
FT                   MITRSMETLVLRMQHAARSGATVARWLASNPFKPVKVLHPELTNDPAYRAVYRRQCSGP
FT                   GSTFAFVLDGGRAQAFRFIDRLTLFKSAVSLGGTESLICHPASTTHSGVPAEVRLAAGV
FT                   SEGLIRASVGLEHPDDLIADLSNALEHC"
FT   gene            complement(83838..84530)
FT                   /locus_tag="Bphy_5614"
FT   CDS_pept        complement(83838..84530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5614"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   bch:Bcen2424_5470 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5614"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74688"
FT                   /db_xref="GOA:B2JUG6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG6"
FT                   /protein_id="ACC74688.1"
FT                   /translation="MPNFDVTIETYLTQIHLGPLPNLVMRALTDMYTFRGLVLIPILWW
FT                   IWFQPGERRNWKREVVIATVVSGLLALFAGRVLADLLPFRVRPIYDPDLHLHFASSSLG
FT                   DAKLSSWSSFPSDHAMLWMAVATGIFIVSRLTGIAVIAYTAVFICFPRAYLGFHHPTDL
FT                   LAGAAIGIATTYLMTRAPIRARYAAPSLHWMERYPGPASVFAFVVCFELVTQFDEVRRL
FT                   ASAASKAL"
FT   gene            complement(84862..86520)
FT                   /locus_tag="Bphy_5615"
FT   CDS_pept        complement(84862..86520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5615"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: bps:BPSS0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5615"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74689"
FT                   /db_xref="GOA:B2JUG7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG7"
FT                   /protein_id="ACC74689.1"
FT                   /translation="MSRLIRWVGAGALAGSMIVPLMTAHAEDGQNRGNDNDDRAIQHVL
FT                   LISVDGLHEQDVARCIGANTCPNIALLAKSGVTYTNAYTPGLSDSFPGLAALVTGGSPK
FT                   SAGLFYDVSYDRTLYAPSDTGCTGAQGWNVVFDETTGIDAQAGGALTHLDGGGAFNPDA
FT                   IPHAKHAGKCTPVYPHDYIKTNTLFEVVKEHIRGARTAWADKHAWGYDWLNGPSGRGVD
FT                   DLSRTEINSINPLTGNDYTDLYTNTEIFDNFHVASIINEIDGKDSTGKRDAPVPTLFGT
FT                   NFQTLSVAQKATVAKGGGYVDTSFTPGTQVAAAIRYVDDSIGKMVAELKARNLASSTMV
FT                   IVTAKHGQSPTDHSKLVKNGDTLTALLESKNFLDPNGNFGQNNNAKAPNDGTGRVGTGL
FT                   VQTDDVGLIWLRDPSQLAQVVATLNANLTCGAPGICADGPQAYILSGAPLASMFGDPSN
FT                   GRTPDIIVQPNPGVIYTSSTKKDEEHGGNAPDDSHLGLIVSFPDGRHHGKTVERRVTTT
FT                   QVAPTILRALGVAPEELHSVQVEGTRALPGLHTDD"
FT   sig_peptide     complement(86440..86520)
FT                   /locus_tag="Bphy_5615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(86939..87889)
FT                   /locus_tag="Bphy_5616"
FT   CDS_pept        complement(86939..87889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5616"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; KEGG: bxe:Bxe_A3018 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5616"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74690"
FT                   /db_xref="GOA:B2JUG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG8"
FT                   /protein_id="ACC74690.1"
FT                   /translation="MMDQHSTDARTSLTSSNQFELLLFRLGSVPGDTAHELYGINVFKV
FT                   REILTMPAITPIVGASPCVMGAVNIRGQVIPVVDLPRLMGCEATRGLNILLVTEFARTT
FT                   QGFAVQEVDDIVRLDWNQVLPADAAAGSGLVTSIARIDGNTGDSRLAQVVDVEQVLRDV
FT                   LPTHQVPAAGSASDLLQLPPGTRILAADDSGFARTLIQQALGEIGAESIMAKTGEEAWQ
FT                   ILVKLADEAERSKTRLRDNVTMVLTDLEMPEVDGFTLTRRIRADNRMRDMPVVIHSSLT
FT                   GSANEAHVRNAGANGFVAKFQAAELAEAIRRAIAA"
FT   gene            complement(88060..88917)
FT                   /locus_tag="Bphy_5617"
FT   CDS_pept        complement(88060..88917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5617"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   bmn:BMA10247_A1148 CAAX protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5617"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74691"
FT                   /db_xref="GOA:B2JUG9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUG9"
FT                   /protein_id="ACC74691.1"
FT                   /translation="MTLSITWIALFLAAPTTLIARIRWPGTALLIIACCAALAVGQLAP
FT                   AALIALALLIFAAYAIAPERARSVRYAGHVLFVALAVGLSTHWLPGFHNQRVIGPERIT
FT                   PDAVPFTMYLNLDKPLIGFWLLLAVPWMRGRYELRTSLKVGLLSLLATTAACLAVAQLL
FT                   GVVGWAPKHPAHSGLWLLNNLFLVSVTEEALFRGYLQGGLARLLARRKHADGIAFCVST
FT                   IVFALAHAPGGWQWIVLAGIAGAGYGLAWRYGGLQASVLAHFGLNTAHFFFFTYPMLQA
FT                   AVRR"
FT   sig_peptide     complement(88798..88917)
FT                   /locus_tag="Bphy_5617"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.495 at
FT                   residue 40"
FT   gene            89285..90571
FT                   /locus_tag="Bphy_5618"
FT   CDS_pept        89285..90571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5618"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_B2742
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5618"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74692"
FT                   /db_xref="GOA:B2JUH0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH0"
FT                   /protein_id="ACC74692.1"
FT                   /translation="MKPNQWDVSYEWKAVTLLALGFGLVGLDRWLIAPLFPAIMKDLHL
FT                   NAQDVGNCIGILGLSWGVFAALMGGISDKIGRRKVLIPAIIAFSLLSGLSGVAGGLAAL
FT                   LGIRALMGVAEGSFCPTSFAATADASHPKRRGFNLGLQQSGFALFGLALSPIIATQLLG
FT                   VMSWRWVFALVSIPGLILGLLMYRVIREPRREPVARTARINASAHKTHGSWRDVLRSRN
FT                   IPVAMVALFCAMTGVFVLGAMLPLYLTDYLSLDTQRMGVVVSAIGFGGFVGQFGLPGLS
FT                   DLVGRRFASIVGFVGTAVMLYVFRGLGAQPVALFAVLFVASFFTLGLVSLLSGPVATEA
FT                   APVGMVSTAIGIVVGAGEIFGGGIAPALAGFVATHFGIQNILWLPICAVILGVGVSLLL
FT                   EETAPAKARRRGPPSVDESAHFPAVEQPE"
FT   gene            90669..91598
FT                   /locus_tag="Bphy_5619"
FT   CDS_pept        90669..91598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5619"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2741
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5619"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74693"
FT                   /db_xref="GOA:B2JUH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH1"
FT                   /protein_id="ACC74693.1"
FT                   /translation="MDRFLSIEAFVRVAETSSFAEAARQLGVTSSVVTNRIQQLEKFVD
FT                   APLFHRSTRHVRLSEVGEAFYRECAEVVGRVNELTDQMRELRATPTGRLRIQMLPGFAL
FT                   GHFGASLAEFNRRYPGIQLDVIVNDRVVDPIEEGFDVAFQIFPPISESLIERRLFPVRR
FT                   LFCAAPSYLREYGTPQHPRDLLQHTTALYSGYPSRNRWTMTRGDEVVEMELPGMIRSNS
FT                   VHLLRDYALTGGGVVCLPTLVASAALLDGSLVPILTDYALSPLNFAAVYPATQRQALKV
FT                   KALVEFLADWLGPEPSWDTPLIERGWIC"
FT   gene            91783..92286
FT                   /locus_tag="Bphy_5620"
FT   CDS_pept        91783..92286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5620"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74694"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH2"
FT                   /protein_id="ACC74694.1"
FT                   /translation="MTDTSYHTFFGSLDAYRKGEIEITSGAARHYVFSNIFEVASQSAP
FT                   YDKVVVGKNIEYVIEVLRTEGQSRWFASSHDEFAILMDGKARIDFIELETPPQNVRGSV
FT                   HASNEGEQPAGRAMGHVVLRRGHQALLPAGCAYRFSAQRSGVALVQTMLGELSVEKWAD
FT                   ICLH"
FT   gene            92331..93350
FT                   /locus_tag="Bphy_5621"
FT   CDS_pept        92331..93350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5621"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74695"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR040908"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH3"
FT                   /protein_id="ACC74695.1"
FT                   /translation="MATLDTLDHPAGFAADAVKASAPDPVTGYKRFSLGAFQFLRDEYF
FT                   VKINWPAKGQNRTHAVPADAFLRAMMRDVAWGFFYGWVNFDHVFGTRNHYGKVDIYAGS
FT                   FNGIMKEAGVDYMETFETPTIMATFKAILHDWTNEGFDPFAAPEETGTAFGRKHGDNDA
FT                   AIERTRIATRRMPGLEGDSPLRDELPINRAFADVPQDEPEVHAEPGFEGELHAFNLFKY
FT                   LSRSDVTWNPSVTSVCGESLFCPTTEEYILPVFHGNDRVEWFLQLSDEIVWDIGDKNTG
FT                   APRARITMRAGDICAMPADIRHQGYSTKRSMLLVWENATPNLPKRYESGELKPYPVDF"
FT   gene            93386..94852
FT                   /locus_tag="Bphy_5622"
FT   CDS_pept        93386..94852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5622"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bam:Bamb_5214
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5622"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74696"
FT                   /db_xref="GOA:B2JUH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH4"
FT                   /protein_id="ACC74696.1"
FT                   /translation="MRNQLFIDGRFTDAAEGGTIDVLNPHDGSLITKIAAATAPDVDLA
FT                   VAAATRAIPKWTGMAAAERGRLLLRLADAIEANAEELAQLESLDTGHPIRDSRALDVPR
FT                   TAACFRYFGGMADKLQGSVIPVETGFLNYVQRAPIGVVGQIVPWNFPLMFTSWKMGPAL
FT                   AAGNTVVLKPSEITPLSTLRIVELMAEVGFPAGVVNIVSGYGHTAGQRLAEHPGVGKIA
FT                   FTGSTATGRRIVEASQSNLKRVQLELGGKGANIVFDDADLDAAINGAAWAIFHNQGQAC
FT                   IAGSRLILHERIADQFLERFVALAASIRIGNPLDPDTEMGPLTSLQHLERVKAYVDVAR
FT                   EQGGRVLTGGGAPQDASLANGYYVRPTVVEAKTPHDRIAQEEVFGPFVTVLRFGSDEEA
FT                   LKIANGTDYGLGSGLWTRNLSRAHRTAARMHAGMCWINCYKRVNPGSPFGGVGQSGYGR
FT                   EMGYEAMHDYTEARSIWVNVDGNVPPHFKR"
FT   gene            94866..95933
FT                   /locus_tag="Bphy_5623"
FT   CDS_pept        94866..95933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5623"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bam:Bamb_5215 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5623"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74697"
FT                   /db_xref="GOA:B2JUH5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR034786"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH5"
FT                   /protein_id="ACC74697.1"
FT                   /translation="MKDFVYQGAPSRVVFGWGALAQLPAEVERLGARRALILSTPEQRA
FT                   LADEVARVLGERAAGVHAQAVMHVPVDVARAAREAAAAIDADCCVAVGGGSTIGLGKAI
FT                   ALESPLPIIAVPTTYAGSEMTPIYGLTQGRVKHTGRDTRVLPRTAIYDPSLTLTLPPAI
FT                   SAASGVNAIAHAVEALYAEDANPIVSLMAEESIRALGEALPRIVRKPDDADTRSRALYG
FT                   AWLAGSCLGAVGMALHHKLCHTLGGTFNLPHAQTHAAMLPHTAHYNHEAASDALTRVAK
FT                   ALGGQHASEAGPLLDDLNRTLGIPMSLAQIGMPEGGLDEAAELACRNPYANPRPVERDA
FT                   IRALLQRAWLGTAPA"
FT   gene            95964..96845
FT                   /locus_tag="Bphy_5624"
FT   CDS_pept        95964..96845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5624"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: bam:Bamb_5216 intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5624"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74698"
FT                   /db_xref="GOA:B2JUH6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH6"
FT                   /protein_id="ACC74698.1"
FT                   /translation="MTTDEREAERALTEQVVASFANAEDARLRTLMQSLVRHMHAFVRE
FT                   VEPTEAEWMAAIRFLTATGKMCDDLVRQEFILLSDTLGVSMLVDAINHRLATGATDTTV
FT                   FGPFYIEGMPERAYGENMAFTPGTPALVHGRVLTTLGEPVAGALLDVWQTADNGMYSGQ
FT                   DTAQPHGNLRGRYRTDAEGRFAITTIVPVSYPIPTDGPVGQMLRATGRHPWRPAHLHFM
FT                   IKAPGYRTLVTHLFDKDDPYLQSDAVFGVKPSLLVAYGERSAGDELARRFGFSGDYREA
FT                   RYDFVVDESATP"
FT   gene            96842..97153
FT                   /locus_tag="Bphy_5625"
FT   CDS_pept        96842..97153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5625"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: bur:Bcep18194_B2736
FT                   conserved hypothetical protein, YCII-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5625"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74699"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH7"
FT                   /protein_id="ACC74699.1"
FT                   /translation="MRRYFAVFATDKPHMREVRERVRPSHRAYLRSAASHGVFVRLGGP
FT                   TLAPHCDAMNGTLLVIEADGIGDVMAFVGNDPYMQAGLFERVEVRPWDWSLGNPEHRV"
FT   gene            97150..97485
FT                   /locus_tag="Bphy_5626"
FT   CDS_pept        97150..97485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5626"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_B2735 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5626"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74700"
FT                   /db_xref="GOA:B2JUH8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUH8"
FT                   /protein_id="ACC74700.1"
FT                   /translation="MNGEPNRLCSLGEVPDGGARVVDRADRPVILVRRGDSVWGYVNRC
FT                   PHFSVRLDYEEGQVSCYRAQVLMCAHHSALFRFEDGRCIEGPCAGAALDAVDVRVDATL
FT                   SVVEVGV"
FT   gene            97555..98022
FT                   /locus_tag="Bphy_5627"
FT   CDS_pept        97555..98022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5627"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188; KEGG:
FT                   reu:Reut_B5138 protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5627"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74701"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS3"
FT                   /protein_id="ACC74701.1"
FT                   /translation="MSVISMQVLVDADACPVVVKEILFRAARRVEVCVTLVANQYLRTP
FT                   PSRFIKAIQVPSGFDAADERIVELVHDGDLVITADIPLAAAALDKGAHVLDPRGTWFSR
FT                   ENIQERLTMRDVMDQLRTSGVETGGPTPYSANDGKAFAGQLDRFLARRRAV"
FT   gene            98390..100144
FT                   /locus_tag="Bphy_5628"
FT   CDS_pept        98390..100144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5628"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS;
FT                   Xanthine/uracil/vitamin C permease; sulphate transporter;
FT                   KEGG: reu:Reut_A1208 sulphate anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5628"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74702"
FT                   /db_xref="GOA:B2JUS4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS4"
FT                   /protein_id="ACC74702.1"
FT                   /translation="MANQQMPSAEAQIETAATGWRAVVPPAQWLAGYRWQWLSADAIAG
FT                   ATLAAYGIPVSLAYATLAGLPPQYGIYCYLVGGLFYALFGSSRQLAIGPTSAISMLVGV
FT                   TVADMAGGDPVRFASIAALTAILVAVMCVLAWIFKLSSLVNFISETILLGFKAGAALTI
FT                   ALTQLPKLFGVKGGGEQFFERVAILVGQLPDTQLVVLAFGIAAIALLLLGEKLLPGRPV
FT                   ALFVVVLSIVLLTVTPLREMGFKIVGTLPTGLPEFHFPALRVRDVDGIIPLAFACLLLS
FT                   YVESVSAARAIAQKNGYEIDPRQELLGLGAANLAAGLFQGYPVAGGLSQSSVNDKAGAK
FT                   TPLSLVFASITIGLCLLFLTGLLTNLPNVVLAAIVLVAVKGLVDIRELRHVWHVSRYEF
FT                   LVSMLAFAAVLQLGILKGVIVAVLASMLLLIRRAAHPHVAMLGRIPGTQRYSDVERHPD
FT                   NEAVPGVLMFRVEASLLYFNTEHVRATVWEKIRSSASPVKLVICDLSSSPSVDIAGARM
FT                   LAAMQADLSKRGMVLRIVMAHAGARDILRAEGLEERVGHLGRRVTVSDVVDAFLRGADT
FT                   TSATLDET"
FT   gene            100866..106898
FT                   /locus_tag="Bphy_5629"
FT   CDS_pept        100866..106898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5629"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ana:alr1121 two-component
FT                   hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5629"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74703"
FT                   /db_xref="GOA:B2JUS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS5"
FT                   /protein_id="ACC74703.1"
FT                   /translation="MDTFEVESSLHSDEQLSHIAAALNALRRGDTSYRLPENWTGKAAE
FT                   IASEFNQLSSQTRHIGQRLGRISRHLRGHGELKKEIAIESGALTGIWLDSASHVNLLFE
FT                   SVTTANECTKTVLGALASLQKGEAASLPADWTGIHGKVAHVFNDVVEQNVRIAEELGRL
FT                   SKVVGKEGRLKERAALPYARGFWGDSIDAVNSLIADLVHPTSEVARVIGAVAQGDLSKS
FT                   MALEADGRPLQGEFFRTAKTINTMVEQLGTFAVEVTRVAREVGTEGKLGGQADVQGVAG
FT                   TWKDLTDSVNSMAGNLTSQVRNIAEVTKAVAAGDLSKKITVDVKGEILELKNTINTMVD
FT                   QLRSFASEVTRVAREVGTEGKLGGQADVQGVAGTWKDLTDNVNFMAGNLTSQVRNIAEV
FT                   TKAVAAGDLSKKITVDVKGEILELKNTINTMVDQLRSFASEVTRVAREVGTEGKLGGQA
FT                   DVQGVAGTWKDLTDSVNSMGGNLTAQVRNIADVTTAVAAGDLSKKITVDVKGEILELKN
FT                   TINTMVDQLRSFASEVTRVAREVGTEGKLGGQADVQGVAGTWKDLTDSVNSMAGNLTAQ
FT                   VRNIADVTTAVAAGDLSKKITVDVKGEIRELKNTINTMVDQLGSFASEVTRVAREVGTE
FT                   GKLGGQADVQGVAGTWKDLTDSVNSMAGNLTSQVRNIAEVTKAVAAGDLSKKITVDVKG
FT                   EILELKNTINTMVDQLRSFASEVTRVAREVGTEGKLGGQADVQGVAGTWKDLTDNVNFM
FT                   AGNLTSQVRNIADVTKAVAAGDLSKKITVDVKGEILELKNTINTMVDQLGSFASEVTRV
FT                   AREVGTEGKLGGQADVQGVAGTWKDLTDNVNFMAGNLTSQVRNIADVTKAVAAGDLSKK
FT                   ITVDVKGEILELKNTINTMVDQLRSFASEVTRVAREVGTEGKLGGQAYVQGVAGTWKDL
FT                   TDNVNFMAGNLTSQVRGIAKVVTAVANGDLARKLTVEAKGEVAALADTINSMTETLATF
FT                   ADQVTTVAREVGVEGKLGGQAKVPGASGTWKGLTENVNQLAANLTTQVRAIAEVATAVT
FT                   QGDLTRSITVEALGEVAALKDTINEMIRNLKDTTQVNTEQDWLKTNLAKFSRMLQGQKD
FT                   LVAVGQLILSELAPVVGVQQAEFFVLDPSEHAASLRLMASYASSGHSAHGKRVQMGEGL
FT                   IGQCAVERRKILLEPSASEPVRITSGLISIVPHNVLVLPVVFEGQVKGVIELASSECFN
FT                   PTHLAFLDQLTESIGIVINTIEANTRTEDLLKQSQSLARELQSRQEELQTTNEELQEKA
FT                   RLLAHQNQEVERKNTEVEQARQALEEKAKQLALTSKYKSEFLANMSHELRTPLNSLLIL
FT                   SDQLCKNSEGNLSTRQIEFSRTIHSSGNELLMLINDILDLSKIESGTVAMDFAEHRLAD
FT                   LTSYVERTFRHVAEARNVDFVIELGTHLPASIRTDIKRLQQILKNLLSNAFKFTHRGHV
FT                   TLSVEEVSGGWSADNERLHSAPACIAFSVSDTGIGISADKQQIIFEAFQQADGSTSRKY
FT                   GGTGLGLAISRELSKLLGGEIRLISSPNKGSTFTLYLPLSAEMGRVARKTVSLSGDAAP
FT                   AAVLDEGVSEFDLLAAHEFVDTVVGDTRELVSAPEDDRFSIMDGDRVLMIVENDLAFAH
FT                   FLLDAAREQGFKGLVTPLGAPALTLAEQFKPDVITLDLFLPDMDGWRVLGRLKNDMATR
FT                   HIPVCVISTDESRERALKAGAFAFLTKPIQAREILDDALSVLAVHASAAPRTLLVALGD
FT                   SPARKEFAALVSSERIVPIFADSREQLLNALAEGQVSAVVLGAEMFQACSDEMSAALSH
FT                   RGTFAPLPLIVFAPGQAAGPWTREIECFNPFVAPDMSRLLDLSVAWLHCDGKWLPQQAR
FT                   DIIGSLHGANEELTGRKALIVDDDMRNIFALATVLEDHGMRHVWADNGRDAIRLVETDS
FT                   EIDIVLMDIMMPEMDGLVTTSEIRKLPVGRTLPIIAVTAKAMKGDRERCIEAGAWDYLS
FT                   KPVNREDLLAVLHAWLHR"
FT   gene            106908..109052
FT                   /locus_tag="Bphy_5630"
FT   CDS_pept        106908..109052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5630"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: afw:Anae109_0539 multi-sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5630"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74704"
FT                   /db_xref="GOA:B2JUS6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS6"
FT                   /protein_id="ACC74704.1"
FT                   /translation="MDHAVASARQPVNILVVDDLPQQHVVMRTVLEELGENVITVASGR
FT                   EALKAVLERAFAVILLDVNMPGMDGLETASLLRTYRRTARTPIIFVTAYIDESEMKRAY
FT                   SLGAVDYISAPVVPEILRSKVKVFVEMHRMHHELLSRAEEREAIVRAEAGRAAAEQARQ
FT                   RADFLAAASHALTRSLEIDATLQRIAELACSELADTAFVAVRGIGEFSTGLTVKSARRN
FT                   DGNAPDFAAFQSKALNRAFPAIDRFVHRLLHEEQVEVEPAVGECVSEAIEGAAFVEGVR
FT                   RVSAFPLLTGNQKGVIVLCSSEAAMPAEQTTLCQEFVSRASIALENALLFSAIRDGDRR
FT                   KNEFLAMLAHELRNPLAPIANAAAVMRSASEGDAQVLRWASEIVGTQVEHMVRIVEDLL
FT                   DVSRIARGTVALRLTPVPLSIVIGRAVETSRPHLIRRSQTLICDEEAVDIIVNGDVVRL
FT                   AQIVANLLNNASKFTPQGGHISLSTRFADGTATITVADDGQGIDAEFLPHVFELFAQAD
FT                   GSLHRSLGGLGIGLTLVRHLTELHGGSVRCKSDGLGKGSEFVVQLPGTVAERTMPALAP
FT                   VVHLNRKAAIRVLVVDDLVASAESLEALLTIHGYIVRCAMDGATALQAASEMRPDVIVL
FT                   DIGLPDMTGYELARYLRQDRACRDALIIALSGYGQEDNIRQAMEAGVDHYLVKPADLAV
FT                   LLDLLSSRDEGQSYDGVAST"
FT   gene            complement(109143..109445)
FT                   /locus_tag="Bphy_5631"
FT   CDS_pept        complement(109143..109445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5631"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74705"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS7"
FT                   /protein_id="ACC74705.1"
FT                   /translation="MTLRSQPTTRSESMEKTYTYKDFEVTVKLEPVRAVSSDFTYGPAA
FT                   AYIAVVSICTADPRRPIGVPVRLIAEGNRAFGTEDEALTTGLNAAQRVIDDRFGS"
FT   gene            complement(109644..110252)
FT                   /locus_tag="Bphy_5632"
FT   CDS_pept        complement(109644..110252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5632"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /EC_number="4.2.1.32"
FT                   /note="KEGG: reu:Reut_B5650 Fe-S type hydro-lyases
FT                   tartrate/fumarate beta region; TIGRFAM: hydro-lyase, Fe-S
FT                   type, tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S
FT                   type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5632"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74706"
FT                   /db_xref="GOA:B2JUS8"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS8"
FT                   /protein_id="ACC74706.1"
FT                   /translation="MKKVLTTPIKSEDLDDLNVGDVVYLTGRLVTCRDVAHRRLIEQGR
FT                   QLPVDLEGGAIFHAGPIVRKKDDGSFEMVSIGPTTSMRMEKFEREFIEQTGVKLIVGKG
FT                   GMGPETAAGCQEHKAVHAIFPGGCAVLAATLVEEIEDAQWQDLGMPETLWINRVKEFGP
FT                   LIISIDTKGNNLIQQNKASFNEKKKPILERISKELSFIK"
FT   gene            complement(110249..111148)
FT                   /locus_tag="Bphy_5633"
FT   CDS_pept        complement(110249..111148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5633"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; KEGG: reu:Reut_B5651 Fe-S
FT                   type hydro-lyases tartrate/fumarate alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5633"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74707"
FT                   /db_xref="GOA:B2JUS9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUS9"
FT                   /protein_id="ACC74707.1"
FT                   /translation="MDKEASIQSLTDTMAKFTAYIGKRLPKDVKAKLSELRTMETNPLA
FT                   KSIYDSMHGNQEAADKLNRPSCQDTGVIQYFVEAGAHFPLLGELEDILRGATEVATRLG
FT                   PLRHNAVETFDEKNTGTNTGTQIPWLDWRIVPDKDSCTIDVYMAGGGCTLPGAAKVLMP
FT                   GQGYEGVAEFVMDVITERGVNACPPLLVGVGVSTSVETAARLSKLAILRPVDSKSANPR
FT                   AALMEELLEQGLNEVGIGPQGLTGNNSVMGVNIESSARHPSTIGVAINTGCWAHRRGKI
FT                   KINADLSYEILSHEGVVL"
FT   gene            111441..111689
FT                   /locus_tag="Bphy_5634"
FT   CDS_pept        111441..111689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5634"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   reh:H16_B1656 helix-turn-helix XRE-family like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5634"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74708"
FT                   /db_xref="GOA:B2JUT0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT0"
FT                   /protein_id="ACC74708.1"
FT                   /translation="MKRTLLNPQQLGQILRTARRGKGLSQAQAASRVGLSQSRLSALEL
FT                   NPDSITSEQLFALLAMYGLELSVQTRPASAVPSQEEW"
FT   gene            111692..113035
FT                   /locus_tag="Bphy_5635"
FT   CDS_pept        111692..113035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5635"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: bvi:Bcep1808_5110 HipA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5635"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74709"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT1"
FT                   /protein_id="ACC74709.1"
FT                   /translation="MGRPSHARALSVWTNGLRVGTWRIPSRGDMELQYDRDWMASAAGR
FT                   PLSLSLPFGIDDAPLRGERVRNYFDNLLPDSEAIRRRLATRFRTATTDAFDLLEAIGRD
FT                   CVGAAQLLAEDARPEGFDRIDGMPMSDEAIEQMLARTVASGGPGAGGDNDDFRISLAGA
FT                   QEKTALLRHNGKWMRPHGATPTTHIFKLPLGLVGNKKADWTTSVENEWLCLALCRAFGL
FT                   PVPNADILTFGEQKVLAVERFDRRLHPSRKWILRLPQEDFCQVLGKPPHQRYEADGGPG
FT                   MIDIAAVLRQSEQPDDDLATFLTAQILFWMLAAPDGHAKNFSIQLLPGGRYALTPLYDI
FT                   MSIWPVEGDGGNQWSWHKAKLAMAVVGKNRHYLMKDIQRRNFNAMASRCFYGADAEPLI
FT                   ASLIEKTPVAIEQVAAELPAGFPQKVAKRIFDGLRASAERLAAMQPGI"
FT   gene            113172..114086
FT                   /locus_tag="Bphy_5636"
FT   CDS_pept        113172..114086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5636"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_6215 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5636"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74710"
FT                   /db_xref="GOA:B2JUT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT2"
FT                   /protein_id="ACC74710.1"
FT                   /translation="MEIKWIEDFIALAQYQSFSRAAEFRNVTQSGFSRRIQSLEQWVGA
FT                   ELIDRSSFPPVLTPAGQLFREVADDVLNKLFDTRAIIRTEQRIAGKSLQIAAGHTIALN
FT                   FLPSWLKALAAHFGEVRARVVPTNVHDSILMLVNGNCELMFAYHHPELPLHLDPAKYEH
FT                   VTVGIDTLMPATRPNQRSAPMYRLPGTAKQPLPHISYTDTSYFGRCLSLLLGRASSTPS
FT                   LRLHYESDMAEVLKKLVMEGEGIAWLPRSAIAEELDNGELVPAGPSVWNLEIALRVYRD
FT                   ASNRNEFLDSLWQHLRAVSPVSG"
FT   gene            114220..115548
FT                   /locus_tag="Bphy_5637"
FT   CDS_pept        114220..115548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5637"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bam:Bamb_6216 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5637"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74711"
FT                   /db_xref="GOA:B2JUT3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT3"
FT                   /protein_id="ACC74711.1"
FT                   /translation="MTIASRPPCVTQGRMEMKNRLTLTIAAGMVLGVLAGYACHTSLSD
FT                   PATVKAVAGYFSIVTDIFLRLVKMIIAPLVFATLVSGLAGMDSGQDVGRIGLRSVGWFV
FT                   CASLLSLSLGLVLANLLQPGAGLHLIESAGEVNTGLNTSALNVKDVITHAFPTSLLDAM
FT                   ARNDILQILIFSVFLGLALSALKRDERVKIVIQAIDGMVPVMLRLTNYVMRAAPLGVFG
FT                   AIASAVTLRGIDVLYTYGKLIGSFYLGLALLWAILIGMGYLFLGRRIGTLLKCVREPAM
FT                   IAFSTASSEAAYPRLTEQLERFGVDKKVVGFTLPLGYAFNLDGSMMYQAFAAIFIAQAF
FT                   GVDMPVSQQIFMLLVLMLSSKGMASVPRGSVVVVAAVAPMFHLPAAGVAMVLAIDQILD
FT                   MGRTMTNVIGNSVATAVIAKWEGARQPQSDDAHEFDHAEAAAK"
FT   sig_peptide     114220..114354
FT                   /locus_tag="Bphy_5637"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.615 at
FT                   residue 45"
FT   gene            115545..117044
FT                   /locus_tag="Bphy_5638"
FT   CDS_pept        115545..117044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5638"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: bam:Bamb_6217 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5638"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74712"
FT                   /db_xref="GOA:B2JUT4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT4"
FT                   /protein_id="ACC74712.1"
FT                   /translation="MTPVIAERRRKYGIVGGLGPLASADVFFKLVQALPSSTDAGHADL
FT                   IFQQHPFRSAGTGSAATTERKLYIFEMIRNFEKQGVTTVVLPCFLSHTFIDELKTNTSL
FT                   HIVDMVDALRQHIRKRMPGARRIGFLASDFTREKHLFERYFMPPEFEVVYPRLRDGVDC
FT                   VTEAVYGRDGIKGGNLRGRPVELLHGACADLIEQGVDVIVPGMTEIALVADEIRVLSVP
FT                   LVDSNQVYAQQVVSGQYDSPSSVFKVGVVGGVGPAATIDFLNKVVRNTPATRDQDHIRL
FT                   IVEQNPQIPDRTENLIGDGADPTVSLYATCKRLEEGDADIIAIPCNTAHAFVERIQPHL
FT                   GIPIVNMLTETVRFVRESWPGYRDIGVLATSGTISSGVYEKALQSQGLRQVTPGEALQT
FT                   RVMEAIYGNNGVKAGFTTGRCQEDIAAAVEGMIAEGVEIIILGCTELPLLLPLAEFIGK
FT                   NGKRAWLVDPTNVLARRCIAHATAARESARAVSTNSLTLPA"
FT   gene            117087..118526
FT                   /locus_tag="Bphy_5639"
FT   CDS_pept        117087..118526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5639"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: reu:Reut_A1791 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5639"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74713"
FT                   /db_xref="GOA:B2JUT5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT5"
FT                   /protein_id="ACC74713.1"
FT                   /translation="MSSTNERIEHDLLGDLAVPDAAYYGVHTLRALANFPITGIPISTY
FT                   PNLVNALASVKEAAAMANHDLGLLEEHKMKAIVHACREIRNGIAHDQFVVDVIQGGAGT
FT                   STNMNANEVIANLALEHLGHRRGDYAVLHPNEDVNLGQSTNDVYPTALKIATYMGIVQL
FT                   VHAMGVLHHAFERKAQEFRHDLKMGRTQLQDAVPMTLGQEFSTFAVMLGEDEERLAEAS
FT                   KLICEINLGATAIGTGINTSPDYAPLACRHLAGITGIPVVTSPNLVEATQDVGSFVQLS
FT                   GVLKRVAIKLSKTCNDLRLLSSGPRAGFGEINLPPVQAGSSIMPGKVNPVIPEVVNQIA
FT                   FEVIGNDVTVSFAAEAGQLQLNAFEPLIAHSIFKSVAHLRAGCLTLASRCVDGITANRD
FT                   RLHALVESSIGIVTALNPYIGYANATQVAQQALLSGKSVAEIVIEKGLLSRAQLDDILQ
FT                   PAMLTEPRHAPSRRLSTLSDG"
FT   gene            118645..118998
FT                   /locus_tag="Bphy_5640"
FT   CDS_pept        118645..118998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5640"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: bxe:Bxe_B1679
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5640"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74714"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT6"
FT                   /protein_id="ACC74714.1"
FT                   /translation="MNAIRTLKLLGAAFVVVASVNAWAQGSESAAASAPTHGASKSEVR
FT                   KANRALSKKVAQALSKGGVDTTGINVLAKGGAITLAGGVNDPAQIDKATSIAQGVAGVT
FT                   SVKNALTVREGGQ"
FT   sig_peptide     118645..118719
FT                   /locus_tag="Bphy_5640"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(119078..120349)
FT                   /locus_tag="Bphy_5641"
FT   CDS_pept        complement(119078..120349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5641"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bxe:Bxe_A2221
FT                   putative glycolate oxidase iron-sulfur subunit, GlcF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5641"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74715"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT7"
FT                   /protein_id="ACC74715.1"
FT                   /translation="MQTNLDSHAKALPDAEEAESILRSCVHCGFCNATCPTYQLLGNEL
FT                   DGPRGRIYLIKQLLEGEPVSARTQLHLDRCLTCRNCETTCPSGVTYHRLLDIGRAELER
FT                   RIERPIGERLTRKGLRTVIPRPDVFDALLKTGRAVRPLLPASVQAKIPARAAVPAKQRP
FT                   APRHTRRVLMLEGCVQPSLSPNTNAAAARVLDRLGISVTRASEAGCCGATDYHLNAQDA
FT                   GLDRARRNIDAWWPAIAAGAEAIVQTASGCGAFVKEYGHLLRNDPLYAAKAARVSALAR
FT                   DLVEVLAAEPLDALQPADDAIALRVAFHCPCTLQHAQKLGGAVESVLTRLGFDLPAVPD
FT                   AHLCCGSAGTYSITQPELAQKLRDNKLTALESGQPDIIATANIGCQMHLDGAGRTRVRH
FT                   WIELVEEALDASMRPLSSAAAAEP"
FT   gene            complement(120363..121430)
FT                   /locus_tag="Bphy_5642"
FT   CDS_pept        complement(120363..121430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5642"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   bxe:Bxe_A2220 putative glycolate oxidase, subunit GlcE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5642"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74716"
FT                   /db_xref="GOA:B2JUT8"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT8"
FT                   /protein_id="ACC74716.1"
FT                   /translation="MRREFDSMDDSARLVAQVQRAIAEHSPLRIRGSNSKRFLGRDVQG
FT                   EELDTRSHRGIVAYDPTELVITARAGTPLVELNAALDEADQMLPCEPPLFDGQGTVGGA
FT                   VATGLSGPRRPWAGSMRDFVLGCRVITGDGDHLRFGGQVMKNVAGYDMSRLLAGSFGSL
FT                   GVLTEVSLKVLPKPRERRSFALKLGVDDAMRELSAWRKAALPVSGACYIDGELHVRLEG
FT                   GSGSVNSAVDRIGGEEIDCAFWHALRDHRLPFFTDTRPLWRLSLPNATPSMTLPGDALI
FT                   DWAGAQRWLKSEAPAAEIRQLAHAVGGHATCFSPSIEREPFQPLAAPLLRYQRQLKRRL
FT                   DPNGVLNPGRLYADL"
FT   gene            complement(121430..122929)
FT                   /locus_tag="Bphy_5643"
FT   CDS_pept        complement(121430..122929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5643"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /note="TIGRFAM: glycolate oxidase, subunit GlcD; PFAM: FAD
FT                   linked oxidase domain protein; KEGG: bxe:Bxe_A2219
FT                   glycolate oxidase subunit GlcD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5643"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74717"
FT                   /db_xref="GOA:B2JUT9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUT9"
FT                   /protein_id="ACC74717.1"
FT                   /translation="MSYAYDERIDGPLPSHDKSALVAELQRLVPGMQLLHDREDLRPFE
FT                   CDGLAAYRTTPMMVALPDSIEQVQALLKFAAARNVPVVARGAGTGLSGGALPLEQGILL
FT                   VMARFNRILHIDPEASIARVQPGVRNLAISQAAAIHGLYYAPDPSSQIACSIGGNVAEN
FT                   AGGVHCLKYGLTVHNILKLEVMTIDGERLTIGSEALDSPGFDLLALLTGSEGMLGIVTE
FT                   VTVKLLTRPQSAKVLLASFDDVEKAGAAVAQIIGAGVIPGGLEMMDNLAIRAAEDFIHA
FT                   GYPVDAQAILLCELDGAESDVQEDCDRVGALLREAGATDIRIAKDEAERQRFWAGRKNA
FT                   FPAVGRISPDYYCMDGTIPRRELARVLRGIAALSNEYGLRVANVFHAGDGNMHPLILFD
FT                   ANSPGEMERAETLGAKILELCVEVGGSITGEHGVGREKINQMCVQFSSEELKLFHSLKA
FT                   AFDPDGLLNPGKNIPTLHRCAEFGAMHIHRGKLPFPDLERF"
FT   gene            123150..123941
FT                   /locus_tag="Bphy_5644"
FT   CDS_pept        123150..123941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5644"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_A2218 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5644"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74718"
FT                   /db_xref="GOA:B2JUU0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU0"
FT                   /protein_id="ACC74718.1"
FT                   /translation="MVIPVIASTEASGKDADRKIADVVAERIERLIVDGVLRSGQALPS
FT                   ERRLTDKLGVSRTALREGLKLLRARGIIETAHGKGSFVANLTAQPPQSPLMHLLSSQPR
FT                   TLYDLFEVRGMLEAESARLAALRGTPADYMMITRRYEEMLAAHQTDADPATHARLDHAF
FT                   HLAICEASHNPVLVHTLRSLTELLLSSVFASVNNLYHRQPHRKRIDRQHARLYSAVTGK
FT                   LPEQAYRTAADHINSVRDSLQEIEQEEQRLVRATLRLEGWK"
FT   gene            complement(124015..124836)
FT                   /locus_tag="Bphy_5645"
FT   CDS_pept        complement(124015..124836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5645"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hch:HCH_04438
FT                   predicted hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5645"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74719"
FT                   /db_xref="GOA:B2JUU1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU1"
FT                   /protein_id="ACC74719.1"
FT                   /translation="MNSTTASPAFSSATPVIALHCSGSGAAQWRKLGEVLGSRHALVAP
FT                   EHYGCESTGPWSGERAFTLADEAARTVGIIDASSGKVHLVGHSYGGGVALRAALERPER
FT                   IASLTLYEPSAFHLLKTMGSYGTHALAEIIAISKRTADGVSCGDYRGAAASFVDYWGGL
FT                   GAWDALRPSVQAALTRWAPKAPLDFRALLEERTPADAYATLRVPALIMRGQHAPVPTRA
FT                   IAERLPMLLPAARLAVVEGAGHMGPVTHADEVNAAIATHIAGAEVDLCAMH"
FT   sig_peptide     complement(124756..124836)
FT                   /locus_tag="Bphy_5645"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.760 at
FT                   residue 27"
FT   gene            complement(125146..125979)
FT                   /locus_tag="Bphy_5646"
FT   CDS_pept        complement(125146..125979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5646"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: rfr:Rfer_2229
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5646"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74720"
FT                   /db_xref="GOA:B2JUU2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU2"
FT                   /protein_id="ACC74720.1"
FT                   /translation="MSAVDSPFAPVADFAAIKLRQQAAWSTGDYAVIGTTLQIVGENLC
FT                   EALDLRAGSRVLDVAAGNGNATLAAARRCCEVTSTDYVASLLDSGRARAQAEGLKVQFQ
FT                   EADAEALPYADASFDIVMSTFGVMFTPDQQKAAAELARVCKSGGRIGLANWTPDSFIGK
FT                   LFKMIGKYIPPSAGVNSPALWGTKARLDALFDGTARNITATSRDFTFRYRSPAHFIEVF
FT                   RTFYGPMNKAFASLEGERQAAFLADLTALIDDGNRSNDATLVLPSEYLEVVVERR"
FT   gene            127025..128299
FT                   /locus_tag="Bphy_5647"
FT   CDS_pept        127025..128299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5647"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74721"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU3"
FT                   /protein_id="ACC74721.1"
FT                   /translation="MIKRRQFLGSLTALGGGYLMSAYGQAFGAVTSGASPDGTTIPSAS
FT                   VIIDKMGSQWTVKNGVIYRNGLKVGNTYNVSLLLWYGGKIWHIGTGGQFYVCADLDVWL
FT                   PCSDPRVPVAAPAGMFYGINGHYDYTYKPAQLVSILKGIGCTTYRVGCTDDPAQISAVS
FT                   KLAQAFQSNGISLLVLINMGIYDSNGNLFPSESAAYNRGLQAAMSVANALKQYGVTMYE
FT                   CGNELTRQNATILDFTNAGTKAIDFNNLNWPVMRGAMRGMIDGVKAVQSSAKCGINFCV
FT                   ADIGAADALWDGMQPDGTGGHPKVRWDITTWHNYEVYGDIFNIGIDGSGPGFDLPTYCK
FT                   ARYGVPFMITEWNTGPEKTQDYRASYITKTLGNFYQGRKTRNVQSVMYYILDSGDNTFG
FT                   IMKDGVALNPPYSAFASFVSGNPDN"
FT   sig_peptide     127025..127111
FT                   /locus_tag="Bphy_5647"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.400 at
FT                   residue 29"
FT   gene            complement(128598..129278)
FT                   /locus_tag="Bphy_5648"
FT   CDS_pept        complement(128598..129278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5648"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   bam:Bamb_0320 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5648"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74722"
FT                   /db_xref="GOA:B2JUU4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU4"
FT                   /protein_id="ACC74722.1"
FT                   /translation="MLQGLTGPAFLDEGDYLYFLACLADAARVADLAVHAWVLMPDAVQ
FT                   LLVTPSYESSVAMAMQAVCRRYVETFNRRHGRRGAMWRGGYRATVIEPDRYFLLASQVI
FT                   DHAPVRKRLVADPGSYQWSSYTHHIGLRVDSFIKDHPIYRALGDTPLERQQAYRDFSAH
FT                   SLDEREVDNLMQSTLNGWVLGSAAYCEWAAQTANRRLMPLLLRDRPAAQGSRDMRARTR
FT                   GLSK"
FT   gene            complement(129711..130139)
FT                   /locus_tag="Bphy_5649"
FT   CDS_pept        complement(129711..130139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5649"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5649"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74723"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU5"
FT                   /protein_id="ACC74723.1"
FT                   /translation="MQPVDLNPKRKKENPLVWIFEPLERDPEYSRERFFNFQAAYLDGL
FT                   LYLAVASGEEPWNGLVVCTSHDRQAGLLEAFPVLAPHPVLGKWLYVSQRDPEFETVAHQ
FT                   MVKLARERDPRMGVVPGKRKRSPDVIEMKSSSRKKKSW"
FT   gene            130315..131181
FT                   /locus_tag="Bphy_5650"
FT   CDS_pept        130315..131181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5650"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_B0376 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5650"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74724"
FT                   /db_xref="GOA:B2JUU6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU6"
FT                   /protein_id="ACC74724.1"
FT                   /translation="MAKKIETIGIVGAGTMGNGIAQVAAVAGLKVVLIDVTDAALSKGV
FT                   ATLTGSLAKLVEKGKVEAAARDAALTRIETSTDYQRLASADIVVEAATENAELKVRILK
FT                   QIESVVSDDTIVASNTSSISITALAATIGRPERFVGMHFFNPVPLLPLVEVIRGVQTSD
FT                   DTATAVRELTERLGKTPVSVKNAPGFVVNRILVPMINEAFFLLAEGTATAEEIDAGMRL
FT                   GANHPIGPLALADLIGLDVCLSVMDVFLKDFGDSKYRACPLLRELVAAGRLGRKTGHGV
FT                   YRYDPKH"
FT   sig_peptide     130315..130386
FT                   /locus_tag="Bphy_5650"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.327 at
FT                   residue 24"
FT   gene            complement(131193..132059)
FT                   /locus_tag="Bphy_5651"
FT   CDS_pept        complement(131193..132059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5651"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_3914 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5651"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74725"
FT                   /db_xref="GOA:B2JUU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR041496"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU7"
FT                   /protein_id="ACC74725.1"
FT                   /translation="MEQAPSTARDLIVRTMNTNEVNLAIEWAAREGWNPGLHDASCFRC
FT                   ADPKGFFVGEWRGEAVGSISAIAYDGQFGFIGLYIVRPEFRGKGFGLRIWQHGIDYLGK
FT                   RNIGLDGVVAQQPNYRKSGFELAYRNIRFQGIADADASRDEAMLVDARQLPFEQLASYD
FT                   GRFFPAPRAAFLRAWIDQPGAVSLAHIGDGQIRGYGVLRRCREGRKIGPLFADDKHIAE
FT                   ALFTALVARCAGETVTLDVPELNSAAVALAERHRLTSVFETARMYTKRAPDHPLMRLYG
FT                   VTTFELG"
FT   gene            132433..135618
FT                   /locus_tag="Bphy_5652"
FT   CDS_pept        132433..135618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5652"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: bxe:Bxe_B0966 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; histidine kinase HAMP region domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5652"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74726"
FT                   /db_xref="GOA:B2JUU8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU8"
FT                   /protein_id="ACC74726.1"
FT                   /translation="MKRNLFFRLLARLRVGRKLLLIYLLDLSAVVYISGILIHEKYISI
FT                   DFSNKEIVGNAYIGTVSDALIDVAMAGAGRRPPAARLEEAQSELSHTEARYGTHLQSAE
FT                   LNARVRAALDALARERQPTAAQINEALDACRELVTRVGNQSNLILDPDLDSYYAMSLSI
FT                   LRYPALLESVNRIGRQLHEGAHAVRSHDELRTRYLVLEGQLDAVLQGMRSDFSEAGAAN
FT                   HALDSTLGPSMARMLTAVESYRHAARIVVDSTGQVDPALLSIVDVQQQTLVASVRDTWR
FT                   STSVQLDGLLHARVRGLFSRMWLHLGTALFLLCSILGMVYFVAQQISRPLRQLARVMDT
FT                   VRRTGDHAVRANWHSQDEIGQLVRGFNDMLEQLDRERDVQKELAATARASAAQHALVES
FT                   TPVPMMVTAVPGHEVLHANQPALYWLNGCTTDPWAYGLDSSVRARFFQQLSDRDAVDEF
FT                   EVRWKASTEPTWAMLSARRLNFQGRDAVLTAFTPINQIKLMEQRLELWAKVFEASSEAI
FT                   LILDQERRLLTANASFYRATGYRAEDIAGKPPAFIVAGANSGAVITALATLVDRSSSWN
FT                   GEAQIRRRQGGDYPAWLMISAVRDKRGSVSHYICTLIDITDRKKSEARIEFLAEHDVLT
FT                   ELPNRALFTKRLGVVLDNAKHAQQRVAVLFIDLDRFKDINDSLGHHIGDGLLRSVSRRL
FT                   VQAVRSGDTVSRLGGDEFTMVLADAGSAADVARTIDERLLPLVREPHAIGGVTLQVACS
FT                   VGVALYPDDGADIETLMQNADAAMYQAKAAGRNLVKFFSPDMAERARQRLALEACMRTA
FT                   IERRELRLAYQPCLDAQTGALVSVEGLLRWTHPQLGAVTPSQFIPIAEETRLIIPIGAW
FT                   VIDQACRQLARWRNAEMGELRMSINLSAIQLRDADLVETLRHSLVTHGVAPQRLELEIT
FT                   ETVLMDSAENYLDAICAIRALGVKLSLDDFGTGYSSLSYLNRFPLDRLKIDRAFVRDML
FT                   DAPADLAVIKAIIELGHELGLRVVAEGVESEDEANTLRSIGCDELQGFLYSAALSAEEL
FT                   ETWAQQRIEADVE"
FT   gene            135804..135983
FT                   /locus_tag="Bphy_5653"
FT   CDS_pept        135804..135983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5653"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: bxe:Bxe_A3352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5653"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74727"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUU9"
FT                   /protein_id="ACC74727.1"
FT                   /translation="MNRDQLKGVAQQVRGKVNEVVGKATGNRRQQLKGDLQQATGTARK
FT                   AYGDGKAKIRKLGR"
FT   gene            complement(136033..137343)
FT                   /locus_tag="Bphy_5654"
FT   CDS_pept        complement(136033..137343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5654"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_3710 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5654"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74728"
FT                   /db_xref="GOA:B2JUV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV0"
FT                   /protein_id="ACC74728.1"
FT                   /translation="MQPELEARVSRKLMWRIIPFVMLLYFVSFLDRVNVGFAAMTMNKA
FT                   IGLSPTAFGLGGGLFFIGYFLFEVPSNLILHRVGARIWIARVMVTWGIISAASAFVAGP
FT                   TSFYVLRFVLGVAEAGFFPGIILYLSLWFPAKQRAAAAAWFMAAAPISTAIGSPLSGAI
FT                   MQMPPMFGLADWQLLYIIEALPAVVLGFVVLKYLTDAPSKAHWLQADERAWLIARLKSE
FT                   ADERKGHAGHTAGALSALRDPRVLALALIYFGTSAGLYTLGLWAPLIIRQFGFSALQTG
FT                   LLTGIPSVLAVIAMVLWARHSDKTEERTWHVVIPCALACVGFIFAGQAGTALLIVLALV
FT                   VVNVGISAAKAPLWAMPSMFLSGAGAAAGIAMINSVGNLGGFVGPFAIGWLKNVTGGYS
FT                   AGLYVVGATLAVSAAVTLLLSRKAAQQPATGCMRHDH"
FT   gene            complement(137455..138537)
FT                   /locus_tag="Bphy_5655"
FT   CDS_pept        complement(137455..138537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5655"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="4.1.1.73"
FT                   /note="KEGG: bxe:Bxe_C1229 tartrate dehydrogenase; TIGRFAM:
FT                   tartrate dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5655"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74729"
FT                   /db_xref="GOA:B2JUV1"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV1"
FT                   /protein_id="ACC74729.1"
FT                   /translation="MRTYRIATIPGDGIGKEVVPAGKEALEALARTSDAFRFEFENFDW
FT                   GADYYREHGVMMPADGLDAIRDKDAILFGSAGDPDVPDHVTLWGLRLKICQGFDQYANV
FT                   RPTRILPGIDAPLKRCTPEDLNWVIVRENSEGEYSGVGGRVHQGHPLEAATDVSILTRA
FT                   GVERIMRFAFRLAQSRPRKLLTVITKSNAQRHAMVMWDEVALQISKEFPDVKWDKELVD
FT                   ASTARMINRPASLDTIVATNLHADILSDLAAALAGSLGIAPTGNIDPEHRYPSMFEPIH
FT                   GSAFDIMGKGLANPIGTFWSVVMLLEHLGEFDAAKRVMSAIETVTADTSLHTGDLGGKA
FT                   TTAQVTAAVCALVEKTAVAA"
FT   gene            138645..139565
FT                   /locus_tag="Bphy_5656"
FT   CDS_pept        138645..139565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5656"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5439 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5656"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74730"
FT                   /db_xref="GOA:B2JUV2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV2"
FT                   /protein_id="ACC74730.1"
FT                   /translation="MTDTVQPTDLSFFSTLAASGSLSAAARELGLTPAAVSKRLTQMEQ
FT                   RAGVPLVNRTTRRMMLTPEGEVYLEHARRILDEIDALSELLGSARKSPKGLLRVNATLG
FT                   FGRSHVAPAISRFVSRYSQVAVQLQLSVTPPPLTDDAFDVCIRFGEPPDSRVVARRLAP
FT                   NRRLLCAAPSYIAEYGVPLTPHELVRHNCIGIRQGDEAYGIWRLSTGRGAARKTEAVRI
FT                   NGNLTTNDGEIAVKWALEGHGILMRAEWDINEYLADRRLVQVLPAYETPGADIFAVYSQ
FT                   RHQMSARIRTFVDFIAGELRQAREG"
FT   sig_peptide     138645..138725
FT                   /locus_tag="Bphy_5656"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.718 at
FT                   residue 27"
FT   gene            complement(139643..139927)
FT                   /pseudo
FT                   /locus_tag="Bphy_5657"
FT   gene            140298..141599
FT                   /locus_tag="Bphy_5658"
FT   CDS_pept        140298..141599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5658"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bte:BTH_II1169 nitrate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5658"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74731"
FT                   /db_xref="GOA:B2JUV3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV3"
FT                   /protein_id="ACC74731.1"
FT                   /translation="MTVKATSIDLLNWRTPPMRAFHFAWMAFFVCFFAWFACAPLMPLI
FT                   KQEFHLTADQVANINIAAVAITILVRLIVGPMCDRFGPRKVYVALMVLGALPVLGAALA
FT                   HNYTAFLLCRLGIGAVGASFVITQYHTSVMFAGNVVGTANATSAGWGNAGAGAAQMFVP
FT                   LMLAGIVALGASNADAWRLTLVLPGLAMPLMAALYWRFTQDCPQGNFNELRVRGIVVDS
FT                   GKKGSWASLLAASRNYRVWMLFVTYAACFGVEVFIHNVAAIYYVDHFQLSLREAGLAAG
FT                   SFGLLAIFARPLGGLLSDWGAKRRGLSARSMLLFMLIAGEGAGLLLFSQASHAAFAVAA
FT                   MLLFGLFTHMACGATYALVPFIDRKALGGVAGIVGAGGNVGAVAAGFLAKGMGDLHQTL
FT                   MMLGGLVTASAICAVAVRFSAEHTAREAALGATN"
FT   gene            141633..144197
FT                   /locus_tag="Bphy_5659"
FT   CDS_pept        141633..144197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5659"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: bam:Bamb_3936
FT                   nitrite reductase (NAD(P)H), large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5659"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74732"
FT                   /db_xref="GOA:B2JUV4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV4"
FT                   /protein_id="ACC74732.1"
FT                   /translation="MKVIVIGHGMVGHKLLECLAEQSAARLDITVLCEEPRPAYDRVHL
FT                   SEFFSGKSADDLSLVAPGFFDRDDMVLRLNAKAVSIDRHAHTVSTSTGETLAYDKLVIA
FT                   SGSYAFVPPVPGRDRQDCFVYRTIEDLEAMQECGARSKRGVVVGGGLLGLECAKALRDM
FT                   GLDTHVVEFAPRLMAVQVDDGGGKTLRGKIEELGVTVHTQKNTLEIVDGEEGTHRMQFA
FT                   DGSHLDTDMIVFSAGIRPRDEIARASGLDVGPRGGIVIDNHCRTSDADIYAIGECALWN
FT                   GQIFGLVAPGYEMARVTAKQLLGEQDAAFAGADMSTKLKLMGVDVASLGDAHGSTAGSR
FT                   TYQFSDERKQVYKKLVVSECGKYLLGGVMVGDAREYGTLLQMMLNRIELPESPEFLILP
FT                   QADGNAKPALGVDALPESAQICSCNNISKGAICASVCAGATTIGDVKNATKAGTACGGC
FT                   VPLVTQVMKAEMKKQGLAVNNHLCEHFPFSRQELYHIVRVERIKTFGALLEKHGHGLGC
FT                   DICKPAVAGILASCWNEFVLKKEHASLQDSNDYYLANIQRDGTYSVVPRMPGGEVTPEG
FT                   LIAVGQVAQKYGLYTKITGGQRVDLFGARVEQLPSIWEELIAAGFESGHAYGKSVRTVK
FT                   SCVGSTWCRYGVDDSVGLAIDIENRYKGLRSPHKLKFAVSGCTRECAEAQSKDVGIIAT
FT                   EKGWNLYVCGNGGMKPRHAELIASDLDRDTLVCYIDRFLMFYVRTADRLQRTSVWRENL
FT                   EGGLDYLKDVIVHDKLGIAAELEADMRHVVDTYECEWKKAVTDPETRKRFRHFVNSDSA
FT                   DDNISFVATRGQIRPASPDERQQRPVRIPVVVEQSTEPAETA"
FT   gene            144241..144588
FT                   /locus_tag="Bphy_5660"
FT   CDS_pept        144241..144588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5660"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: bam:Bamb_3935 nitrite reductase (NAD(P)H), small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5660"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74733"
FT                   /db_xref="GOA:B2JUV5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV5"
FT                   /protein_id="ACC74733.1"
FT                   /translation="MNNDRLPTTWTSICALDEIVPNTGVCALVNGEQVAVFRVEGERGG
FT                   IYAIDNFDPASQAAVLSRGLIGSLGERVVVASPIYKHHFDLRTGECLEAPDKSVSAFTT
FT                   RIEDGHVWVSA"
FT   gene            144621..148823
FT                   /locus_tag="Bphy_5661"
FT   CDS_pept        144621..148823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5661"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding domain protein; molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase Fe4S4 region;
FT                   flavodoxin/nitric oxide synthase; KEGG: bxe:Bxe_A2212
FT                   putative assimilatory nitrate reductase/sulfite reductase,
FT                   NasA/NapA/NarB/FdhF"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5661"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74734"
FT                   /db_xref="GOA:B2JUV6"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV6"
FT                   /protein_id="ACC74734.1"
FT                   /translation="MACENIKTACPYCGVGCGMVLHVEEGQVVKISGDKDHPTNYGRLC
FT                   TKGQSAHVALRNSGRLESAFERRTRDADPIPVSVDLAIPDTARRLRAILDEHGPDALSF
FT                   YVSGQMSIEAQYLVNKLAKGFIGTNNIESNSRLCMASAGSGYKLSLGADGPPGSYQDFD
FT                   KTNLFFVIGANMADCHPILFLRMMDRVKAGAKLIVVDPRRNTTAEKADLFMQIRPGTDL
FT                   ALLNGLLHLLHANGRTDARFIADFTEGWDAMPAFLDDYTPEKVAAITGIPEADIRQAAQ
FT                   WIGDAPEFVSCWTMGLNQSTHGTWNTNAICNLHLATGKICRPGSGPFSLTGQPNAMGGR
FT                   EMGYMGPGLPGQRSVLVEEDRVFVEDLWQVPRGTLTTKLGSGTVDMFSRMSAGEIKACW
FT                   IICTNPVASVANRQNVIAGLQAAELVIAQDAFLDTETNRYADVLLPGALWAEAEGVMIN
FT                   SERNMTLMQQAIDPPGAALADWQIIARVACEMGFAHAFTYASAAEVFDEIVRASNPKTG
FT                   YDLRGASHARLRETPLQWPCAPDAVEDRNPLRYVNDGVSQTLKLLPDGTRPALAFPTAS
FT                   GKAMFFARPHVNPAEMPGAEFPIVLNTGRLQHQWHTMTKTGKVPMLNRLNPAPFIELHP
FT                   EDAASLGVRDKDRVEIRSRRGRAVLPAVVTERVRAGNCFAPMHWNDVYGDDLCINAVTS
FT                   DAIDAISQQPELKFCAVALTPVEAEPADGVDEPAQDIHEAPVAASAAPLSQVSHDCQQQ
FT                   ELDMSRIDALAAMLGITDTPAPTLDDASRVYVAGFISGMRSSQGDVRGVPTLPPSAPLP
FT                   AAARLWLDGVLAGLFSRAAPDGAAALPSAAHPAADSAPAVRIAHARPKVVLLWASQTGN
FT                   VESLTEQYATQLMESGFEIRMSCMADYPVAALSQAKYVLLMTSTFGDGDAPDNGQSFWS
FT                   ALQADTAPRLADQQYAVLGFGDPSYDQFCGHARKLDVRFAELGAKRLHARVDCGTDIQP
FT                   AADKWLDAVIAKIKEDDASLYAVPAQGVIPAVLPGAAPSKTSPVQSRLVENLRLNRNGS
FT                   KDTRYFSLAVSLATGDSNLEYEAGDALGVWPRNCPELVDELIDLSGVKADASVHVAGVG
FT                   DMRVAEALARHYEIARPSVEALQLIASRSRNDALAKLLTEERKGDLKRWLWGQQLADVL
FT                   HEFPVDLSAGELLGVLKRLQPRLYSIASSPKAHAGEVHLTVAAVRYNNGRRNRKGVSST
FT                   FLADRAHDVSVPVFVQKSAHFRPPRSGDTPMIMVGPGTGVAPFRGFLHERAARGAQGRN
FT                   WLFFGEQHAATDFYYRDEIEGMQKSGLLTRLDLAFSRDQSDKVYVQDRMREQGAQLWAW
FT                   LEEGAHFYVCGDASRMAKDVDAALKEVVAVHGGMSAERAVEYVGAMTKDRRYVRDVY"
FT   gene            148962..149423
FT                   /locus_tag="Bphy_5662"
FT   CDS_pept        148962..149423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5662"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: bam:Bamb_1608
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5662"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74735"
FT                   /db_xref="GOA:B2JUV7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV7"
FT                   /protein_id="ACC74735.1"
FT                   /translation="MKTTAKAEDTNPKLADFLCFAVYSANLAFGKAYKPILEELGLTYT
FT                   QYITVVAMWEEDNQTVSSLGEKLFLESNTLTPILKKLEGMGYLERQRDPEDERQVRVNL
FT                   TKAGRKLREKAFGMDLAQACGLEPDEFSKMQKSIVALRNNLVKAVSEQE"
FT   gene            149882..150169
FT                   /locus_tag="Bphy_5663"
FT   CDS_pept        149882..150169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5663"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5663"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74736"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV8"
FT                   /protein_id="ACC74736.1"
FT                   /translation="MADGSYVYKGLEVCPLVFPHTPTRAGFAHDYDAGFDAAVRIRERS
FT                   DNGLEARSRVFRLNVATPFPSAGDARRASTAYGKLLIDGSTQGDTIWDGD"
FT   gene            150288..150860
FT                   /locus_tag="Bphy_5664"
FT   CDS_pept        150288..150860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5664"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5664"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUV9"
FT                   /protein_id="ACC74737.1"
FT                   /translation="MSRLADLMMQHRSVETEIALRELELNTCRLSIDEQVAAGTSAIPP
FT                   LDTLTFLEAQLRLWKFKRERLRLAIARCATGLLVHAQSASRVGPRTRCPGRKSVSVACR
FT                   EEKHMFDYPGAFHVDPTPRRADGEYIAHARISRSSTDGHEYDVHLSGDLRGFDAREDAI
FT                   RFAAEWATEWLETHCASHQPQSGDHRQ"
FT   gene            150896..151195
FT                   /locus_tag="Bphy_5665"
FT   CDS_pept        150896..151195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5665"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5665"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74738"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW0"
FT                   /protein_id="ACC74738.1"
FT                   /translation="MNAEPLLTLAQYLDLSLDTSGSVIMMQRCDDHCAIYIGDADEDQG
FT                   HWDYRGAIAAPVAGDILKMTRSGPNRIEIGGQKYRFIRSFTHFEDRGATVFSPG"
FT   gene            complement(151202..151699)
FT                   /locus_tag="Bphy_5666"
FT   CDS_pept        complement(151202..151699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5666"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74739"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW1"
FT                   /protein_id="ACC74739.1"
FT                   /translation="MPCISKQRAATSATAVDNDNNLSRVSQAGTSPDNAFDLISREHSK
FT                   FGEQLELMRGFSSRDQGVHAQLVALIVRKIMRAREGIPRYAVERSRDATPSGKCHEQTT
FT                   RPAANQLAIDIQNVAIVSVPQDQVIRSRAQFFRFRGGDSGARESALSRGLSFKRRPAAS
FT                   QR"
FT   gene            152324..153688
FT                   /locus_tag="Bphy_5667"
FT   CDS_pept        152324..153688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5667"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG:
FT                   bur:Bcep18194_B0308 citrate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5667"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74740"
FT                   /db_xref="GOA:B2JUW2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW2"
FT                   /protein_id="ACC74740.1"
FT                   /translation="MQTTSHASGHSRPASTQQAVSKTRFWPEGWWKLMEYRIGIIPLPV
FT                   YLILLALIAGFAVTGKVPGEISMAIAVLAFFGFTCAEFGKRLPILRNIGAAAICATFVP
FT                   SALTYYHLLPKPILHLTTEFTKSTNFLYLFIASIIVGSILSMDRRVLIQGFVKIFVPLA
FT                   VGSIAAAIVGTAVGAAFGLGVRHTLLYIVVPIMAGGVGEGAIPLSVGYSEIMHLPQGEL
FT                   FAQVLPPVMLGSLTAIVLSGALDMLGKRFPHLTGEGRLQVGETDEMDPVKEEITGHIDV
FT                   SHIAAAGITAITLYLLGLMCRNLFGLPAPVAMLFLAVLVKLARAVSPQLQEGAFVVYKF
FT                   FSTAVTYPLLFAIGVAMTPWDKLIAAFTFANIVTIVVTVATLMGTGFVVGRFLKMYPID
FT                   TAIVNACHSGQGGTGDVAILTAANRMTLMPFAQIATRIGGAIVVTMTLILLAHFG"
FT   gene            153762..155633
FT                   /locus_tag="Bphy_5668"
FT   CDS_pept        153762..155633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5668"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bvi:Bcep1808_3572
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5668"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74741"
FT                   /db_xref="GOA:B2JUW3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW3"
FT                   /protein_id="ACC74741.1"
FT                   /translation="MRVTIRGIPLWAWATAAALYFGVAAAAVEFAWNRAIDALAEVGAH
FT                   RLDLYAASLKSELGRFEMMPAIVARQDSVRSMLAAGSRASPELVREVDTYLEAVNNDAG
FT                   SLAVDVIDLQGEVIAASNWNQPLSFVGTNVSYRPYFKDALAHGTGRFFGIGTNTGMPGL
FT                   YFASAVRDAGKPIGAAAVKLSVDALEAAWRAPGEAAMVIDSNGVIVISTVPAWKFTALR
FT                   PITAQQQRDIQASRQYAGRTVDALAYRRVGDGNGTAWLGRFPDWRRAGRSTQFLVMSRP
FT                   APQAGDSLMVLLDVAGARRQQQVALAFVTGAFVIAGLYALYAVQRRRAIAEKLKAQDAL
FT                   RVANDRLEITVAQRTAALTATNERMQQEIVERKRTEQRLRDTQQEVVHAGKLAVLGQMA
FT                   AGLTHELNQPLVAIRTLCDNARTFFERNQPAQAVANLERVGKLVDSMAVLTGELKAFAR
FT                   KPEVERVAVSLTEAVAHARLIYEARIRDEGVRLDVDIPAASTVWAESSQLQQVIVNLLG
FT                   NALDAVRDEHRRIISIHAAQPDASERVLFTIADSGPGIAPEVLAHLFEPFVTTKPRGQG
FT                   LGLGLAITSRIVEGFGAKISAANRTDGGAQFTIEFAAAMSQRVVHDS"
FT   sig_peptide     153762..153842
FT                   /locus_tag="Bphy_5668"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.496 at
FT                   residue 27"
FT   gene            155623..156987
FT                   /locus_tag="Bphy_5669"
FT   CDS_pept        155623..156987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5669"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: bam:Bamb_4692
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5669"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74742"
FT                   /db_xref="GOA:B2JUW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW4"
FT                   /protein_id="ACC74742.1"
FT                   /translation="MTVEIRVLVVEDDENVRFGVEQAVALAGFPVSAFASAAQALAEVA
FT                   PGAPLVIVSDVRMPGIDGLQLLDKVIAIDAQIPVVLISGHADISTAVGAMQVGAYDFIE
FT                   KPFSSDHIAGRVARAVEKRRLTLEVQGLRAALENWQGIEALVLGKSPAMAEVRKKILRL
FT                   ADTSVSVLITGETGSGKELIARSLHDFGSRRDKHFVALNCGGLPEQIFESELFGHEAGA
FT                   FTGAIKKRIGKIEWAHGGTLFLDEIETMPVALQIKMLRVLQERTLERLGANESIAVDCR
FT                   VIAASKADLAALSADGRFRADLLYRLNVAQIELPPLRERREDVPLLFEHFVLAAARRFG
FT                   QPAPVVSASQVSELMTHAWPGNVRELQNVADRFVLGLTGDSLLAEGASAPVKGGSLSDQ
FT                   MAYFERMLIEDMLRRHHGNVAETSEALGMPKKTLYHKLRLLKIAGRDAQGEEVDS"
FT   gene            complement(157281..158870)
FT                   /locus_tag="Bphy_5670"
FT   CDS_pept        complement(157281..158870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5670"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: bch:Bcen2424_5852
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5670"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74743"
FT                   /db_xref="GOA:B2JUW5"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW5"
FT                   /protein_id="ACC74743.1"
FT                   /translation="MLFSFRKPVAVGRSFTPMLALVVAVVCGVCVLVTAALWARHADQA
FT                   AIRERESLIAGDMVASIDRILDSVISRAHSGLATLPGRPCPLVEHRLSELQTYVLYVRS
FT                   VNLVANQNIYCSSALGSIDMPLAAYLSLAPARIELDLIAGTPQQPREPVMPLYVPTSKD
FT                   TGLLYVVEARYLADTLAHGVRYEAGQVVLVVSNARALDAYGEVISAESAAKWKGTRASS
FT                   ARWAFSIVVVAAPAFVTQTHWKYGLLASAAAILVNLLIAAAYLIAFAPRRLLLSAVRRA
FT                   LKHGQLHFAYQPVVEIATRRIMGVEALIRWTHPRWGAVSPAAFMTEVERSSLLASVTRF
FT                   ALQRATEEIMRKTELRPLRIAVNVAPMDLERKDFVADVLAVHATLPADITLVLEVTERF
FT                   LIDKHPRTDVIFNLLKAQGVRFAIDDFGTQHSNLDLLGRFPFDYVKIDGEFVRQVDKQG
FT                   GELIRAIAAVSKHYGMEVIAEGVETQAQHEALRSLGIPYGQGYLYQRPVPASRLFVDTG
FT                   ANVIATKTHVTH"
FT   sig_peptide     complement(158763..158870)
FT                   /locus_tag="Bphy_5670"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.666 at
FT                   residue 36"
FT   gene            159568..161729
FT                   /pseudo
FT                   /locus_tag="Bphy_5671"
FT   gene            complement(162131..162958)
FT                   /locus_tag="Bphy_5672"
FT   CDS_pept        complement(162131..162958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5672"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5672"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74744"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW6"
FT                   /protein_id="ACC74744.1"
FT                   /translation="MMTTRKILMILAGLVLGAALTTYLMVLQADRRATAEATAGMDESA
FT                   SPSAAGSRVSENHVTEGSIGSSTPRASTKDVTVAPQAVTPAPPAPAAPAAAPAPRTAFV
FT                   QQAQPVEPPQPAPPATVATMNVPNAAAPKVVPAPRAQRGRDTLDRRSAYQGATPETEEL
FT                   VRQSSKLDPLLPPPAAAAPPSLNSANMDQHNTYRGSYHAGASQTDQLVRDSAKLDPSLP
FT                   PPDMAAVRAATEQQQRSTTKPVTNASTNPVAAALTEQLVRDSAKLDPSLPPPK"
FT   sig_peptide     complement(162869..162958)
FT                   /locus_tag="Bphy_5672"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.363 at
FT                   residue 30"
FT   gene            complement(163754..164587)
FT                   /locus_tag="Bphy_5673"
FT   CDS_pept        complement(163754..164587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5673"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: bch:Bcen2424_3453 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5673"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74745"
FT                   /db_xref="GOA:B2JUW7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW7"
FT                   /protein_id="ACC74745.1"
FT                   /translation="MNETSSVSRKPFRRLLLTGAGGNLGRQLRDALAAWADIVRVSDIV
FT                   AVSTAAAHEEASVVDLADREAVMQMVEGVDAIVHLGGISIDAPFDDLLEANIRGTYNIY
FT                   EAARKHGVKRVVFASSNHAIGFHPVTDVLDVDAPQRPDSLYGVTKCFGESLSRYYFDRF
FT                   GIETVCLRIGSSFEEPKNPRMLVTYLSYRDFIELVRCSLFTNRVGHAVVYGASDNPVKW
FT                   WDNTKAGFLGFRPRDSSVQFAERFPVTAPTTEYDDPAQRFQGGAFVLGEPMERKA"
FT   gene            164717..165760
FT                   /locus_tag="Bphy_5674"
FT   CDS_pept        164717..165760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5674"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bch:Bcen2424_3452 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5674"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74746"
FT                   /db_xref="GOA:B2JUW8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW8"
FT                   /protein_id="ACC74746.1"
FT                   /translation="MRFLRQSPNANENVTLRMKKVSPTIRDVAVAAGVSVATVSKYING
FT                   AQRFSPAVEARLKESIERLGYRSNPLARSMITGRTRTIGLAILDISNPHFTNVVKGANR
FT                   VALQHDYTLLLVDTEENQARERSLIEALAQRVDGLIISSRMPDEESQWMLELNKPVVLL
FT                   RRSPGLPIPSVGIDNRLATYMLARHLLNLGHRHIAYLGFGQARINDERIRGVRECLDEV
FT                   GLSLDVHDAHAPTAQAGEQACSRVMLGPQRPQAVICYNDLIALGFMKEAASLGFKLPRD
FT                   VSVTGVDNVPYGEYASPALTTVDIQSEKMGELAMQKLIDALAGHGEAEHSMFEPRLIVR
FT                   ESTAACS"
FT   gene            complement(165822..167111)
FT                   /locus_tag="Bphy_5675"
FT   CDS_pept        complement(165822..167111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5675"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bam:Bamb_5234 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5675"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74747"
FT                   /db_xref="GOA:B2JUW9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUW9"
FT                   /protein_id="ACC74747.1"
FT                   /translation="MQSAVVGVVRAASRFRWTVCALLFFATVINYMDRQILGLLAPLLQ
FT                   HEIGWTQVQYGRIVIAFSAFYAIGLLCFGRVVDWLGTRISYAGAMLIWSIAAMLHAAVG
FT                   SVMGFAAVRALLGVGEGGNFPAAIKTTAEWFPRRERALATGIFNSGANIGAVFAPAIIP
FT                   AIAVMYGWRAAFVIIGAIGIVWLAVWLAIYRPADGSVQDEAFDEPRDEVEALDARHANA
FT                   RAPGWGELIKKRETWAFLIGKFLTDPVWWFYLFWLPKWLNESRGMDMQHIGLPLVIIYA
FT                   ITTVGSIGGGWISSALLRKGWSVNAARKTAMLICACCVLPIAFVSQVDNLWMAVGIVGL
FT                   AAAAHQGWSANLFTTASDLFPRRALGAVVGIGGMAGSIGGVLFSEVIGQVLQRTGHYWV
FT                   LFAIGALAYLLALAIMHVLTPRMAPAKLDA"
FT   gene            167439..167768
FT                   /locus_tag="Bphy_5676"
FT   CDS_pept        167439..167768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5676"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5676"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74748"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX0"
FT                   /protein_id="ACC74748.1"
FT                   /translation="MGSTSERRAVSNTEAMATLSEYLELALDRGGHLVMVRNPSGTSTL
FT                   YVGDISALEDELKKCGAILDELADAILESTHSGFNELTVNGSAYRFMRTFTQVGNKGAV
FT                   VFASV"
FT   gene            complement(167898..168056)
FT                   /locus_tag="Bphy_5677"
FT   CDS_pept        complement(167898..168056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5677"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74749"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX1"
FT                   /protein_id="ACC74749.1"
FT                   /translation="MQATLSGRLIAAEVGNMIVIELDRAPSGEAHPIRAYPRQFVIDPH
FT                   GSPKAAG"
FT   gene            complement(168176..168424)
FT                   /locus_tag="Bphy_5678"
FT   CDS_pept        complement(168176..168424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5678"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74750"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX2"
FT                   /protein_id="ACC74750.1"
FT                   /translation="METVNPELIARLVRINPVVIVNGETSRSLRYHGKRNVRALMGFLG
FT                   TYRDMRALVYSHSASGRQMWLDVQTGRVSQLPVPVPN"
FT   gene            complement(168530..171067)
FT                   /locus_tag="Bphy_5679"
FT   CDS_pept        complement(168530..171067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5679"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: reh:H16_B1541 signal transduction histidine
FT                   kinase containing a receiver domain (hybrid) and PAS sensor
FT                   domains; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5679"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74751"
FT                   /db_xref="GOA:B2JUX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX3"
FT                   /protein_id="ACC74751.1"
FT                   /translation="MNASQDRQIDTPDTAALLDRERSTNARLRKLIDAHSRIAAAKLDL
FT                   DRFLSLVTDALLELVPAAHASVVEWVDGEDMVYRACSGTIAQHVGLRLKRDGSLSGLCS
FT                   VEKHLLYSVDTANDTRVDAAACRRVGATSMIVAPLLYQSEVAGVVKLMAGSPGAFSNDD
FT                   IETLERITSLVASGMAHQRVFAENRALIEQNTITIARLRTEISLREAADSKLEASLRRR
FT                   RLVLDTTHDAFVCTDADGIVIDWNDAATRTFGYARDAVMGRPMLDVLFPARCKDRYAEL
FT                   DVFRITPEPNADGPSYRSRTELIARRIDGSEFPAELSACPVHFDGHIELAYFIRDVTER
FT                   FSARELDKRFRVLVDAIKDYAITMLDPHGHITTWSAGSTQVMGYTPDEVLGQSSALFYT
FT                   PEDVAAGRPKRDLELAAREGRIEMEEWRVRKNGTIFWANIITTALRDPNGALQGFAKIT
FT                   RDMSRRRRLEELEASSQRMSQFLALLGHELRNPLAPLRNAVSMLQLKSASHGAFVPEHE
FT                   LIDRQLSHLTRLVDDLLDAGRVTLGRVQIEPKPVSMQAIAQLSIEGSAPLLATRNQTLD
FT                   VVMPDTPMYIEGDLTRMVQVVQNLLNNASKFSPPGASIGLQAFRSGRLLAIRIHDSGRG
FT                   IDRDAIDAIFNLFVQETPTQEQADKSGLGIGLTLARAIVDLHGGHIDAHSEGRGKGSVF
FT                   TVWLPECSRAIADEGQRDEAPGPTRPVDLKVMVVDDNVDSADSMATLVQVLGHEAHAVY
FT                   DGAAAIELARKLQPHLVLLDLSMPKMTGFDALPHIRQAIAAPGAVIAAMTGLGTSEDRV
FT                   RTEAAGFDLHLTKPVGLPDLESVLQIAVAHVRD"
FT   gene            complement(171403..172344)
FT                   /locus_tag="Bphy_5680"
FT   CDS_pept        complement(171403..172344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5680"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_B5829 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5680"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74752"
FT                   /db_xref="GOA:B2JUX4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX4"
FT                   /protein_id="ACC74752.1"
FT                   /translation="METQNIEDLWTHLHWLTMLAEQGTYTAAAARLGVSKAAMSQRISE
FT                   LERAAGISLVQRTTRSVRLTEAGQQLVDATRGQYAQIAASFAQVRELSGVPRGQVRVTA
FT                   PVAFARQQLVPKLPEFLSANPAVRVQLEVSDRLVSLATEGFDLAIRHTAEPPDTHVAWK
FT                   LCDTRSVIVATRAYLRKRGMPKSPDELASHDCLFYPRSMGEPMWSFERKSARKNTARPV
FT                   ALPVKGPFCANNSETLRDAALESLGIALVPDFTAQAAVQAGKLVVVLPDWRVTGAFAEQ
FT                   LYILRPYASHVPRAVGLFVGYLRERFAQGFPV"
FT   gene            172456..173967
FT                   /locus_tag="Bphy_5681"
FT   CDS_pept        172456..173967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5681"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: reu:Reut_B5828
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5681"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74753"
FT                   /db_xref="GOA:B2JUX5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX5"
FT                   /protein_id="ACC74753.1"
FT                   /translation="MQAYTDSADVGHFIHGQRVSGTGTRSQAVFNPATGARARKLLLGE
FT                   AADVEAAVASAKAAFPKWADTPPIRRARVMLRFLELMNRHRDELAAIITAEHGKVFSDA
FT                   QGEVSRGIDVIEFACGIPQLLKGDYTEQVSTGIDNWTMRQPLGVVAGITPFNFPCMVPC
FT                   WMFPVAIATGNAFILKPSERDPSAALFMAGLLKEAGLPDGVFNVVQGDKVVVDALLTHP
FT                   DVKAVSFVGSTPIANYIYETGAKYGKRVQALGGAKNHMVVMPDADLDKAVDALIGAAYG
FT                   SAGERCMAISVALLVGDVADKIMPKLAERARTLIVKNGMEADAEMGPIVTRQALERIEG
FT                   YIAEGVKEGATLVVDGRGLKVPGHEDGFFTGGTLFDHVTPQMRIYKEEIFGPVLACVRV
FT                   KDFTESVELINAHEFGNGVACFTSDGHIAREFGRRIEVGMVGINVPIPVPMAWHGFGGW
FT                   KRSLFGDTHAYGEEGVRFYTKQKSIMQRWSESIEKGAEFAMPTAK"
FT   gene            174229..174426
FT                   /locus_tag="Bphy_5682"
FT   CDS_pept        174229..174426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5682"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74754"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX6"
FT                   /protein_id="ACC74754.1"
FT                   /translation="MKRESANFRNIDDHSGAGVRVRVEAVSSDKAQAAAVPRNWAWAHF
FT                   SDSYDWMDLHSPAVVNSLLD"
FT   gene            complement(174500..174925)
FT                   /locus_tag="Bphy_5683"
FT   CDS_pept        complement(174500..174925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5683"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bur:Bcep18194_C7670
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5683"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74755"
FT                   /db_xref="GOA:B2JUX7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX7"
FT                   /protein_id="ACC74755.1"
FT                   /translation="MSLEKALYTAHATATGGRDGRATVPDAGLDFKLTTPKELGGKGGE
FT                   GANPEQLFAAGYSACFIGAMKFVAARDKIAMPADASIDSSVGIGTIPNGFGIEVAMKIS
FT                   LPGMDRDAAQDLINKAHVVCPYSNATRNNIDVTLTLV"
FT   gene            complement(174973..175209)
FT                   /locus_tag="Bphy_5684"
FT   CDS_pept        complement(174973..175209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5684"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: bja:bsr5938
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5684"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74756"
FT                   /db_xref="GOA:B2JUX8"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX8"
FT                   /protein_id="ACC74756.1"
FT                   /translation="MPIVTIQVTREGTTPGADCVSAEEKAQLIEGVSQLLLEVLHKPLE
FT                   STFVVIDEVPTENWGWGGLPALEYRKLKASKQV"
FT   gene            175507..176520
FT                   /locus_tag="Bphy_5685"
FT   CDS_pept        175507..176520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5685"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /EC_number="3.5.99.7"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bur:Bcep18194_C6869
FT                   1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5685"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74757"
FT                   /db_xref="GOA:B2JUX9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUX9"
FT                   /protein_id="ACC74757.1"
FT                   /translation="MSIAPDLDLTAFSRYRLMEGPTPIQHLGRLSKLAGNVDIYVKRDD
FT                   LMGLGGGGSKLRKLEFLLGEALAQGADTIVTVGARQSNHARLTAAAAARAGLACEIVLT
FT                   RTVPRDDNDYLHNGNVLLDQLLGARIHDLPGHADAMAFAQHRAEDLRKSGRKVYLAPLG
FT                   GSSAVGNLGYAACAAELLGQAREAGVSFDRIALPNGSGGTHAGLVAGLLSMGEDPARVV
FT                   AYNVLATHESTLANTRLKAQQTLELIQPAAILPISGVIVADGQRGDGYGIPTDAMREAV
FT                   RLLASTEGLLLDPVYGGKAFAGLLQDIRSQAFAPGSKVLFLMTGGLPGLYAYRSAF"
FT   gene            complement(176560..177120)
FT                   /locus_tag="Bphy_5686"
FT   CDS_pept        complement(176560..177120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5686"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   mms:mma_3329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5686"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74758"
FT                   /db_xref="GOA:B2JUY0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY0"
FT                   /protein_id="ACC74758.1"
FT                   /translation="MYSRFKTLATVVAVAAIAALGAVVANSGAATAVPVDKNRAAPEFT
FT                   GINQWLNSRPLTMQQLRGKVVLVDFWTYTCINCVHTLPHVEKLYEKYKDQGLVVIGVHT
FT                   PEYAFERETKKVSAAIAEYGLHYPVAQDNSYATWNAYGNQYWPAVYLIDKQGHIVYSHF
FT                   GEGDYDQIDAAVREQLARPGQAG"
FT   sig_peptide     complement(177022..177120)
FT                   /locus_tag="Bphy_5686"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.646 at
FT                   residue 33"
FT   gene            177586..178473
FT                   /locus_tag="Bphy_5687"
FT   CDS_pept        177586..178473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5687"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: acr:Acry_3308 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5687"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74759"
FT                   /db_xref="GOA:B2JUY1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY1"
FT                   /protein_id="ACC74759.1"
FT                   /translation="MDVADLKVFEAVARHGSMNRAAVELHTVQSNVTARIRALEREIGV
FT                   ALFQRHVRGVSLTPAGQRMLPYAARIAKVLADARLAALDDGPPAGALALGTLETTAALR
FT                   LSPILSHFAGIYPDVRLSLTTGTSCSLTEDVAACRLDGAFVAGPIDHPDLHAEMIFQEE
FT                   LVLVTSRNVRSIDALPASPDLKTIVFRLGCSYRQRLEALLAEKGIVTATPLEFGSLDAI
FT                   VACVAAGIGVTLLPRGVVASAAERGIVALHALPPEKAQVATLFIRRHDAYVSSAMQAFV
FT                   EVTRSQLDPVMAAA"
FT   gene            complement(178505..179452)
FT                   /locus_tag="Bphy_5688"
FT   CDS_pept        complement(178505..179452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5688"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B1227 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5688"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74760"
FT                   /db_xref="GOA:B2JUY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY2"
FT                   /protein_id="ACC74760.1"
FT                   /translation="MDQLYMLRAFVSAAQHQSFSKAAASLGVTTGSISKAIAKLEASIQ
FT                   TRVLHRTTRSVTLTEEAQSYYLSCCRLLEELDEANRRIMREREVDSGKLRLVIHPMLVS
FT                   DTFSQFLSSYREVAPNVNLVVSVHEGAVNLYDGQFDMAMLPPHQVEQSAVIRRTLFRSS
FT                   RSLVASADYLARRGTPRRAADLSEHFLLLPTQSRQRNTNYVQMIENDEPVQVIPMSSMD
FT                   GNDVLLRAAALAGAGIAELPEAIARDDMASGKLVPVLPNCSISDSEVEVCLFYSHRELL
FT                   PARFRTFVDFCTDFFRVNGARRRAPLLDMEQQAA"
FT   gene            complement(179603..180148)
FT                   /locus_tag="Bphy_5689"
FT   CDS_pept        complement(179603..180148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5689"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: amr:AM1_1232
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5689"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74761"
FT                   /db_xref="GOA:B2JUY3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY3"
FT                   /protein_id="ACC74761.1"
FT                   /translation="MASIAHEGVRLCLGAFHVLLLRSDAASRKPRPEHCTGSLDMTTQA
FT                   LTAGIDHVGLSVRDLNLTRDFFVECLHWTQVGERPEYPAVFVSDGHVMLTLWQVTNQDR
FT                   RVEFDRKSNVGLHHLALRAGSEAAFDEIFRRVSQWPGVQVEFAPENLGAGPKRHTMIYE
FT                   PGGIRLEFDFDPRLQAAG"
FT   gene            180358..181284
FT                   /locus_tag="Bphy_5690"
FT   CDS_pept        180358..181284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5690"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   bxe:Bxe_C1386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5690"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74762"
FT                   /db_xref="GOA:B2JUY4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY4"
FT                   /protein_id="ACC74762.1"
FT                   /translation="MPLVPLSQREVTIGVPLPFSVYTEDGRLLMARGHIVHSAEQCERL
FT                   FSLGPFRHLLPGERRNDALAAQENAAAAPAARARRDHDEQTFVGPFPHAGCTPEDFVIT
FT                   LANGPAISSRTRFVGVLDDASLLLSGKDVDPAFAPGEAIEGQFIAGRYRHAFESEVVGR
FT                   HATPFDVLYLRYPTEVRSRALRRHVRIGIDVTAQLSRNDRPMAGTEVRAVDLSAAGVGL
FT                   LVNSNSLAPGEHFKLSLPLARAGCVRTAPLNCIARNRRTKGGKTLVGAEFGNTSGDVRA
FT                   LVKDYVMDVLTGAMPAERNPLRNGGFA"
FT   gene            181520..181903
FT                   /locus_tag="Bphy_5691"
FT   CDS_pept        181520..181903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5691"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bvi:Bcep1808_3954 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5691"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74763"
FT                   /db_xref="GOA:B2JUY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY5"
FT                   /protein_id="ACC74763.1"
FT                   /translation="MHNHPIASVIDDDESVRTAMSSLVRSLDWDVRLYASAEAFLASGI
FT                   ASNVACIISDVQMPGMSGLDMYRHLLEMGVTQPIIFISAFASDAVRRQALDLGAMCVLT
FT                   KPVDGGEVSRCLAKVGPGSASGE"
FT   gene            182149..184350
FT                   /locus_tag="Bphy_5692"
FT   CDS_pept        182149..184350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5692"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pfo:Pfl_2251 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5692"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74764"
FT                   /db_xref="GOA:B2JUY6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY6"
FT                   /protein_id="ACC74764.1"
FT                   /translation="MMFRQGAGIPSPRDARFLFALAAVIGVIVFVIDALTPLDIAIAVL
FT                   YVVVVLLVASTGSRQATIATACASVVLTLVAFMMSHDTNYSGGSIARCIVSLLAIGTTS
FT                   FLALRNQGNTARLQEQIQLLNLTHDAIVAYDMSDRITFWNQGAEELYGWTASQAIGQRI
FT                   HELTRTSSSIPVDELRDEVVREGRWEGELQRVRSDGSTVVVSSRFALWRDDKGRPRAVL
FT                   ATNNDITVRKRMEAELQRQQEELRATVDAIPGLVWSSSRDGELSYINRRWNELGITLTG
FT                   NSGDVWTSIVHPDDWPAMHAAWRGAIATGKPFENVSRIRQSNGAYRWMHIGAEPLRDQD
FT                   GRILRWYGVNTDIEERKQAEQALERSEAFLCDAQRLSRTGSIATRLPTGEMWWSDEVYR
FT                   IFEYSPDYMPAMQLILARTHPDDLALVRDAYAAGLSGAPYVDVEHRLQMPDGRIKYVHY
FT                   VAHLAAPQSASSEYVGALMDVTERQLAQDALDRSTAELAHVTRVTMLGELAASIAHEVT
FT                   QPLAAIVTAGDAANRWLNRAKPDLGEVGQSISQMVRDAKRASDVIRQIRAMAQKRDPSQ
FT                   TVLDLNAIVRESIELVRRELDAARVELEASYAEPPLFVCGDRVQLQQVVINLVMNGVQA
FT                   MAGVTGRTRRMRIGTRRVDGRYGQVAVEDSGTGISKESVGRLFNAFFTTKADGMGMGLS
FT                   ICRSIVEAHGGRIWAESEAGQGATMQFVLPIDKGTCDEQ"
FT   gene            184340..185014
FT                   /locus_tag="Bphy_5693"
FT   CDS_pept        184340..185014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5693"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: bch:Bcen2424_5186
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5693"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74765"
FT                   /db_xref="GOA:B2JUY7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY7"
FT                   /protein_id="ACC74765.1"
FT                   /translation="MSSDEMNDVNPSIVYVVDDDDSMRAAVSMLLRSVGLRVEAFASAQ
FT                   EFLSFDKPDMPSCLILDVRLKGQSGLAVQEQIASGDVHVPIIFMTAHGDIAMSVKAMKA
FT                   GAMDFLAKPFRDQDMLDAVASALAKDEERRKSERSVSDLRRMYESLTPREREVMAFVAS
FT                   GLMNKQIAAEMNLSEITVKIHRGQAMKKMESRSLADFVLKAEALGVKSLDSSTSTRTQR
FT                   GS"
FT   gene            185371..186330
FT                   /locus_tag="Bphy_5694"
FT   CDS_pept        185371..186330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5694"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bvi:Bcep1808_3764 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5694"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74766"
FT                   /db_xref="GOA:B2JUY8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY8"
FT                   /protein_id="ACC74766.1"
FT                   /translation="MTTTMPDLPAPLADVVSRRPASPIVAEQQWRRMNGPAFDMAARRD
FT                   NVVVARWTHAGNAPLAVENEGSVADHCIGLNLKCAALTFDHAGRRLVHGRLTAGAAQVT
FT                   APGVPTKAVFASSADVLHLFVSQQVLGECYEDLFQHSRDGDIVLDDPELIRDPVLERLG
FT                   QALAVSQSNDASLGKIFTDSVSLAIVSRVVARHFAGATRRTREAAPLPQWRMNRVIEFV
FT                   DAHLAEPIGLAEIASSAGLTRMHFAAQFRRATGLRPHEYLLRRRVEHAQHLLVTSKHNV
FT                   MDVALSCGFRSQAHFTTVFKKFVGETPHRWKEMTNGAR"
FT   gene            186398..186784
FT                   /locus_tag="Bphy_5695"
FT   CDS_pept        186398..186784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5695"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74767"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUY9"
FT                   /protein_id="ACC74767.1"
FT                   /translation="MLANANATDPWTQTIGLLSTPYRLMAAAKGTAQSRRNAHCADGRF
FT                   GAAVTLIDRPTPSTATIAWRDSTRGCFGDQVWRMARARISGFCAMSGQPIRPGDAVYKP
FT                   NPRPAPVNGDAMILACVLRDTATL"
FT   gene            complement(186890..187879)
FT                   /locus_tag="Bphy_5696"
FT   CDS_pept        complement(186890..187879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5696"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   bvi:Bcep1808_3760 cytochrome bd ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5696"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74768"
FT                   /db_xref="GOA:B2JUZ0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ0"
FT                   /protein_id="ACC74768.1"
FT                   /translation="MDSTTHSLLAYVWFGLLGLMLAFYVVTDGFDLGVGILSLLRARRA
FT                   DRDVMVESIGHVWDANETWLVVLGGGLFGAFPLAYAQLMQDLYSPVMALIAGLIMRGAA
FT                   IEFRHSVEHGPLWDKVFGIGSLIAALAQGVVLGKVITGLVPGEMNNVFVIVAATGVVAG
FT                   YALLGATYLVKKTVGMIEQWSRRLALLSAMLTVAAALLLTTATWFFSDVGSERWSRPGV
FT                   MHLLIALGIAAAFAFAFIMVSLYLGSSRGPFRGAVTLFVVSFAGLAVSLFPDFVPGKLG
FT                   IVQAASDSHTLAFMLAGIGLIFPVMIGYNLYQYYIFRGKVAGGAHAGE"
FT   gene            complement(187910..189313)
FT                   /locus_tag="Bphy_5697"
FT   CDS_pept        complement(187910..189313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5697"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bvi:Bcep1808_3759 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5697"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74769"
FT                   /db_xref="GOA:B2JUZ1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ1"
FT                   /protein_id="ACC74769.1"
FT                   /translation="MLDHVANLSRAQFAMTAIFHILWPILTISLSAFLVLVEALWIKTG
FT                   DVMYYRQARFWSKLLVLNFAVGVVSGIPMEFQFGTNWAGFSQYSGQFIGNILGFEGAMA
FT                   FMLEAGFVGVMLLGWGRVPRGVHLFATSMVALGSSISAFWIMVANSWMQTPAGYAVVNG
FT                   KIEVTDYLVAIFNPDMVWGVSHMWVAAIETGMFVIAGISAYNLFRKRHPEFFARSFKIA
FT                   LSVLVVAAPLQIWLGDSSGVSVFETQPAKGAAIEGHWHTNASGTGASWSLLAWPDQKAQ
FT                   RNDWSLEVPGMLSVLGTHSLHGQVKGLTDFAREDQPPMIPLLYYAFRAMAGIGLCFMLL
FT                   AFWTAYALRKARGSLDALLARRKLLLAWVLCIPLPYVAVEAGWIVREVGRQPWVVYGLL
FT                   RTSQAASTVAPSAVSLSMAMFFAFYAVLLVTFFVLACRWLRKGPDLTSLPPAIDAARTA
FT                   AAPTSVSGY"
FT   gene            complement(189306..191663)
FT                   /locus_tag="Bphy_5698"
FT   CDS_pept        complement(189306..191663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5698"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: bvi:Bcep1808_3758
FT                   oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5698"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74770"
FT                   /db_xref="GOA:B2JUZ2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ2"
FT                   /protein_id="ACC74770.1"
FT                   /translation="MGKKKVIRIYSDPAGGWGALKATGEALALQGIPVSGARTLLRMNQ
FT                   PEGFDCPGCAWPDPKHTSSFEFCENGAKAVAWEATANRCTPEFFASHSVSELAAWDDYD
FT                   LEMAGRLTHPMVYDGKSDRYVPIRWEDAFALVGRHLNALDHADQADFYTSGRASNEAAF
FT                   LYQLFVREFGSNNFPDCSNMCHEATSVGLPQSIGVGKGTVLLEDFEHADAIFIFGQNPG
FT                   TNSPRMMSDLHSAARRGAKIVSFNPFRERALERFASPQDPVEMATLGYTSISAFLYQVR
FT                   VGGDVAVLKGMMKAIVAADDAALAADAPRILDIEFIEGHTHGIDALLDDLRATPWDAIE
FT                   RYSGLSRADIENAANLYMQAQNAILVYGMGITQHHRGTENVQQIANLALLRGNVGRPGA
FT                   GICPVRGHSNVQGNRTVGITEKPGEALIDGIERAFGFRAPSGHGNDVIATLEAMMRGDA
FT                   KVFVALGGNFASAIPDWVRMQEHIRKLDLTVHIATKLNRSHLVHGKAALILPCLGRTEI
FT                   DVQADGPQSITVEDSMSMVHASAGRNQPASPHLLSEPAIVAGIARATLGEQSRVPWEQM
FT                   VANYDRIRDAIEIVFPIFQAYNERIRVPGGFHLVSPARERVWDTPTGRANFLVFKGLDE
FT                   DPWQDDPDALWLTTMRSHDQYNTTLYSHSDRYRGVFGQRDVVFMNQHELQKRGLHPGER
FT                   VDLVALSTDGIERVIRSFKVVEYSLPNGCCGAYYPEVNPLVPLYAFDPQSRTPSYKSVP
FT                   VKIVRAAAVGPDSAPRAIAVPPASQREETRHA"
FT   gene            191805..192014
FT                   /locus_tag="Bphy_5699"
FT   CDS_pept        191805..192014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5699"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5699"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74771"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ3"
FT                   /protein_id="ACC74771.1"
FT                   /translation="MEAHMSSTKKELNPTSEKPEHRVDEAIEDTFPASDAPAQGGTTRI
FT                   ESDDEANEDKANEDKPDRSGSGGS"
FT   gene            192085..193002
FT                   /locus_tag="Bphy_5700"
FT   CDS_pept        192085..193002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5700"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bxe:Bxe_C1291
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5700"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74772"
FT                   /db_xref="GOA:B2JUZ4"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ4"
FT                   /protein_id="ACC74772.1"
FT                   /translation="MDTNRERPTSRLQAVHRKVTVVGAAKDTIGRFSNHRCAMMGSSIA
FT                   FYCAFSLAPTLLIVLAVLGWFFGQDAAQGRLFGQVKDIVGTEAASAMQAIVEHAHRSHA
FT                   GGFAALISVVLLAVGASATFSSLNTALDVVFAVRAPKGIAGVALLLRARLVSLGLVMGL
FT                   AFLLVVSLVVDVAIQTVGSMLFGTDALNAFADAAQSVFGLALLTVGLGALIKWLPDTHV
FT                   AWRPAVVGGFVAAFLFTAGRHLFVLYLAHAGTAGAFGAAGSLAVLMMWLYFCAVVFLLG
FT                   AEVTATLGGAPHDEAAFEHETAHR"
FT   gene            complement(193028..193378)
FT                   /locus_tag="Bphy_5701"
FT   CDS_pept        complement(193028..193378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5701"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74773"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ5"
FT                   /protein_id="ACC74773.1"
FT                   /translation="MRTLAFPRFRATYVIAACSVGLATTCAYQAPGLMQAILVVGANAQ
FT                   LPLERLAAQADLQPPVSDAAVSSTAWKQHPAAQARPAAQKLDDSGQTMRARRGHSETHG
FT                   YEHSVTDYKYWT"
FT   sig_peptide     complement(193289..193378)
FT                   /locus_tag="Bphy_5701"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.747 at
FT                   residue 30"
FT   gene            complement(193378..194340)
FT                   /locus_tag="Bphy_5702"
FT   CDS_pept        complement(193378..194340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5702"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_1412 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5702"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74774"
FT                   /db_xref="GOA:B2JUZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ6"
FT                   /protein_id="ACC74774.1"
FT                   /translation="MDKILSMRIFSRVVESGSFSAVAEHMNCSTGSVSRAVSSLEDQLQ
FT                   ARLLQRTTRKISLTEPGERYYQKCKKILADLEDAEAEAGDAHTCARGTLRIHCVTDLGL
FT                   AQLTHSIIEYRKRFPAVSVQLKFLPRMANLLEDEVDVSIVSAPTLPDSRNVCKLIGHCE
FT                   RVLVASPAFLQTHRIDMASDLDEHALTPVSFRVEPGDHHVRLSLVKSASREAAGQFAVN
FT                   DTEATRIATLAGAGVAALPTHCVADDIRDGRLVQLFPESRLQNTGVFAVYSSRHHIDAK
FT                   IKTFVDFLTSHLGATLDTRLFNEHSNQTFNRLARVVENA"
FT   gene            complement(194576..196846)
FT                   /locus_tag="Bphy_5703"
FT   CDS_pept        complement(194576..196846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5703"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: bam:Bamb_5820 putative
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5703"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74775"
FT                   /db_xref="GOA:B2JUZ7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ7"
FT                   /protein_id="ACC74775.1"
FT                   /translation="MSHADDDFNEGRRRFMASGALFVTFSLFPGARALGQQVIADEGAA
FT                   VHISKETQALAGSLKTNPFLDAWIKIDPAGKVTVYTGKVELGTGVRTALLQIAAEQLDM
FT                   APALITFLTADTSASPDEGLTAGSHTIADSGTALLNAAAQVRGLLVDAAAKSLHVERGK
FT                   LTTRDAVIHAPDGRTVTYGDAVGLVDLHRMASPVSPLKDPKTFFVIGQSLPRVDIPAKV
FT                   TGGASYVQDMSLPNMVHARIVLPPVYEAKLLRDNAAQVMSMPGVLKVYRNGSVLAVVAR
FT                   GEWQAVAAQRALSAGSEWSAGRTLPDPATVHRDLGTLCTQHLEIADTHAQDGAPAAVKT
FT                   LNARYSKRYMLHGSIGPSCAIASFDDGHMTVWTHSQGVYPLRDALAEMLSMPKDAVRCI
FT                   HVEGSGCYGHNGADDVAAHAALIARDMPGHPVRVQWMREQEHSWDHFTPAMVAQARASL
FT                   DATGRIVDWDYALWSSSHNERIVNAGRLVPATMLASPFKPAPSVPMVQPEGGGDRNAIP
FT                   LYTFPNLHVMNHFSPTMPLHTSAMRSLGAHLNLFSIESFMDELALAAHADPVAFRLKHM
FT                   QDPRARDVIRLAAQKFGWPRPPRKPNHGVGFAFGKYKNLMAYVAMAVEVSVVRETGQVV
FT                   LERAEVAVDAGQIVNPDGIRNQIEGGVVQSASWTLYEQLQFDTQRIRSFDWSSYPILRF
FT                   SAVPHSLNVHLLDRPGAPFLGAAEAAMGPTAGALANALFDATGYRARDMPLAGDGLRGH
FT                   IDA"
FT   gene            complement(196843..197337)
FT                   /locus_tag="Bphy_5704"
FT   CDS_pept        complement(196843..197337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5704"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: bvi:Bcep1808_6385 (2Fe-2S)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5704"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74776"
FT                   /db_xref="GOA:B2JUZ8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ8"
FT                   /protein_id="ACC74776.1"
FT                   /translation="MIHLTVNGVHHTLDIDPSTPLLYALRNELGLHGAKFGCGLGQCGA
FT                   CTVIVDGQATFSCLIPVASIGTRQVRTIESLGTAQHPGALQQAFIEHQAAQCGYCIAGM
FT                   IMRAQALLERNPRPTEAELREHMEPNLCRCGTHMRILAAIRQVAQLNGDRTDAHAHGDP
FT                   Q"
FT   gene            complement(197334..198635)
FT                   /locus_tag="Bphy_5705"
FT   CDS_pept        complement(197334..198635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5705"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="PFAM: cytochrome c class I; KEGG: bch:Bcen2424_6358
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5705"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74777"
FT                   /db_xref="GOA:B2JUZ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JUZ9"
FT                   /protein_id="ACC74777.1"
FT                   /translation="MTRVSIMRNPLALAVAGVAIAAALVAGLLMWRPAIAPISPPSPSS
FT                   FDSQTKLAGARVIALGDCIVCHTAKGGKPFAGGLPLATPFGTIYATNITPDPGTGIGTW
FT                   SLEAFTRAIRQGVSRDGHLLYPAFPYIHFTHMSDTDIAAAYAYLMTREPVAATAPANAL
FT                   MFPLNFRPLLAFWNALFLRPGEQQAGAAKDAEWNRGQLLVNGLGHCASCHSPLNMIGGE
FT                   QPGHAFDGGVVDGWDAPALNMLGAAPKPWTKAQLAAYLRTGRASEHGAAAGPMLPVTRD
FT                   LATVPAADVEAIAAYILSLQKPVAAPDRARAIPAGAGPMTAAQQRGATLFAASCAQCHG
FT                   NAAPMQSLGQRPTLAFSTAVNADTPRNAIQMVLGGIAWHGEDTLNYMPAFGNVYTDEQI
FT                   ADLLSYVRATYSQRRAWTDIEATVAKIRKENDAR"
FT   sig_peptide     complement(198555..198635)
FT                   /locus_tag="Bphy_5705"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.535 at
FT                   residue 27"
FT   gene            complement(198692..199897)
FT                   /locus_tag="Bphy_5706"
FT   CDS_pept        complement(198692..199897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5706"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bxe:Bxe_B2392
FT                   putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5706"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74778"
FT                   /db_xref="GOA:B2JV00"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV00"
FT                   /protein_id="ACC74778.1"
FT                   /translation="MKHQPLPRAVVIGGSLGGLFAATSLRAAGWHVEVFESSPNQLDTR
FT                   GGGIVLQPDVLQAARYAGAALPSPAGVRSGERIYLDRGDNIVERLDMPQTQTAWSLLYR
FT                   AMKDALPAQSLHAGETFVDFEQDGDEVVARFESGRAERGDLLIGADGIRSTLRQRLLPD
FT                   VTPAYAGYVAWRGLVPEQALPAPAADMLRERFAFQHGDGHSALAYLIPGERDETRVGER
FT                   RWNWVWYRRYSEDVLTRLLVDRYGMARTGSLPPGMMKQADIDRLRNDAQAELGPTFRAL
FT                   VDSTADPFMQPIVDLRAPRMVFGRALLIGDAAAVPRPHTAGSTAKAAANAHSLALALDL
FT                   ANGSGLSIDERLARWEALQVQRSKQMTDLGISLGKRLMTVAPPLSQRFSAASGISIQTP
FT                   IR"
FT   sig_peptide     complement(199814..199897)
FT                   /locus_tag="Bphy_5706"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.963 at
FT                   residue 28"
FT   gene            199930..200196
FT                   /locus_tag="Bphy_5707"
FT   CDS_pept        199930..200196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5707"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74779"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV01"
FT                   /protein_id="ACC74779.1"
FT                   /translation="MSSDAHTLSVAHGLLNPSALQTRIALGATRARCHASRHQARVSGN
FT                   LKSSAAGDVPARIARSNVFSESAICFAARVARCRARVRRMSSR"
FT   gene            200367..201008
FT                   /locus_tag="Bphy_5708"
FT   CDS_pept        200367..201008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5708"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: bxe:Bxe_B2386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5708"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74780"
FT                   /db_xref="GOA:B2JV02"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV02"
FT                   /protein_id="ACC74780.1"
FT                   /translation="MNRNIAGIDMPDTALARAALEHIRGVESELTLHHALRAFLFAALT
FT                   GIREALEFDAELLYVGTLFHNVGLSLRYNRSPNRFEIDSANEAREFLIAHGVGKIAAED
FT                   VWNAVALHTTPGIPEHMSALVLLVSAGVQMDVRGARYYEFTAQQRDAIVQAFPRERGFK
FT                   SKLIEAYARGMVHRPETTFGTVNADVLDRWDPDYRRLNFCGLVLGSEWPN"
FT   gene            201051..202793
FT                   /locus_tag="Bphy_5709"
FT   CDS_pept        201051..202793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5709"
FT                   /product="cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="PFAM: cyclic nucleotide-binding; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   bxe:Bxe_B2382 cyclic nucleotide-regulated FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5709"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74781"
FT                   /db_xref="GOA:B2JV03"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV03"
FT                   /protein_id="ACC74781.1"
FT                   /translation="MNTPDLLSTSPDAAAPDLAMPYSSLEYRQHQMFPRLSSAEISSLR
FT                   RFAQPMSFKAGQLIFETGRIALGLFVLLHGRVRIFSRDSFGRSTLVTEHDDGHFMAEMA
FT                   QLSGKPALIDGVALTDCETLVVSPEKLRALIVADAQLGEHIMRALILRRLGLIEQGLGP
FT                   IIVGNGDDARLVRLQGFLRRNAYPAMVIDARHDVEAATLLSDITTGPDDFPLVFCPNGS
FT                   VLRAPDEAQLASCLGLVPTFEGSHIYDVAIVGAGPAGLAAAVYAATEGLSVAVFDQRAP
FT                   GGQAGASSRIENYLGFPTGISGQALAARAFQQALKFGAHLAIPGKVMNVDTQDGAYALT
FT                   LMDGQRVSARTLVVASGAAYRKPVVADFDRYEGRGTYYWASPIEAKLVKGQDIVLMGGG
FT                   NSAGQATVFLANFARSIRVLIRGADLNASMSKYLIDRIGSLPNVSVCTRCTLKALEGDE
FT                   AGLTQVHVRREKEGEGPEDEIIDTRHLFLFIGADPKTDWLASSGVELDSRGFVVTGFAR
FT                   RTPTHVDTGIHYPLETSLPGMFAVGDVRSESTKRVASAVGDGAAVVSQIHAYLAQHPTV
FT                   AQNI"
FT   gene            202914..203273
FT                   /locus_tag="Bphy_5710"
FT   CDS_pept        202914..203273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5710"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74782"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV04"
FT                   /protein_id="ACC74782.1"
FT                   /translation="MWCAYSALTVSDDAFAAVPMAGTQTPRLLGDDRGRSASDGALRSH
FT                   ASFPAPCAPASKFSNGSFGFFHPCASLAVLDCQAHQPVCSMLSILSCSTRDSWLFSNSG
FT                   ARREAWRAHACAIRS"
FT   gene            203270..205246
FT                   /locus_tag="Bphy_5711"
FT   CDS_pept        203270..205246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5711"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bxe:Bxe_B2376 transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5711"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74783"
FT                   /db_xref="GOA:B2JV05"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV05"
FT                   /protein_id="ACC74783.1"
FT                   /translation="MIRIGPLDIDLACREARVDGKPVRIGNRAFDMLELLIEAQGGLVS
FT                   KEAILERIWPESVVGDNNLQVHMSALRKLLGDSRDLIKTIPGRGYRLVRGAAIVRHADT
FT                   AASYVERQTAAPHNLPACNSALIGRAEAIAHVSDALGKARHVTLIGSGGIGKTRVATEV
FT                   GRRLLDDAPGGVYFVPLSAASDMCGVLAMLASVIGVHPDGCASTRERIVEAIGGRRMLI
FT                   VLDSCEHVVDAAAQLAHHLLDACAQLRVLSTSREPLRIPSETLYWVPALDVPEPNDDVL
FT                   QVLRSSAVSLFLTRARAIDARFAADEASIQVTGMVCRRLDGIPLAIELAAARAALLGID
FT                   TLAAHLDDRFGMLTGGTRTALPRHQTLKATLDWSHALLDEAERKTLRRVGLFADRFPLE
FT                   AAIAVAADRVTRELDVVAAMASLVEKSLVVASTEPGHAAFRLLETTRMYALQKLDDNGE
FT                   RRMVALSHARYLSALIDGGLAGKTAGESWRTRMPVLLDEVRAALAWVLSDDGDEALRET
FT                   LSVKAVFLFHELSLIDECCVWARRALVAFPATRDCAHASPRARVRLLAALGASLVLAHG
FT                   PNAETHAIWKEVLDSGDETFKARAAQLLQSACANACNGRDIDDFKAAGQLLLQVKGLVQ
FT                   RPVGASGERRHADASTRHLSITP"
FT   gene            complement(205279..206199)
FT                   /locus_tag="Bphy_5712"
FT   CDS_pept        complement(205279..206199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5712"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B2375 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5712"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74784"
FT                   /db_xref="GOA:B2JV06"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV06"
FT                   /protein_id="ACC74784.1"
FT                   /translation="MNLSFEVLQALDAIDRTGTFAAAAEELHKVPSSLTYLVQKLEVDL
FT                   GVKLFERSGRRAKLTHAGRVIVEEGRRLLEAARELEQKAKRIEHGWESELRVAVDEIIP
FT                   FDLIWPHVTDFYKLNLGTRLMLSKETLGGTWDALITRRADLVVGAAGDPPPIANLVAKP
FT                   IGSLKHVFAVAPGHPLASAAEPLTMDNVARHRAVAISDTSRKLAPRTIALAANQEVLTV
FT                   PTLDAKLAAQMKGLGVGTVPECIAAGPINRGQLVRKEVCGMRDVTHFFLAWRDDEAGKA
FT                   LRWWVDQLDRRNLIDDVAQRLAAMG"
FT   gene            206376..208628
FT                   /locus_tag="Bphy_5713"
FT   CDS_pept        206376..208628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5713"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: rme:Rmet_4279 fusaric acid resistance protein
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5713"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74785"
FT                   /db_xref="GOA:B2JV07"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV07"
FT                   /protein_id="ACC74785.1"
FT                   /translation="MPRTPTRMPYRSAQHGHPMNCDAGAAARPPWRDELRQYWSEDYPR
FT                   FRHVVKVAIASTLAMGLCMLLELRGPATAMVSCIVVMMFQQSGMVIARGFYRGLGMLGG
FT                   SLAGLLLVSLFSQAPWTFLLALAAWIGLCVFGSSYFRNFQSYGFLLTGYATAITSLPAL
FT                   SNPYGVFDNLVYTVSEVAIGVSCASLVSALVLPRRVAPELHAASKGNIAHLFAAVHVLL
FT                   GAALPQDGFGTMLDLLRERANVQSLRAGAVFEDPSIRLQHHAFVELDTHFVDALASTHR
FT                   LREVLAQASAGADERVLHAVRELIDTLLSIVPDGLPPGAAVEQPVEALSAALAGFERDL
FT                   TGRLDALLHTIHAARQPRRMFDGTMRAALQGFVRDLRELCRSVVEARRADGRSWHQSVL
FT                   RALTHIDSTRATADRAAAVINGVRAAAAVLTVGALWLASGWVGGSSALVSVAIVSALFT
FT                   LAPDPVVASWQMFCGCVAGAMAGFLFSFFVFPLFDSFPLLAACLAFPIMVSAYLNTFTK
FT                   TATLGLGFGVFFCYSVNVANPVTYHPAQFLDTAFGLSLGIAAAAVAFSTIVPLAGDWIS
FT                   KQYLKQIRSLVTKSVRDSGLDDLSPRFDAGMRGFIMRIASAPAGERVDQARLMASAFAA
FT                   LEFGRAIIVIRRDTERVATLLPDGWRAVQNAWLDALADVLSTATPEARVRAMGATQRAG
FT                   LVLSRVTSSAEAADSLSIERMRRLMHFSARVLRDDTLSLWRTVSAARTIDAKGVSG"
FT   gene            208625..209088
FT                   /pseudo
FT                   /locus_tag="Bphy_5714"
FT   gene            209089..209235
FT                   /pseudo
FT                   /locus_tag="Bphy_5715"
FT   gene            complement(209244..210158)
FT                   /locus_tag="Bphy_5716"
FT   CDS_pept        complement(209244..210158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5716"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bch:Bcen2424_6349 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5716"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74786"
FT                   /db_xref="GOA:B2JV08"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV08"
FT                   /protein_id="ACC74786.1"
FT                   /translation="MSTCVHPTAAAPPKPKDTLGCVSSKLLKDIELDIGDMRFYRKCMN
FT                   AAHLDRVAMPACDRGFLVGISLNSGHRRKIFNGERTVAKQFESDSIYIRDFSDDYRADL
FT                   YGNFDFVLVELSRAFFTRLSDETGGPDIGGLTCGLEQKDPVLGHLARALDGHLTHYSAN
FT                   GSLFVEQMSVFVGTHLAQRYGNLRQTSPRAKGALSHAHEARAKELMLERSRHGASIADV
FT                   ASECNLSRGYFIRAFTRATGRTPHQWLLEQRVAEARKLIGATDMSLTDIAIFCGFADQS
FT                   HLSRVFLKSVGMSPGTWRRTAGR"
FT   gene            210642..213563
FT                   /locus_tag="Bphy_5717"
FT   CDS_pept        210642..213563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5717"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_4; KEGG: bch:Bcen2424_6350
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5717"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74787"
FT                   /db_xref="GOA:B2JV09"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV09"
FT                   /protein_id="ACC74787.1"
FT                   /translation="MIQIGTLLVNFEQREIRQQGRPVRIGARAFDILEVLHRADGGIVS
FT                   KDAIMDAVWPGSIVEENRLQVHIAALRKLFGADRELIKTVPGRGYMLVSESRHARAAER
FT                   QSGAPSSGGLPACAATLVGRHVEVAQIVDRLGQACVVTLVGAGGIGKTCLAVHVAREMR
FT                   DRLGEPVCFVELARASTREAVLKALAGALRIDASDDYLTQERLADVLAAAPCVLVLDNA
FT                   EHVIDVIATLVEALTARAHALRVLVTSREPLHIWAESVFRIEPLAVPATDSSASAILAH
FT                   SAVELFLTRAQSVAPDCGADEETIRLVGEICRRLEGLPLAIELAAARVATLGVEGVASR
FT                   LDDRLNLLTGGLRSALPRHQTLRATFDWSYALLDAASRMLFRRLGFFAGAFTFDAVCTV
FT                   ATEPDMPIAAVISSLSELATKSLLTVEFYGAIAQYRLTESTRAYAMEKLRDEGELQRIA
FT                   SRHMQYLRERIEHGKMPIGDMAQGLPATEPRLALDDARAAFEWAFSPGGNPALGVALAG
FT                   SLVGTLLQGGLLHECHERSRRALAALDALPPGSVDTLCEMRLCSAYASTLLHAGGDVHE
FT                   AGPLWKRVLVLAREARDEAFEARALWGAWNSTLACSDIHASFRFATRFQAFAERCGTPW
FT                   QQVLGAEMIAVSLHCFGEQEQARVRLERAIAALTELGADAADCVDLPVDPFNFGNGTLA
FT                   RIVWMQGHPEQAMQLVENIVNSLRPDMLEPSLSHVLAVAAVPIALQCGQLETASRYLAV
FT                   LQSQVALNRFEIWQAYAECHAGHLDILQGHPQAGLAKLERALQRLMSCGFRRVLTPMIA
FT                   ICAEALARTGRIAEARTRLDEALEFCLAHGEHFFIAELQRVQGVAALQHARAIQSGGRA
FT                   SMAGEFEAQGRRHLRDAMQTAREQHAPMLELRAVLTFVDHLLERGETARASSLVADMST
FT                   RIDLQSNAPDIRRLAQLLHAARAADQSHDLDADSGRPVMAGGM"
FT   gene            213820..214812
FT                   /locus_tag="Bphy_5718"
FT   CDS_pept        213820..214812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5718"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bam:Bamb_5816
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5718"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74788"
FT                   /db_xref="GOA:B2JV10"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV10"
FT                   /protein_id="ACC74788.1"
FT                   /translation="MSTQNYTAAPSESRRRLLSAGATMAGAVAAMSSLAANAAGTANGA
FT                   AGGHTQRLHQQGGNFVKAKDGTEIFFKDWGTGTPVVFSHGWPLCADAWDPQMLFLVNQG
FT                   YRVIAHDRRGHGRSGQSSGGNDMDTYADDLAAVLDALDVKNAMLVGHSTGGGEVAHYIG
FT                   RHGSKRVSKAVLIGAVPPLMLKTQVNPGGLPMSVFDGIRTGVAVNRSQFYLDLATPFYG
FT                   FNRSNAKVSQGLIQDFWRQGMEGSIKGQYECIKQFSEVDYTDDLKKIDVPTLFLHGDDD
FT                   QIVPIDASAKLASKLVKNATLKVYAGAPHGMCSTHVEQVNADLLSFLKA"
FT   sig_peptide     213820..213936
FT                   /locus_tag="Bphy_5718"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.909 at
FT                   residue 39"
FT   gene            214957..217857
FT                   /locus_tag="Bphy_5719"
FT   CDS_pept        214957..217857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5719"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: bur:Bcep18194_A4972 transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5719"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74789"
FT                   /db_xref="GOA:B2JV11"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV11"
FT                   /protein_id="ACC74789.1"
FT                   /translation="MAVALVGPRRAGIAWCGPRNLAQRPLRASQSSTSPHQMTTIRIGQ
FT                   IEVSLDHRDVRLDGRKVPIGSRAFDILALLIAARGDLVSKDEIMRAVWPTTVVEKNNLQ
FT                   VHISALRRAFGDERERIATVPGRGYRLIMQAELGAHAAPTRDAASEREATGMSLPAVSE
FT                   AARPARRPLPARVPELIGREAALDGVKRALRAHQAVTLVGTGGIGKTRLAVEVAHAVQQ
FT                   DFADGVVFVPLAAVYDAQSALDALAFAMRSRLSASRAALAQMAAEWREREALVVLDNCE
FT                   QVLEIVAAMAEALTGAGSRMRVLATSREALRVRDEIVYQVPPLSVPTANDPDTDVLRTD
FT                   AVRFFLARAQAVGAQFSRDDTSIRLTGEVCRRLDGIPLALELAASRAAVLGIGLLAEHI
FT                   DDRFRILTGGRRTALPRHQTLKATLDWSYRLLGQNEQKLLRWLGTFVNGFTLDAACAIA
FT                   GHAGLTRMEALDAVSGLVSRSLLTTEFEGSSYRYRLLETTRAYAQQQLDDNGERTCAAA
FT                   AHATLFLELLETAQKRWAERPVSEWLGEFARELGNVRTALDWTLGERGDHMTGIALAAV
FT                   TVPYLYDLSLVDECCSRARAALRLISEQGDDAGVGVETRLRLVSALAAALVYVEGPLAQ
FT                   TREAWTLVLNDAVRAGQPDYASRARWGVWNWHQYGGRARDALMLARRFGDLARSASHAT
FT                   LAVLADRVEGIALHYTGDQCRARELLERMIAAYEARPLTRWHTTGFRVDHGIVARATLA
FT                   RVLWVQGQRDDAYDLAARCFDSAIEYDHEMVTCYVLVEALVPIALLNNDRAAARHGIDV
FT                   LHELSTRFGFTIWSACCACYEAWLMTLMETGAAAVERLSVSIDTLRATGFLAQLSPLLG
FT                   QLAVAMTNEGRAREALDTIEQALHHADENGERWYNAELCRIKGDVLRVLGRHDEAQRWF
FT                   SAALECGQRHAAGRATTRNASNPRTALQVVSVQYRA"
FT   gene            218114..218749
FT                   /locus_tag="Bphy_5720"
FT   CDS_pept        218114..218749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5720"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bxe:Bxe_B2389
FT                   putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5720"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74790"
FT                   /db_xref="GOA:B2JV12"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV12"
FT                   /protein_id="ACC74790.1"
FT                   /translation="MAYELLTPDTCALALIDHQPQMFFGTHSHERTNVLHNVQILAKSA
FT                   KLFKVPTVLTTIAADSFSGHLLPEVQSVFPELKPIDRTSMNSWEDKGFREAILATGRKK
FT                   IVIAGLWTEVCVTFPTIQMLKEGFEIYVPTDACGDITEEAHERAVQRIVQAGAVPMNSL
FT                   QFMCELQRDWARSETYEGCMDIFKAHSAYGIGVRYAKQILGEHASEAG"
FT   gene            218862..220742
FT                   /locus_tag="Bphy_5721"
FT   CDS_pept        218862..220742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5721"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bxe:Bxe_B2388
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5721"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74791"
FT                   /db_xref="GOA:B2JV13"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV13"
FT                   /protein_id="ACC74791.1"
FT                   /translation="MTAPIQPGRIADLVIYNGKIATQDDKRSFVTALAVSKGEIVASGN
FT                   DHDMMQWANDATRRIDLKGRTVIPGLNDSHLHVIRGGLNFNLELRWDGVPSLHDALEML
FT                   RAQVARTPAPQWVRVVGGWNEFQFAEKRGPTLEEINAIAPDTPVFILHLYDSALLNAAA
FT                   LRAVGYDRDTPNPPGGEIQRDRRGNPTGMLIARPNAGLLYATLAKGPKLPLEDQMNSSR
FT                   QFMRELNRLGVTSAIDAGGGYQAYPDDYAVIMELAKRNELTVRIAYNLFTQNAKKEIED
FT                   FAKWVKVTKPGDGDDFLKVNGAGEMLVFSAADFEDFLEPRPDLPDAMESELEAVVRLLV
FT                   QNRWPFRLHATYDESIERFLNVFERVNIDTPFNGLRWFFDHCETISQRNIERIAALGGG
FT                   IAVQHRMAYQGEYFIARYGAEAAARTPPVRQMLAAGLPVGAGTDATRVASFNPFVSLYW
FT                   LVSGRTVGGTPMYAAQDRLDRMEALRRYTVGSAWFSNDDTRKGALVPGQLADFAVLSDD
FT                   FFTVDEDAIKHLTSVLTVVNGRVVYAADEFETFAPPALPVSPTWSPVVEFGGYARYRPV
FT                   AAPLAQSCNDACVNLCGVHRHAHAWAWRSDVPASDANSFWGALGCSCFAF"
FT   gene            220757..221170
FT                   /locus_tag="Bphy_5722"
FT   CDS_pept        220757..221170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5722"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bvi:Bcep1808_6370
FT                   DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5722"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74792"
FT                   /db_xref="GOA:B2JV14"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV14"
FT                   /protein_id="ACC74792.1"
FT                   /translation="MNRFSAPDAALLFLRVTASVLVLLVHGLPKALHYTSQLGAIEDPL
FT                   HLGKTLTLAFAIFAEVVCPLLMIAGIATRLAALPVMLVSVIALGLVHREWTLDQGQFAW
FT                   MLLIMFGTLAIGGAGRYRIAPWRHASGERGRSC"
FT   gene            221164..221826
FT                   /locus_tag="Bphy_5723"
FT   CDS_pept        221164..221826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5723"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /note="KEGG: bvi:Bcep1808_6390 metal-dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5723"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74793"
FT                   /db_xref="GOA:B2JV15"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV15"
FT                   /protein_id="ACC74793.1"
FT                   /translation="MLNVHAVRLVEVAGVGIPQTPLAIAAAQAAHASLPAVVTAHASRV
FT                   FVFAALAARQERVACEPDTLYVAAMYTNMGLSAAYAHSNLRYEIDGADAARAFMQRYGA
FT                   SASVLDDVWCAIALHTTPGLPAHMSPLTRLLSSGVRADLFAANLDTWTQAERDQILAAW
FT                   PRGIRFKERMIEAIGRGVGHRPMSTFGTVSADVLERVDPNFCRTNFCGLILGSPWND"
FT   gene            221931..222167
FT                   /locus_tag="Bphy_5724"
FT   CDS_pept        221931..222167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5724"
FT                   /product="protein of unknown function DUF1427"
FT                   /note="PFAM: protein of unknown function DUF1427; KEGG:
FT                   bur:Bcep18194_A4952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5724"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74794"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV16"
FT                   /protein_id="ACC74794.1"
FT                   /translation="MSYLISLGAGLVVGLLYYLVRVQSPAPPLIALAGLLGIVIGEHAI
FT                   PFVQAQIRTPDAQTQSAPSVTTTTPASSCSKDK"
FT   gene            222149..222892
FT                   /locus_tag="Bphy_5725"
FT   CDS_pept        222149..222892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5725"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bch:Bcen2424_6339 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5725"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74795"
FT                   /db_xref="GOA:B2JV17"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV17"
FT                   /protein_id="ACC74795.1"
FT                   /translation="MQQGQVSAGAQAQAAGQPDHVMGEDAWLATIAGYVDTLGFVALFG
FT                   LFTAHVTGNFILIGSGLAGAGKGLLIKWLAFPAFVAGIVLARVLDNRLLARGHGTRACA
FT                   LYAMQAVLLAGFMVAGVLAAPIADADAPMTIACGLLGAAAMGVQNAHGRLTARSVVANT
FT                   VMTGNVTQAVIDAFDLLFSPGDAKTRHAARTRLVRTLPPVAGFAVGAGAGAAGYLLASF
FT                   WALLLPLAALCVLAVLSGNTGARSS"
FT   gene            222947..223882
FT                   /locus_tag="Bphy_5726"
FT   CDS_pept        222947..223882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5726"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5726"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74796"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV18"
FT                   /protein_id="ACC74796.1"
FT                   /translation="MSTVKMYRLLRAVVVSIAALGVTLAGAPAFAEADHQNGGKSSPVV
FT                   SVGPQYDTTHVYVPSQDIDAFVDSFVATFGGKASQRAVFTVTPTPSKTASQYVQTPVGM
FT                   LSVFAFQTPVPYPFGSERTGYLVTDIDKAVRAARAAGADVIVDTFDDPIGKDAVIQWPG
FT                   GLYMQLYWHTKAPSYGPLETVPDNRVYVSPQAADNFVKRFVRFSHGKVVSDDRHADGAE
FT                   IGRPGDTIRRIRIASGFGNMLVFATDGKLPYPFGRETTGYQVADLDATLTKAQGVGVKV
FT                   LSAANRTVEGRTAMVEFPGGYVAEIHEVKR"
FT   sig_peptide     222947..223042
FT                   /locus_tag="Bphy_5726"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 32"
FT   gene            223909..225351
FT                   /locus_tag="Bphy_5727"
FT   CDS_pept        223909..225351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5727"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5727"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74797"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV19"
FT                   /protein_id="ACC74797.1"
FT                   /translation="MDRATSVAACAALAICGLAKGASALAAEASASAAAADAPACTATR
FT                   PSGLSFNRWQEDWSVLALPCVPRKPFDALKYIPLGGDPSTYLSLGANLRERFELNNTPL
FT                   FGLGSARPDSYVIQRAEVHADARVGQHVQAFFQLEDARPFGKDSVSPVDKNPLDIEQAF
FT                   VAFVYGVGGGTFKARVGRQEMAFDLQRFVSVRDGPNVRQAFDALWADYEIDKWRFIGYM
FT                   TQPVQYRDATTFDDVSNRHLTFSGVRVERANTGPGDLSAYWSRYNRDNARFLDASGTEH
FT                   RDVFDVRYAGKVAPFDWDAETMLQTGHVGKDTIGAWAFGMLGGYTLASMPGTPRIGLQV
FT                   DGASGDRHPGDGRVGTFNPLFPNGYYFTLAGYTGYSNLIHVKPSITFKVTPKVSLLTAL
FT                   GFQWRATTADAIYGQGSAVVPGTAGKGTRWTGMYAQVRADWLVSANVALALEAVHFQVG
FT                   DSVRALGAKNADYVGVEAKFGF"
FT   sig_peptide     223909..223989
FT                   /locus_tag="Bphy_5727"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.741 at
FT                   residue 27"
FT   gene            complement(225973..226224)
FT                   /locus_tag="Bphy_5728"
FT   CDS_pept        complement(225973..226224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5728"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74798"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV20"
FT                   /protein_id="ACC74798.1"
FT                   /translation="MKEQSQPPVNPEEMPDAKPGRNGGVGHPFMLGRQRIRNKARRLGR
FT                   EVVHGQMEMPPAEPVVHPVTSPRAEPVVSIRKRRRIEM"
FT   gene            complement(226231..228015)
FT                   /locus_tag="Bphy_5729"
FT   CDS_pept        complement(226231..228015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5729"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: bxe:Bxe_A3644 putative activator/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5729"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74799"
FT                   /db_xref="GOA:B2JV22"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV22"
FT                   /protein_id="ACC74799.1"
FT                   /translation="MKIRKRLAALPLTALVTLASNAQQTPAPADAAAAARANAEQNQQL
FT                   QQQRDAQQRAKTVNAPAVRSTVPKDGAYPDLPRETPCFHIDTFALDVPATLRDLARKNG
FT                   ASNLPLDPFWFAREWLDHYRGECIGKAGLDVLTKGLQQVILSRGYVTTRVLLPEQDVST
FT                   GTLKVALVPGTVRHLRFADPDTRGTWKSAFPARDGDLLNLRDLEQGLEQMKRVASQDMD
FT                   MKIEPAESPGESDVVIAVKRAKPWSFVASVDNSGTKATGKWQGNVSLGLDNPLGLNDIL
FT                   TVGAYQDLSFGNKTLGSHGFNGSYSVPWGYWTATLSGNTNTYYQNIAGVNQTFVSSGNA
FT                   QTAAFRLARVLSRSQNDVFSMELQLSKRFGESFIEGTSIPIQDRNNTFVEAGLTDRHYF
FT                   GAAQFDGTLAYRQGIHGLGATGDPDPSLYASTDDGKPLPTYLYRMLVLDANLSVPFAIA
FT                   TQNFRYLSTVHGQFTNDRLFYIDDLTIGSRYTVRGFDGETMLAAEKGFYWRNELQWPIF
FT                   QTGQTLYAGIDYGRVFGPNTAILAGTQLAGAVIGIRGGIPAKYAGFSYDLFAGTPIYKP
FT                   AGFPTARVTAGVQATMQF"
FT   sig_peptide     complement(227947..228015)
FT                   /locus_tag="Bphy_5729"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            complement(228092..228457)
FT                   /locus_tag="Bphy_5730"
FT   CDS_pept        complement(228092..228457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5730"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="KEGG: bch:Bcen2424_6821 conserved hypothetical
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5730"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74800"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV23"
FT                   /protein_id="ACC74800.1"
FT                   /translation="MKIFMNKTISIVVLVTALTGCAFSSGQRTGNMKLEDATQESLVDQ
FT                   FKLDVATRDDVVSRFGPPEKKITAGSMEVWTYSYKSSAYVIVGFASVPTGTSKAANFYF
FT                   DEKSGVLKKIELEAHRG"
FT   sig_peptide     complement(228383..228457)
FT                   /locus_tag="Bphy_5730"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.686 at
FT                   residue 25"
FT   gene            complement(228478..228684)
FT                   /locus_tag="Bphy_5731"
FT   CDS_pept        complement(228478..228684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5731"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5731"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74801"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV24"
FT                   /protein_id="ACC74801.1"
FT                   /translation="MRNLYVLAAFALLAACQHVPPGAPPMPPPKPEMEPVLPPNASSFW
FT                   VMGYWKWSGMEWVWIPGHLAPKP"
FT   gene            complement(229478..237826)
FT                   /locus_tag="Bphy_5732"
FT   CDS_pept        complement(229478..237826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5732"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: bpl:BURPS1106A_3880 polymorphic
FT                   membrane protein, filamentous haemagglutinin/adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5732"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74802"
FT                   /db_xref="GOA:B2JV25"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV25"
FT                   /protein_id="ACC74802.1"
FT                   /translation="MNRTTYRLVFSRLRGMLVAVEETATATGKSAGETRATGRASRKVT
FT                   RSPLRNLVALMLAVAPLLAFAQIVPGGAHAPGVITTQNGIPQVNINKPSAGAGVSVNTY
FT                   NQFDVSNRGAILNNSPTIANTQLAGYINGNPNFGPNDSAKIIVNQVNSSSPSLLRGYLE
FT                   VAGPSAQVVVANPSGLYLDGAGFINTSRATLTTGTPNFAPDGSVSGCNVTGGNITVQGA
FT                   GFNASNIDQVDLLARTLQVNAAIYAKNLNVVTGANAIDYGTLAATPIAGSGPAPGVSID
FT                   VSNLGGMYANRIVLVGTENGVGVSSKGVLAAQAGDMILTTQGKLVLAGQTNASGNITAS
FT                   ARDGIDNSGTTYAQQGVSANTSGALTNSGTLAAQQNMSVTAGSVASTGTLGAGVNSDGT
FT                   IANSGELSVAATGAVAATGRNAAGDSANISGASLNLAGSSTSANGALTLTASNGNLNLA
FT                   GATTTARTTLNASTTGTLTTDNGALSSGGAQAITAGALSNNSGQMVSGATQTATVTGAV
FT                   SNQSGTMQANGALSLQAGSADNTGGHIASLNADGLNLTVSGLLKNGAGGSIGGNGNVTI
FT                   RAGQVANAGSITAVQNLIASAVQTLFSSGTLAANGNATLSAGTSLTNSGSITAASAASI
FT                   TASTFDNSSGTTGANQITLNATDLLNHAGTITQYGSSAMGFNVSGTFDNSSGGTLQTNS
FT                   TDLTLAPGALDNDGGKILHAGTGTLTIAPGNGAGALSNAGGQIISAGQIAARAGSLNNT
FT                   GGVLAAQSNIAATVSGDVNNAQGAVRSLSSLTLTSGGTLTNTNGQIQSGTGATDDTSTL
FT                   SIQAASVDNTNGLTGNLGTGGTTIHGSSQIVNTGGVMTGNGNVAVDTSALGNTHYGQIS
FT                   GANVAVQADTVDNSNGQIGNLTGSNGDVTIAATGALTNTSGQIGATHNLSVNAAGLTGG
FT                   GAYSAANDVAINVQGNFAPTPDFQFNAGHDLAFTLPGAFTNAASLQSVNNLSVDAGDIA
FT                   NSGVLMAGGTLITHSATLENTGAMVGGSVSLNATQSLSNVGPTALIGATDSSGTLELLA
FT                   PDIENRDDTTMTDTQATTAIYGLDKVVLAGGKDASGNYTNANLIRNQSALIQSAGDMAL
FT                   DAAQVTNTRTTMTTTGFNQPVDPALLAQLGISLSGRTGQVGIQDPNSIGGVFTDPPHGG
FT                   QWNSTYEYTTYTGVAVANLIASISPQAQIIAGGNLDASKVGLFQNYWSAVAAAGNIAAP
FT                   VTLDQNSWQGQTAPQVQVTYSGEYHYNNYDNSEYNWQLPFGNAGFVTNHPGGYTQAAPA
FT                   DIRYYALPSYESTFVAGGTLSGTGVNISNTAGNAGVPSLGLVPGQSAGGVNAGGINGGA
FT                   GLVNPVIASATAVNVLSHLTIPQGGLFRPDTAPNAPYLIETNPAFTSQKSFISSDYYLQ
FT                   QLGLNPQTVEKRLGEGFYEQQLVRNQITSLTGKAVLGPYTDIQSMYEAMLASGASLAKS
FT                   LDLPLGMSLSPDQVAALTSNVIIMQTEVVDGQSVLVPVVYLAKASQQDMNGPLIAATDI
FT                   DLKNAQTFSNSGTVQASNTLSIQGQQIDNAFGALQSGGLMSLGTKGNVDLTSATVNAGS
FT                   LALNAGGDLLLNTAVKTVNQVSATGATRTTTTLGPVANLNVKGDAVIVTGGNVEQNAGN
FT                   LNVGGNLGMAVGGNYDIGSVQTGEHKVVERANGISNTDFNQTTGSSVNVGGVSQIGVGG
FT                   DLTATGANIDLGGGGVIAAKGNVTLQAAKATSTVDSNSSGSDHHGGYSESSHTSDDTLT
FT                   ATTLHSGDSLTVASGKDLNLVGSAVELDRGNAMLAAAGNVNIGAATETHVDNGQETHSH
FT                   SNGLSGKEVSSSRDTTTTLSQGSLISADGVSIASGKDINVAGSDIVGTNAVSLNAARDV
FT                   NIATSQDTMQSSGSYQEKDSGLGTSGLSVTIGSRKTATTDWESSVKNNASVIGSSTGNV
FT                   SITAGQDLGITGSEVVAGGNVALTGQNVAVNAAYDTYHESQSQQTSQSGLSVGLGGGLV
FT                   SLGQSMANTVRQGVQSGDSRLAAVQGVAAAEMAYQNRGAIGSAASGLANGDGSSATQGI
FT                   QLQISVGSSHSSSHSSTSITSAKGSSIIGNGNVSVTATGIPDTKGNAQAGTGDITMTGA
FT                   TVTGKNVTLDANNAITLQSAQSTEQDSSPNSSSGWNAGVGIGVGKNTGISIFANGSNTH
FT                   GQGNGDSVTQTDTSVAAGKTLTMKSGGDTTLAGAQVSGNTVNADVGGNLTMTSVQDTST
FT                   YSANQHSSGASGSFTFGYGGGVDASVSHTGIDSNYASVNRQTGIVAGTGGFDVNVAGHT
FT                   QLNGAKIASAAPAENNSLTTGSLGFTNVQNSMSYSGSTEGFSLSGGPSFAQTSDSASGT
FT                   TRAAVSPGTITVKSDQQNGTDSTAGLSRDTANANQTVQNTFNLQQVQNNLAFAQAFGKT
FT                   ATYAAGQIADQLENTNPAFAEGGVARDAMHAAVAAIGAAMSGGNIAGAVGGSLAGDALQ
FT                   SLAQPIIDQAVAQVPPENQAALRNALNEIVATAGGAAGGALGGGGSSGALAGAGSAANN
FT                   EVFNRQLDKSEKNAIANKANGDPGEQQKLTAAACYVVQCWAQYPPNSAAYQQNYVSVVE
FT                   AAGLQNEIAWVQSQQSQGLFNYTPMQGFVDYVQANTIAPAKDVMKVASGGAAFVAGIGM
FT                   CGSAAGCVLGAPMAALGASDLTEGATGLYNFYQGNGAAGFNPGQTVLNYISPRWGNTIY
FT                   DAANLGVSIGGLSVNVPLNMGTADGLGRPQSIFGVTVSAYNNTKLLPLTGGALPGVNQP
FT                   LMLYGVGSKGITVYNDSTGASKK"
FT   gene            complement(238013..239341)
FT                   /locus_tag="Bphy_5733"
FT   CDS_pept        complement(238013..239341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5733"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   vha:VIBHAR_06951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5733"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74803"
FT                   /db_xref="GOA:B2JV26"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV26"
FT                   /protein_id="ACC74803.1"
FT                   /translation="MLSSHLTFLLDAQQPADLSRLAEHLPYEWIERAVQATGAASIRRR
FT                   RLPAEQVVWLVIALAMYRHWSISEVLDSLDLALPNEAAPFVSKSAVVQARQRIGEAPMA
FT                   WLFEQTARAWTTQDAAHHAFKGLSLWAMDGTTLRTPDSAANREHFGAQGYASGKVASYP
FT                   QVRAVTLTAIPTHLVADINFGCYDTNEMVYAKSLLPQIPDDSLTVFDKGFLAAEILCGL
FT                   TMNGRNRHFLIPAKSNTCWEVIAGTADDAMVRMRVSQQARKKCPALPEFWNARAIRAID
FT                   ARGRERVLLTSLGDRRRFKPADIVACYERRWRIETSYGELKQSMLGSELTLRSRTVEGV
FT                   YQEIWGALIAYNLIRREIASAAWEAKLAPTDISFVRALHTIQHEMMWAALTPAYAKLPA
FT                   CLQRLRDRLKSLPNEKRPGRACDRVVKSRPKRYTVRYLNKDIN"
FT   gene            complement(239913..240452)
FT                   /locus_tag="Bphy_5734"
FT   CDS_pept        complement(239913..240452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5734"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74804"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV27"
FT                   /protein_id="ACC74804.1"
FT                   /translation="MRSGLLCAQNRRCIPPAIWCGNRPVGRGKLWEPVVPTAHGVVCAG
FT                   SGIHHTRLHTPQISVRGEQRGLRVHADPRHDVEEAEMPHAPIHFPVQVASNVPLSEFQS
FT                   VFVAEQCVAALLNMHPDGKDLDHVVLEVAIDGGLLVLFVDADCEIFAALHQAPGTPLVS
FT                   SVDDAGEIDWLRGCVQ"
FT   gene            complement(240471..241037)
FT                   /locus_tag="Bphy_5735"
FT   CDS_pept        complement(240471..241037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5735"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74805"
FT                   /db_xref="GOA:B2JV28"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV28"
FT                   /protein_id="ACC74805.1"
FT                   /translation="MQSGMQKLTGQLLFQTLAQSGVLSHRGYSRFDSLMTYGGWASFGF
FT                   VVVMLYGLAVLPWTYHRCATVICCECGLIVTGVPLLYFVVTTGVFGFWLGIATKSIALI
FT                   SATPHVELFHYGEVLATAINAHPYLTVCIMLALTGAHLVSIETRRQGMKVAYGNSGLAL
FT                   LAVDITSFALLLLALKVLIHTLPGR"
FT   gene            complement(241348..241681)
FT                   /pseudo
FT                   /locus_tag="Bphy_5736"
FT   gene            complement(241731..241877)
FT                   /pseudo
FT                   /locus_tag="Bphy_5737"
FT   gene            complement(241894..242211)
FT                   /locus_tag="Bphy_5738"
FT   CDS_pept        complement(241894..242211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5738"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5738"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74806"
FT                   /db_xref="InterPro:IPR022236"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV29"
FT                   /protein_id="ACC74806.1"
FT                   /translation="MRLNAGSGTAKQVITSLVVLAMAFGTLPAYARTSATDAWTQPDES
FT                   DLTNHGHYVNHDGHNVHSPSRTKDGAVRPGATAHCADGSYSFSQHHSGTCSRHGGVAEW
FT                   E"
FT   sig_peptide     complement(242116..242211)
FT                   /locus_tag="Bphy_5738"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.993 at
FT                   residue 32"
FT   gene            complement(242248..243081)
FT                   /locus_tag="Bphy_5739"
FT   CDS_pept        complement(242248..243081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5739"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5739"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74807"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV30"
FT                   /protein_id="ACC74807.1"
FT                   /translation="MAKFVPEESLQRLAGAARSRGLTLLSKEWHGSTGQHEFRCGRGHV
FT                   LLRRADYVIADSQRQDGRRKTRCPLCARIDGLDRLIELAARHGGRCLATEYLGMNTPYE
FT                   WECARGHRWSVQAENISQGSWCAKCWAKGNGLRKRLADGMERLREKAATLGGECLDTSY
FT                   IGLKKRYRVRCAKGHEWETRGAHLLEGRWCKRCVVDQLRTPIEVFKNAARERGGLCLST
FT                   ESHGVKVRLQWQCAKGHVWETSPESILTNGSWCPSCALLERTKIPWKRRRYDVDG"
FT   gene            complement(243406..244476)
FT                   /locus_tag="Bphy_5740"
FT   CDS_pept        complement(243406..244476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5740"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: vei:Veis_3858 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5740"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74808"
FT                   /db_xref="GOA:B2JV31"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV31"
FT                   /protein_id="ACC74808.1"
FT                   /translation="MGKMNLSETEREELMSMQRSRTMAVGQVRRARLILLLDGGASRAA
FT                   IMAELRCDSRFITTWQMRFNSERLAGLYGRHPGLAPRPDLAGLEARVLDYTLRRKPSDG
FT                   STHWSSRKLAAQLGMAFMTVQRIWRKHDIRPHRLDTHMVSNDPDFEAKAADVIGLYLNP
FT                   PLHAVVCCVDEKTAIQALDRQDRMLPLSPGRAESHGFEYKRNGTLSLFAALNVATGEVL
FT                   GKTAPRHTSAQFVAFLTEVVSAQPRGKEINVICDNVSSHKTDTVQTFLADHPKVSIHYT
FT                   PTYSSWLNQVENWFARIQRDVIARGVFTSTKDLDKKLMRYIRQYNKQALPLKWKYSDPS
FT                   RRIRCNSSGSTDLATH"
FT   gene            complement(244652..244936)
FT                   /locus_tag="Bphy_5741"
FT   CDS_pept        complement(244652..244936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5741"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bam:Bamb_0211 PaaR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5741"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74809"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV32"
FT                   /protein_id="ACC74809.1"
FT                   /translation="MALPIIVFGDQTSHGGIVISGSETHTIDGKPIARLYDLVDCPQKY
FT                   PDGRPHGINKIIEAHPTFTIGGEQVALHGHQTECGCTLIGSTRTGVGDE"
FT   gene            complement(245003..245821)
FT                   /locus_tag="Bphy_5742"
FT   CDS_pept        complement(245003..245821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5742"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5742"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74810"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV33"
FT                   /protein_id="ACC74810.1"
FT                   /translation="MTSRTMKKLNQWLVFLMSALLLPAYAAGQDIYRMMGAARFDHGSD
FT                   FHKLSFPVNPVMAGFLTFDGSTFVYHETGNDCSVLVHKRMSFYVDPVISHSFGSLDNFN
FT                   GFLRSRFHANGNALTETYLLGGADAPLCTGLRYATIYKSPDEILLLDGSWAYLFERQTH
FT                   APTNAEQSFDCKKAHTNVEHLICNSTELVKLDATVNRGYVAMLLTDSKEISYLDPVRQD
FT                   QINWIRKVRDACTDNTCLLNAYRARVEYIKGRIATTYPAYPEDDSDQEGD"
FT   sig_peptide     complement(245741..245821)
FT                   /locus_tag="Bphy_5742"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.813 at
FT                   residue 27"
FT   gene            complement(245829..247544)
FT                   /locus_tag="Bphy_5743"
FT   CDS_pept        complement(245829..247544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5743"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: glycoside hydrolase family 24;
FT                   Peptidoglycan-binding LysM; peptidase M23B; KEGG:
FT                   aci:ACIAD0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74811"
FT                   /db_xref="GOA:B2JV34"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV34"
FT                   /protein_id="ACC74811.1"
FT                   /translation="MQRSSNASDYVSDVTVFFKDHFGVPIQNLKVEIRGIEDQAGHMYH
FT                   SASTNARGAIQFSVRKGEELSVHVKRWTSESMKEVARLSAALSQIAFHLTSPKTQHDLP
FT                   TKTDDSGGGNYWRGTYKVKAHDNLTAIARKYHTSVDLLKRVNGLKSDLIVVGQTLKVPP
FT                   VESRKSDEPVPKKPAPSGTPPQNDHSNNDHGAPTTMPRRGPAPIIFPIAARPLNDEGGV
FT                   YGTPSCDYTWTKQLHGGGYDQARYGANRAGGRKHAARDLYVKSDTPIVAIAPGVVIKCE
FT                   FFYCHTWQISIHHKTTDGREFIALYGEVKPSSITVKIGDTVNQGQILAASGTLLKANGT
FT                   PLHVVGNENVSMLHFEAYSGSLGFDSHSRLNGSAMPAPFQRRADLIDSLTILLEGYQAT
FT                   FLDAPPLKAVGQRIAIAQLNISEQGKAFIKGWEGVYYDDSKANTYYYDDSKGYCTVGWG
FT                   HLISKSSCTANGYVAMSSKISVADAQTLFDRDVARIETAVKNAISVPLYQYEYDALVSL
FT                   AYNMGSLIKAPSLCRKLNSGDYVGAPAEFLDIENKTRREREHDMFCLNTYNSNH"
FT   gene            complement(247572..250334)
FT                   /locus_tag="Bphy_5744"
FT   CDS_pept        complement(247572..250334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5744"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bxe:Bxe_B2595
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5744"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74812"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV35"
FT                   /protein_id="ACC74812.1"
FT                   /translation="MSWLDQPRTLEIVSAGLPKWQDECLFTVSRLTGTEKLGRLYDYTV
FT                   EIATKDDIGLTVHEAREMVEVDKLVGKQVTVKIATEGSGTYETGTIGVSPSINIGAGVR
FT                   EITGLIVSAECVGSDTRRAFYRLRIRPWLFLATLNQDSRIFQDLTVKEISETILKKYPF
FT                   HYELRLAGPGFGRQYPKRDYQRMFWESDWGYLNRLWQEWGITFFYDGPTLVLCDSTAAY
FT                   KKHGPAYATLRYQDRDGQRIDEEHVHQFEIARALTTGKVSVTDYDYTQSRANLAAKDSD
FT                   YRERANDNIEHYAWGDYSQPLAGAMGTAAQPNEVDFEGEHLARVRLEAKRAKSLRGKGR
FT                   GNMRGLRVGYTFHLEGYPLAPGNGEYLVVATKIEIVNNDTVTNRGALQRQYTCDTQFTV
FT                   QPANTYFRTPQKAKKPRSHGEVAIVTGYSDSKIWTDRYGRAKVWFPWDREGQQDQDSSC
FT                   WVRVSSPWQGANYGAIYIPRAGHEVVIGYQDNDPDKPYIAGRHVNQFHEPPWPLPANQA
FT                   LSGWLSEDLEGPTTNSVVTDDTPGKLQVQVASDHAASRLVLGSNTRIDRRKGRSEARGE
FT                   GFELATEAHGVARANLGMLITTEKREGASAPVKDMVETVQRLTQARQLHEDLSQAARKH
FT                   TAQTLEANQSEATTTIKVQNDAVKGGVKSVANPSPEMTRPDVVISSASGIATTATDSTH
FT                   MASMNDHAVTTGRDFSMAVGRAYHASVRGSISLFAYQDAMKFVAAKGPVILQSRSNNIE
FT                   IIADQVLKLTSAKKRIEITAAEEIVLQARGSYIRINGAGIEHGTPAKWIAHAASHALPG
FT                   PKSMPASLPEMDMPKAFSNRLDAYDIYWLRDFNDVEYAARRANGDLIAQGTLDQDGRTS
FT                   RLSTDQPETIQVLVGTRGAWLVETDGRENNPQSDDPLPDDPNHYVNLST"
FT   gene            complement(250719..251039)
FT                   /locus_tag="Bphy_5745"
FT   CDS_pept        complement(250719..251039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5745"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74813"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV36"
FT                   /protein_id="ACC74813.1"
FT                   /translation="MNGRGWRRPVSDWRQSNQARAMTGTGGDFQLRDPASLSGTGALTE
FT                   DAVRLGFGFEAPASEVIARCRSELEPVTDADNELWGLDEVVTVHPLLLPLLAHPHYEAE
FT                   KR"
FT   gene            251685..252494
FT                   /locus_tag="Bphy_5746"
FT   CDS_pept        251685..252494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5746"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5746"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74814"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV37"
FT                   /protein_id="ACC74814.1"
FT                   /translation="MTSNVERFEDDLAKLIKKGNRLHDSMQNACYPAEFKTQYKKLLKD
FT                   KVDDFIKDLPNFDTEYQRWYSEALALLRQILPDRVADFCRHYEKPKTRKEITFENYRIE
FT                   DYLQGLTVTRGAHKDKVVGPEAAITQFRQQLAIVEAAQGRFESSLFDIRHMVQADLMDS
FT                   ELEAAEHLAKLKYSRAAGAIAGVVLERHLGEVCTNRQIAISKKNPTIADFNEALKAASV
FT                   VDIAQWRYIQHLSDLRNICDHARTPDPTADQVTDLLGGVKKIIKTVY"
FT   gene            complement(252575..253341)
FT                   /pseudo
FT                   /locus_tag="Bphy_5747"
FT   gene            complement(253406..254206)
FT                   /pseudo
FT                   /locus_tag="Bphy_5748"
FT   gene            complement(254203..254553)
FT                   /locus_tag="Bphy_5749"
FT   CDS_pept        complement(254203..254553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5749"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5749"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74815"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV38"
FT                   /protein_id="ACC74815.1"
FT                   /translation="MIDALITGTLIVDPVAKTTRTGNPYCTCRVRVPMGEAEALFCLMT
FT                   AFEATARDGLLALHRRDPVALACSLSISVWTPDTGGARPNVQGTVHAILTPYQVKHTHS
FT                   ELANAQQHEHIA"
FT   gene            complement(254550..255032)
FT                   /locus_tag="Bphy_5750"
FT   CDS_pept        complement(254550..255032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5750"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74816"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV39"
FT                   /protein_id="ACC74816.1"
FT                   /translation="MSEVEHSPGDWMARNARPVPGNAGRPIATDYARAVSALEAIPGND
FT                   PDWRLILASWALEFDRAGEPAARTWFARCTASSGVAFDDAYRATPEARITFVLVRAAHY
FT                   GWLDPLPAAVKSREANAKQRAAYEEKARKARERVEAKAAREAARAAKFSTTRRKAA"
FT   gene            complement(255273..256982)
FT                   /locus_tag="Bphy_5751"
FT   CDS_pept        complement(255273..256982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5751"
FT                   /product="putative helicase"
FT                   /note="KEGG: reh:H16_B2382 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5751"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74817"
FT                   /db_xref="GOA:B2JV40"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV40"
FT                   /protein_id="ACC74817.1"
FT                   /translation="MELEDSGERAIGLWINGKPAHAHAYVASKDLRAACDADRLRVAAN
FT                   DPACLLAPIRALTGDAPVVAVQRIFADGSKRTLGRLTPFPGCCYVIGELRDGVTMIGCE
FT                   GVATGEAIAQACPTAAVVVTIGVSREREVMGEIRALYPASPRVTVADRGRRVADAARDR
FT                   PAGHIETITARAAQETRSAWVSMPAEAPEGYDAWDFATERGHDALAVWMAGQGRHEYEP
FT                   RYRVLSGAAITSQPIIDDLVDDVIPAHAVGAVWGASAAAKSFLVLDLAAALTECRSFFG
FT                   HDVFEPVPVLLVSLEGNNGLPRRYLAWEKHNGRPVPARLHTLTQGFSLLDPRDTDDLCE
FT                   AIETCGITGGVVFIDPFALATIGLEENSSADMGRAGAALNTLRERTGCTVIAVHHTGKK
FT                   QENGMRGSSNLPFLLDFHLEVTRDRQSGLREWSTGKQKDAGDDLRHAFRLAPVVIGVKR
FT                   NGKPLTSCVIEDCDAEMRGREDVQKPEQPRGELQRIAFDVIGEQLRRGENIGAGSGCPA
FT                   GRPCIAFAQAVELLAVRLVSYEAGKRRWKASKVIEAMQPKFYATDGEWLWRV"
FT   gene            complement(257482..257721)
FT                   /locus_tag="Bphy_5752"
FT   CDS_pept        complement(257482..257721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5752"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5752"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74818"
FT                   /db_xref="GOA:B2JV41"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV41"
FT                   /protein_id="ACC74818.1"
FT                   /translation="MSAHELPDTFTSFDRLPGAAYVSIAVVALLYGCATPTVWRRVARG
FT                   LIPPPRKFGASARWNVGVLREELAKRPQAEAVEA"
FT   gene            complement(257879..258025)
FT                   /locus_tag="Bphy_5753"
FT   CDS_pept        complement(257879..258025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5753"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5753"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74819"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV42"
FT                   /protein_id="ACC74819.1"
FT                   /translation="MMLDLYGKPLDDIVALLVSAITDLPQPLTRDDIRPYLKRTGKNLN
FT                   KTR"
FT   gene            complement(258062..258214)
FT                   /locus_tag="Bphy_5754"
FT   CDS_pept        complement(258062..258214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5754"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74820"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV43"
FT                   /protein_id="ACC74820.1"
FT                   /translation="MLWRSPSRLRVLPLSQSAYPALADVLQPAIDALERAARAMPIVVQ
FT                   PGRPD"
FT   gene            complement(258271..258954)
FT                   /locus_tag="Bphy_5755"
FT   CDS_pept        complement(258271..258954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5755"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5755"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74821"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV44"
FT                   /protein_id="ACC74821.1"
FT                   /translation="MSQTPPRRGFCFMLMAYHVQSVHCGGSLAGRYRMGLSTNPNLNGQ
FT                   DGSDERRMKREARRYGRIIARLLPAWAPAPIISRLHDELAHYQLARREARARPGVTPRL
FT                   DQQWFARQVASTVRLCTYSPDMERAWATLTTAPLRGQDRSGWTASDRTLQVLSGIDNAM
FT                   CCASPTRQNLPRQRAENLSHVWRRLADACLKPSRLHRKRPCCFASHSPNSLRRTNIDHI
FT                   FWVTC"
FT   gene            complement(258969..260237)
FT                   /locus_tag="Bphy_5756"
FT   CDS_pept        complement(258969..260237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5756"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bvi:Bcep1808_5519 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5756"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74822"
FT                   /db_xref="GOA:B2JV45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV45"
FT                   /protein_id="ACC74822.1"
FT                   /translation="MSVFASTAAARRKRSGRTATAPASGRCTRRSLKRQRTAAARENIN
FT                   IIEAEKRERIVRTGATLNQVFEVWFNESIAEKRGRKGRKDGGKVLRRQAELHWLGRFGE
FT                   RHIGDINRTDIVEHFRAISRTGRNRTAVVNFRAMHQLIKWANRTRPYRQMLADSDFFEI
FT                   DVADVVTGDYHPVHGNERSRTLSDDEIRLLAKKMHASTLPRYAVYAVYIMLGTGCRVGE
FT                   LSLARWANVDLEAGLWTLPAPNTKTQAEITVVLSPFVQRQFEALRAMHTGTCVFPRRLG
FT                   VSAAEEVPIDGATVGKVITYRQMTPAEHARKPLVMDHDALALPGGRWRCHDLRRTAATV
FT                   MQRCGVDDTSIHRCLNHAREDALDRVYLQERTTPRMRAAWLALGEYLDRLLGTAPEAAN
FT                   DDEKEVTTTTGREAGAVPLKIVA"
FT   gene            complement(261183..261875)
FT                   /locus_tag="Bphy_5757"
FT   CDS_pept        complement(261183..261875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5757"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aga:AgaP_23091 ENSANGP00000028253"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5757"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74823"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV46"
FT                   /protein_id="ACC74823.1"
FT                   /translation="MRISALLGSAALTVTLSPALSPATAWADGPRSAYDSGGVIEEASL
FT                   DPGEEQMTVDEENKARLKDLSDAYHSGYNARAKEDAETYASLRDQLKRTKTSAQQPPPL
FT                   PSGEPGDDGAQVRRVSQARVAQQRLQAAYDDDDAAAPVQYAPPAARPRYRSAPAPVMYT
FT                   QAPVYDGPSAEEMQTVVFQPYQAPMPMPMPVQYVQSYQPVYVSPAPVVPVQYAAAYPVY
FT                   RPYGYGWR"
FT   sig_peptide     complement(261792..261875)
FT                   /locus_tag="Bphy_5757"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 28"
FT   gene            complement(262272..263150)
FT                   /locus_tag="Bphy_5758"
FT   CDS_pept        complement(262272..263150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5758"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Helix-turn-helix type
FT                   11 domain protein; Transcriptional regulator IclR; KEGG:
FT                   yen:YE1877 IclR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5758"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74824"
FT                   /db_xref="GOA:B2JV47"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV47"
FT                   /protein_id="ACC74824.1"
FT                   /translation="MAAIDKPKTTAPRKRAAAPLVSDADAADRNESLSSVARVFAILGA
FT                   IGDSGQIGISELSQRLALSKTTVHRVLQTLKALGYVTQEVETERYRLTIRLFELGAKAL
FT                   ESVDLVREADIEMRRIGHATREAVHLGTFDEDAIIYIHKIDADYGLRMQSRVGRRNPLH
FT                   STAIGKVLLAWMEPAEAREVLSHIELRKSTAKTLSSAEAVMSILPQVRAQGYGEDIEEQ
FT                   EEGLRCLAVPVFDRFGRVIAGLSVSFPTMRCGADTKLHYVALLKEAGAALSARLGYRAP
FT                   APEAAEVTHPG"
FT   gene            complement(263238..264008)
FT                   /locus_tag="Bphy_5759"
FT   CDS_pept        complement(263238..264008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5759"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="TIGRFAM: 2-deoxy-D-gluconate 3-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: esa:ESA_02139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5759"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74825"
FT                   /db_xref="GOA:B2JV48"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV48"
FT                   /protein_id="ACC74825.1"
FT                   /translation="MTLQPMHPFDLSGKVAVVTGSNTGLGAGMACALAAAGCDIVGVSR
FT                   SDDSDTAQRVQALGRRYAGVNANLSSIAPVDDIVRAALEACGRIDVLVNNAGIIRRADA
FT                   LSFSEDDWDDVMNVNLKSAFFLAQAVARHFVEHEKRGKIINVASMLSFQGGIRVASYTS
FT                   SKSGILGLTRLLANEWAARGINVNAIAPGYMATLNTAALREDERRNGEILARIPAGRWG
FT                   TPEDLAGPAVFLASSASDYVHGHTLAVDGGWLAR"
FT   gene            complement(264034..264870)
FT                   /locus_tag="Bphy_5760"
FT   CDS_pept        complement(264034..264870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5760"
FT                   /product="4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /EC_number="5.3.1.17"
FT                   /note="PFAM: 5-keto 4-deoxyuronate isomerase; KEGG:
FT                   ypi:YpsIP31758_1694 4-deoxy-L-threo-5-hexosulose-uronate
FT                   ketol-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5760"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74826"
FT                   /db_xref="GOA:B2JV49"
FT                   /db_xref="InterPro:IPR007045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR027449"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV49"
FT                   /protein_id="ACC74826.1"
FT                   /translation="MEVRQGMNSEYAKTLDTAGLRKAFLVEKVFEPDTLALTYSHIDRI
FT                   IVGGAFAQTRAVEVPSAIGKSIGVSYLLERRELGAINIGGDGWVEADGKRFVVRNEEAI
FT                   YVGKGTQSLTFGSDDPARPAKFYLNCAPAHATYPTRTITLAEASPQTLGDPATSNHRTI
FT                   YKFIVPEVLPTCQLSMGMTRLEPGSLWNTMPCHTHERRMEVYFYFNVADDAAVFHMLGE
FT                   PQQTRHILVHNEQAVISPSWSIHSGVGTRAYAFVWGMVGENQAFSDMDHLAVRDLR"
FT   gene            265147..266163
FT                   /locus_tag="Bphy_5761"
FT   CDS_pept        265147..266163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5761"
FT                   /product="2-keto-3-deoxygluconate transporter"
FT                   /note="TIGRFAM: 2-keto-3-deoxygluconate transporter; PFAM:
FT                   2-keto-3-deoxygluconate permease; KEGG: bch:Bcen2424_5850
FT                   2-keto-3-deoxygluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5761"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74827"
FT                   /db_xref="GOA:B2JV50"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV50"
FT                   /protein_id="ACC74827.1"
FT                   /translation="MKLKKAIDRVPGGLMLIPLLLGACVHSFAPGAGKYFGSFTNGLIT
FT                   GTVPILAVWFFCMGATIDLRATGTVLRKSGTLLVTKMLVAWLATIVASSLLPIDGIKTG
FT                   LFTGLSVLAITTSMDMTNGGLYAAVMQQYGTKEEAGAFVLMSIESGPLVSMIILGATGV
FT                   AFFEPRLFVGAVLPFVIGFTLGNLDSALRELFGRCVVPLIPFFGFALGNGIDLNVIVKS
FT                   GIPGVLLGLAVIVVTGIPLILADKFIAGGNGAAGLAASSTAGAAVANPSLIGEMIPRFK
FT                   PMVPAATAMVATACLVTAILVPILTAMWSRRARVKAGVNQQIEEDSVGELKPLGAHE"
FT   sig_peptide     265147..265230
FT                   /locus_tag="Bphy_5761"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.695 at
FT                   residue 28"
FT   gene            complement(266257..267471)
FT                   /locus_tag="Bphy_5762"
FT   CDS_pept        complement(266257..267471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5762"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bxe:Bxe_B2393 major facilitator superfamily (MFS) efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5762"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74828"
FT                   /db_xref="GOA:B2JV51"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV51"
FT                   /protein_id="ACC74828.1"
FT                   /translation="MSSSPSTLARSETAAGLTRGLIALFAFSCGAIVANLYYAQPITEL
FT                   IAPSIHMSNGMASLIVSLTQIGYALGLFFLVPLGDLLENRKLMIATALVSIASLAAASF
FT                   TQAPGAFLAVSLLIGFSSVAVQILIPLAAHLAPDAARGRVVGTIMGGLLLGILLSRPIS
FT                   SIVAGHFGWRVVFGSAAVLMTIVTAVLALTIPSRQPSHQATYPQLIASLGHLVRTMPVL
FT                   RHRALYQALMFASFSLFWTAVPVELTRHYGLSQTSIGVFALVGAIGATSAPIAGRLADA
FT                   GHTVRATLIALIVGALAYTPALIHPAWGVGALVATGVVLDFAVQMNMVLGQREIYALHA
FT                   ASRNRLNALYMTSIFVGGAIGSALASPLYEHGGWTLVASVATAFPVIALVHYLAIGRPH
FT                   AASRA"
FT   sig_peptide     complement(267352..267471)
FT                   /locus_tag="Bphy_5762"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.320 at
FT                   residue 40"
FT   gene            complement(267542..268198)
FT                   /locus_tag="Bphy_5763"
FT   CDS_pept        complement(267542..268198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5763"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: bxe:Bxe_B2391
FT                   putative DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5763"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74829"
FT                   /db_xref="GOA:B2JV52"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV52"
FT                   /protein_id="ACC74829.1"
FT                   /translation="MQAVQIAFAYDFICPWCWIGHTNLNAGMQAAAPGAPVEVRYLPFE
FT                   LNPSMPVQGMDRRAYRAQKFGSWARSQMLDAQATAAGVAAGLAFDYAKVARTPNTRRAH
FT                   QFMQFAMLHGDRENVARVFDAIFAAYFSQGRDIGSIDTLVAIAQEQGFDASRARAWLIS
FT                   DEGNRALTGAQSCPQRAVINSVPTVWIDGISISGAQPPAVFAHALRAAVTQGSTA"
FT   gene            268320..269270
FT                   /locus_tag="Bphy_5764"
FT   CDS_pept        268320..269270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5764"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B2390 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5764"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74830"
FT                   /db_xref="GOA:B2JV53"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV53"
FT                   /protein_id="ACC74830.1"
FT                   /translation="MDKLLALNTLLEVADAGGFAKAAQRLGVATSSVTRLMDALEASLG
FT                   TALLTRTPRKVSLTDAGMAYVEQISKVLDDLAEADESILDSGASPVGALRITVPSAYNR
FT                   TQLAPHLAAFLAEYPRIALDVVVADHFADLALDRIDVAVRIGLISRDPNLVVKKLADNP
FT                   RYVVASHDYLQRAGTPPAPVALNEHECLRIAYGGSYRARQVWTFSRNALQERVDVRGRL
FT                   ISNSLEMLLEAVLAGHGIALLPDWLVNHEIGAGRLMRLFADFDVTPQNGEAVVYAAYLP
FT                   NRRHSSKVRALLRFLEARVGGGSTESAAWRVPPVS"
FT   gene            complement(269265..270221)
FT                   /locus_tag="Bphy_5765"
FT   CDS_pept        complement(269265..270221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5765"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: reu:Reut_B5033 regulatory protein,
FT                   LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5765"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74831"
FT                   /db_xref="GOA:B2JV54"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV54"
FT                   /protein_id="ACC74831.1"
FT                   /translation="MENHHALLATNDGFLRDLQLFCTVARRASFVTASAEMGISPSHVS
FT                   KRIALLEKSLGVKLFMRTTRRVSVTSDGEAAFQWAQKILDDVQGMADAFAGLKSDPRGV
FT                   LRISTSLRLGREHVSPILSLLRKRYPGLEIWLELLDRRVDLVGEGFDIDIRVGNIQEPH
FT                   LIAHKIVGSARILCASPEYLKRAGTPRTLADLAQHDCLLFRERDQRFGAWRLTGPDGEK
FT                   SVKVTGPIASNHSDIVQQWALDGDGIIMVSVWDVASSLESGALVRVLPQHHQPADVWAV
FT                   TSARASSSAKLRVCVDFLKQHLTHGPYALNTRGVGGL"
FT   gene            270312..271373
FT                   /locus_tag="Bphy_5766"
FT   CDS_pept        270312..271373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5766"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; Oxidoreductase domain;
FT                   homoserine dehydrogenase NAD-binding; KEGG: dac:Daci_4435
FT                   oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5766"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74832"
FT                   /db_xref="GOA:B2JV55"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV55"
FT                   /protein_id="ACC74832.1"
FT                   /translation="MRRIQLAVAGAGLIGRRHIELIQQNPRCRLTAIVDPGSAAEQVAH
FT                   RADVPLFRTLGELMEKCRPDGVVLATPNQLHVEQALQCVDARVPALIEKPVAHTLDEGE
FT                   RLRVAADAAGVPLLVGHHRAHSPILATAREIIQQGRIGKVVGVMGSAVFYKPDDYFDAA
FT                   PWRREAGGGPILLNLIHEIGNLRSLCGEIVAVHAFASNAVRQFAVEDTVAINLRFECGA
FT                   LGTFLLSDTAASPRSWEQTSRENTSYASYDDEDCYVIAGDMGSLAVPTMRLKTYARKED
FT                   RSWWKPFDKSVAGVERADPLERQLEHFCDVIAGSAHPLVTVHDGLRNLRITDAIAESAR
FT                   TGAIVDTRLHATL"
FT   gene            271396..271833
FT                   /locus_tag="Bphy_5767"
FT   CDS_pept        271396..271833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5767"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: amt:Amet_1074 3-dehydroquinate dehydratase,
FT                   type II; TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5767"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74833"
FT                   /db_xref="GOA:B2JV56"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV56"
FT                   /protein_id="ACC74833.1"
FT                   /translation="MKKVLMLHGINHNMFGKRDPAQYGTVTLEEIDSQLQALGRELNVE
FT                   VESYQTNHEGDMCLRIHQAFTDKTDAVLINAGAWTHYSYGIRDALAILTVPVVEIHMSN
FT                   IHAREPFRHHSVFAEIVKGQICGFGVNSYLLGLRAAVAALA"
FT   gene            271971..272132
FT                   /locus_tag="Bphy_5768"
FT   CDS_pept        271971..272132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5768"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   bch:Bcen2424_6479 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5768"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74834"
FT                   /db_xref="GOA:B2JV57"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV57"
FT                   /protein_id="ACC74834.1"
FT                   /translation="MLYYALVFFIIAIIAAVFGFGGIAAGAAGIAKILFFLFLVIFIVT
FT                   LLMGVVRR"
FT   sig_peptide     271971..272054
FT                   /locus_tag="Bphy_5768"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.453 at
FT                   residue 28"
FT   gene            272620..274533
FT                   /locus_tag="Bphy_5769"
FT   CDS_pept        272620..274533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5769"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: peptidase M41; AAA ATPase central domain
FT                   protein; SMART: AAA ATPase; KEGG: bxe:Bxe_B2284 putative
FT                   cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5769"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74835"
FT                   /db_xref="GOA:B2JV58"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV58"
FT                   /protein_id="ACC74835.1"
FT                   /translation="MKPAKNTFWSRYGRYVTLGVTAAAFVALVTFLHLRHDQRKVQGPP
FT                   VLTGVASDMRKDAASWTHQERDASEMLSDIRERNVTAIGVSPNAILVSTANGAKYYVTD
FT                   HNSAFSNALLLGEMKADARSPYQLVFLPDADIHTGSARWMDAFDKARDAISVLLPLLLI
FT                   GGLVWFMRREMTGGARLLEKTPALSFEDVIGAGEAKAALSDIQAYLTNPKQFTGMGVRA
FT                   PCGILMTGGPGVGKTRLAQALAGECGANFISITGSYFSAKYYGVGIQKVKHLFELARKN
FT                   APTVIFIDEADGLAKRTDTGGGPVEAESNRVINQLLAEMDGFASNEGVIIVAATNHPDN
FT                   LDEALRRPGRFDRTVAVRLPDLEDRAEIIRFYAAKLTSKADDIDFTQLARLTTGLSPAT
FT                   LSMVVNQAGLVARKAGDDTVAARHFIEAIKIARIGDVNGAERALTEDERTRIAVHEAGH
FT                   GLVAALLGTGILEEVTILPRGGALGVALITKTQDKHLYRETEMRNEIQVLLGGRNAELL
FT                   MFSEASSGAAQDLQEASRISLDMVSKFGFNADGNLFSLAALPAQYAGLQMKGAIGHANI
FT                   LLKDLNDACYALLHENAPVLRAIADQLLESETVPGETVYRLIDEHKSSRESLHLAEQPA
FT                   AA"
FT   gene            274656..275840
FT                   /locus_tag="Bphy_5770"
FT   CDS_pept        274656..275840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5770"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rru:Rru_A2831
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5770"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74836"
FT                   /db_xref="GOA:B2JV59"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV59"
FT                   /protein_id="ACC74836.1"
FT                   /translation="MDKRRVAALDAGRALAIVGVVAVHLSFQFPNLPHAVALIARMGQY
FT                   GVQLFFVISAITIFMTLEIDHERCADARHVTLRFYIKRFFRIAPLYYAAIAVYGAISYC
FT                   AMHSGFERAWVLGSHGPVDILLNVLFLHALSPTAINNVVPGGWSIGVEMLFYLIAPLLF
FT                   FAAMNRVRLMLATLALLALSVATLSFGDCNGTLDCQVSNNSFSYFWPPVQGPCFIVGMW
FT                   AWYGFRSHLLGTSNMTKRGAWMYFALAVMFAFATAAFGVWLAKSHAFAPIFAACAAVAF
FT                   LLFVCSQSDVVRRMMQSRATLFARQCASALGRESYGIYLWHFICVYATFHFFEDRFRRT
FT                   DRDLSLALYVVTVLTALVASYGLSRLSDRLIQGRATRLSRKLLSRVDGCFHGSR"
FT   gene            275969..276649
FT                   /locus_tag="Bphy_5771"
FT   CDS_pept        275969..276649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5771"
FT                   /product="conserved hypothetical membrane spanning protein"
FT                   /note="KEGG: reh:H16_A2493 hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5771"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74837"
FT                   /db_xref="GOA:B2JV60"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV60"
FT                   /protein_id="ACC74837.1"
FT                   /translation="MDTTMQAAGAEQETREPVLDTVDRVSELCFGLYMALTFVGAVSAV
FT                   TAGEDAGRKMLYSALGCNLAWGLADAVMFLVRTLTNRDRRVTLAMAVQREQNPAVAVQA
FT                   LRDALPKALKTLVADSELEMIRARIAASPMLHTRVRLVRADFIGALGIFLIVVISTFPV
FT                   ALPFVVLSDVKTALIVSRVLTLVMLFGAGYALGRFSGVGSMRAGLSMTALGVLLTMAII
FT                   ALGG"
FT   gene            277029..278660
FT                   /locus_tag="Bphy_5772"
FT   CDS_pept        277029..278660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5772"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bte:BTH_I2935 amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5772"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74838"
FT                   /db_xref="GOA:B2JV61"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV61"
FT                   /protein_id="ACC74838.1"
FT                   /translation="MNNSIQRHIGPFALMLTGLGSIIGSGWLFGAWKAAKIAGPAALCA
FT                   WVIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGALVGFISAWANWIAIVSVIPIE
FT                   AEASIQYMSTWPYEWAHNLFINSELTTPGLLLSAVLVVIYFMLNYWGVKVFARANTAIT
FT                   IFKFIIPGLTILGLMMSGFHKENLGEASTFAPYGWSAVLTAVATSGIVFAFNGFQSPIN
FT                   LAGEARNPAKSVPFAVIGSILLALVIYVLLQVAYIGAVSPADVMKGWNQFNFKSPFAEL
FT                   AIALNLNWLAILLYIDAFVSPSGTGTTYMATTTRMIYAMERNNTMPKIFGSVHPLYGVP
FT                   RPAMWFNLLVSFIFLFFFRGWSSLAAVISVATVISYLTGPISLMALRRSATDLERPLHI
FT                   PGMGLIAPFAFVCASLILYWAKWPLTGEIILLMIVALPVYFYFQAKSGFSGFNQDLKAA
FT                   WWLVAYLPVMAILSLIGSKQFGGMGVLPYGWDMLVVIVFSLIFYYWGVHTGYRSDYLDE
FT                   RDAVHGDKAFDYATAGVQADEWMSAR"
FT   sig_peptide     277029..277121
FT                   /locus_tag="Bphy_5772"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.416 at
FT                   residue 31"
FT   gene            278876..279790
FT                   /locus_tag="Bphy_5773"
FT   CDS_pept        278876..279790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5773"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: bxe:Bxe_B1127
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5773"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74839"
FT                   /db_xref="GOA:B2JV62"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV62"
FT                   /protein_id="ACC74839.1"
FT                   /translation="MDYSRILEQIHADLQPWLDKGRVADYIPELATVPVNSFGMAVVTT
FT                   AGDVFRVGQADTRFSIQSISKLFACTMAFKLLGDDLWQRVGREPSGNAFNSLVQLEAEQ
FT                   GKPRNPFINAGALVVTDVLSRRFVKAETALVEFMRRVTGVPSIDYDMRVAQSELQHAHR
FT                   NRAMAHFMASFGNMEMPPEVVVDAYCRQCAISMSCVELAQAALYLSNGGVVPSTGERIL
FT                   DPSSAKRLSALMLTCGTYDAAGDFVYRVGLPAKSGVGGGIVALLPGEMAVCVWSPGLDN
FT                   NGNSLAGVLALEWLTTQTGRSIF"
FT   gene            complement(279812..280798)
FT                   /locus_tag="Bphy_5774"
FT   CDS_pept        complement(279812..280798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5774"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bxe:Bxe_A1844 zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5774"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74840"
FT                   /db_xref="GOA:B2JV63"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV63"
FT                   /protein_id="ACC74840.1"
FT                   /translation="MRAMVFDGSSPVLAGRELTMRALAPGEMLIDVLACGVCRTDLHVV
FT                   DGELREPKRPVIPGHEIVGRVAARAADVTAFDIGDRVGVPWLGHTCGVCRYCASGRENL
FT                   CDAPGFTGYTIDGGYAEQVIADHRYCLHLPERYDDAQAAPLLCAGLIGYRTLSMAGDAK
FT                   RVGIYGFGAAAHIVAQVARHQGRAVYAFTRPGDDTAQQFARRLGATWAGGSDEAPPEPL
FT                   DAALIFAPVGALVPVALQAVAKGGVVVCGGIHMSDIPAFPYAFLWGERRVASVANLTRA
FT                   DGEAFMKIAGDTQLEIEVTRYPLADANRALDDLRNGRVSGAAVLIVR"
FT   gene            complement(280840..281148)
FT                   /locus_tag="Bphy_5775"
FT   CDS_pept        complement(280840..281148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5775"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5775"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74841"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV64"
FT                   /protein_id="ACC74841.1"
FT                   /translation="MQTKLTAHLPTVDVEITRHKLPERHAESVTIHITAVPSLEAAARW
FT                   FVQPDLFALASPLSVFSMWSMWMRAWQPWLPSALAPVQGTPEDEKRLTQNRDAASRE"
FT   gene            281686..283209
FT                   /locus_tag="Bphy_5776"
FT   CDS_pept        281686..283209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5776"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: Peptidase C24 Calicivirus polyprotein ORF 1;
FT                   peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF domain
FT                   protein; KEGG: bte:BTH_I2658 probable protease signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5776"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74842"
FT                   /db_xref="GOA:B2JV65"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV65"
FT                   /protein_id="ACC74842.1"
FT                   /translation="MLHSTLSQTWLCTAVTAACLAAYSTTDAATNATHTAAASSPAPAS
FT                   ASAKETRTAPEKTHAPMDFPAIVERYGPAVVNIRAILPDKPLAASAVPAAPAPASGTSS
FT                   EIIDGDDPLFAFFRQAMPQAQDGQSSSPRAISGVGSGFIVSPNGLILTTAHVVDGSEDV
FT                   TVRLTDRREFKAKVVAVDTQSDVAVIQIDATRLPVVKLGDSTRVRVGEQVLTIGSPDSY
FT                   QNTVTAGIVSATSRTLADGTKFPFFQTDGALNPDNSGGPVFNRAGEVVGIHVQVYADGD
FT                   RLQSLTFAIPINMANKVRAQLQTQDKEARGGSFGMQVQDVDPGLAGAFGLPRAAGALVI
FT                   AVEPGSPAATGKLKAGDVIVQVGDKPIEHAADLTDQDADLQDGAKIPVKVIRNRKQITA
FT                   MIGGTASAQPETAGATDDGALDHLGLSMHPLTDDERRTTGLPQGLMVDDVSGTGGTAGI
FT                   KPGDVVLSLNGTLVASQDELASLAAKAGKKAALLIQRNHARSFVSVNLK"
FT   sig_peptide     281686..281772
FT                   /locus_tag="Bphy_5776"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.617 at
FT                   residue 29"
FT   gene            283370..284608
FT                   /locus_tag="Bphy_5777"
FT   CDS_pept        283370..284608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5777"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   bxe:Bxe_B0092 chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5777"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74843"
FT                   /db_xref="GOA:B2JV66"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV66"
FT                   /protein_id="ACC74843.1"
FT                   /translation="MESESTSRRETRAGSAFEVLRVFLLLGCTCFGGPIAHIGYFRREF
FT                   VERRRWLDDTTFTDLFALCQFLPGPASSQVGFSIGLLRAGWWGGLAAWLGFTLPSAILM
FT                   AGFARIAGLLDNTFGQGLVHGLKLVAVAVVAQAIWDMARRLCADRVRTAVALAAIALLS
FT                   VLDTVYAQIIVIGGGALLGLMFCRTSAPADARHLSHDVHAFALPRAASAVALALFCALL
FT                   VGLPALEALLPAAWMVRIVDVFYRSGALVFGGGHVVLPLLQQATVASGWISASEFLSGY
FT                   GAAQAVPGPLFTFASYLGWIMSPAPDHALGALFATAGIFLPGLLLVIAVLPHWQALRVR
FT                   PPVAALLAGANAAVVGLLASAFYSPVWTSAVLSAADFAVAVIALLLLTRWHVRPLLVVL
FT                   LCAAAGIVESFVR"
FT   gene            284751..285812
FT                   /locus_tag="Bphy_5778"
FT   CDS_pept        284751..285812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5778"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   LuxR; KEGG: dar:Daro_0264 regulatory protein, LuxR:response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5778"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74844"
FT                   /db_xref="GOA:B2JV67"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV67"
FT                   /protein_id="ACC74844.1"
FT                   /translation="MLILFVAPTGLFRDGVARLLTDLGEHVDVRCADYASNVFEREERV
FT                   DLIVLDGDYLPDALSVATASQRLSAGLPVLVLLTAVDPQTVDQFVSAGVAGHLGKSESG
FT                   RALLDALRLLLAGSRYPASAPLVLDALPPEMATNDLPAPDASTSADASGDACADSKPHV
FT                   LTPRQIQVLALAARGETNKSIAKQLNITEGTVKVHLYTVYKALKVGSRGQASVAAARLR
FT                   QIGDAQLHHALDGRLSIGRLLAFTMPTRFRSGEVLFHKNDPSDALYYVVRGTVSLLEIN
FT                   IEVGQGTVLGEIGLFSPDHRRTCTARCISDCELLMVSATDAMRLYYQDPEFATYLIHLI
FT                   TRRLEADKLRASS"
FT   gene            286146..287930
FT                   /locus_tag="Bphy_5779"
FT   CDS_pept        286146..287930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5779"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; SMART: Tetratricopeptide domain
FT                   protein; KEGG: pol:Bpro_4216 integral membrane
FT                   protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5779"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74845"
FT                   /db_xref="GOA:B2JV68"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV68"
FT                   /protein_id="ACC74845.1"
FT                   /translation="MTADSSCSSDGLARVVRTVLFMDLVESCRLIQDNEVEAAGRWRRY
FT                   KAHIENDIVPAHRGRLIRTEGDGLMVTFVELRDALAATFAIQRASSETNAGLPAATHML
FT                   LRMGLHVTELYEDERDVYGRGVNLAARLYTLAGPGEIVVSAQVRDQLTPELDADIEDLG
FT                   QCHLKHFDQPVRAYRIGPPGPRPVIEPGSAFLPDLRPTIAVIPFASRGGEAQQQVLGEV
FT                   MADEIISSLSRTAELQVISRLSTTTFRERDATLDEISAFLGARYVLSGAYRSSGDQVVL
FT                   VVELAEARSRHILWTQSVKGRATHIMLGEDELIDRIVAEVSGAIIDRELQRARSQALPS
FT                   LASSTLLMSAIVLMHRGVSHDFHRARDMLEALIERAQRQALPHAWLGKWHVLRFNRGWT
FT                   DDRAGQAQAALDCTRRALDADADCSLALTIDGFVHTNLLKQLDVGQRRYERALEVNPND
FT                   SLAWLLKGTLLAFEGEGEQAVDATERALRLSPLDPLRYFYESLGATAALSAGRYERAVE
FT                   LAQRSLRVNRTNTSTLRALAIAQALLGDLEAARQTVQEVLLLDPSLTVKSYLDRSPSGA
FT                   YETGKIWSEALRQAGLPA"
FT   gene            287978..289270
FT                   /locus_tag="Bphy_5780"
FT   CDS_pept        287978..289270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5780"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   pol:Bpro_4217 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5780"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74846"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV69"
FT                   /protein_id="ACC74846.1"
FT                   /translation="MSGLGGAGGAGGAGGAGGAGGAGGAGGAGGAGGVYDQGAGAIPCD
FT                   GPLFAQALIGHRDGIVGSWRVPEELTLNFDLQRFQPLDDYRQLWRWEPWVRATAIDFEL
FT                   LSNLRFSIEPGANPGEQHAQLWHRSPTGGVNDLKLVSLSRPDQSVFKAQAEWLDFYSDL
FT                   REDRMAEILCQLGPQHAFWGMLIYLHPGRTPKTIELLDTAVRFAIFAEIRFKHALAAPR
FT                   AIEYSSQMQPMIQTPGHGSMPSGHSTQAFIVAVVLCALFNQKFGTLFYQQAMRQAYRVA
FT                   VNRTVAGVHFPVDSIAGHVLGTALGEYFVARCTRNLPSVPASPPPPPAVQHDPARYMRP
FT                   NGNFTPRAFLGHVLTATDNPDFDYHEPLSPDDVTNYAQLHKIANPTTVPGMFPFLQWDP
FT                   PVVVDGSNILSWLWNQAESEWNGNGLANTKF"
FT   sig_peptide     287978..288043
FT                   /locus_tag="Bphy_5780"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.294 at
FT                   residue 22"
FT   gene            289312..291558
FT                   /locus_tag="Bphy_5781"
FT   CDS_pept        289312..291558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5781"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5781"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74847"
FT                   /db_xref="GOA:B2JV70"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV70"
FT                   /protein_id="ACC74847.1"
FT                   /translation="MTWQSLTGAGGAWSGIDWTARAADTASADPYLAWADTTQFADLGG
FT                   PPAGWIRVIIELQANAPDGTALTARSFADSLEGANAPWQAWIRVSSLYRYPPADLDQTR
FT                   FLTAVVTNAFFARLDTTLKGYVKRFEIGMPVVPDDAPATNTMPDAETLAAGTGPVFGPV
FT                   PPTSASAVSAAPGPMVFLGVMDDGLAFAHERFRSTATPSATRIERFWNQDDASGAPPAL
FT                   HYGRQFTKAGIDALLACCTQGGQVDEDAVYAQAGYINVRKRWAHGTEVMDLAGGLRPNP
FT                   LHAASMSPDERAQRDALANVRLLGVQLRTAGRTVRDTTGRWFAVHALDAMRYILRCADD
FT                   LAGGAKYCVVLNLSYGYMAGPHDGSSIIESAIDELIALHHDLSVVVPAGNSNVLRCHAS
FT                   FSVANGASKDITWRALPDCATPGFLEIWLPDHADESNVTVQIRPPWGDPSPAIAVKNIA
FT                   AWQNGRDVLCTVVYLDRAATGRRTMILIALAPTVTRQPARIAAPAGNWVVTLANRASTN
FT                   GSLDIHAWVQRNETAYGFPLRGRQSRFEDPRYKRFFGGMHVRDSDDNNTDSWISRRSTL
FT                   NSIATGDATVVVGAYRRTDGTAAVYSSTGPSLRQTVRDGPDAAAISEDSPACAGVLGAS
FT                   TRSGSLVAMSGTSAAAPQVARLLACARVLGKAPVISPHGMPPFSARDWVEKRAGQEDPA
FT                   PTALMAHRLGTCPGTAAPPVLPLPDHAWVPMLPGPRGGSGRFPSPRWKKRGVKL"
FT   gene            complement(291652..291924)
FT                   /locus_tag="Bphy_5782"
FT   CDS_pept        complement(291652..291924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5782"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74848"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV71"
FT                   /protein_id="ACC74848.1"
FT                   /translation="MKTMLILCGGVLCLSTMQAYAQETTTTPHASTATPETTINSEGPG
FT                   MSSTSMSGGMTTSHGKSRADVYQDLVHSQQSGEAQRLNDLFKGGN"
FT   sig_peptide     complement(291859..291924)
FT                   /locus_tag="Bphy_5782"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            292255..293628
FT                   /locus_tag="Bphy_5783"
FT   CDS_pept        292255..293628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5783"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   mac:MA3604 carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5783"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74849"
FT                   /db_xref="GOA:B2JV72"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV72"
FT                   /protein_id="ACC74849.1"
FT                   /translation="MSRYHARITGKDQAALADLVTKHKIIVARHTIEKVHDGYRIDAHA
FT                   TDAQLKALEAAGYTVDRREDAEAEGKVRQRETRARTAGPQEPESLSVAAGTGYLDVEQV
FT                   EAALAAATATPNDTFARLIKLPHATWEKRTCHALKIGNGSGAARPGIYFLGGVHAREWG
FT                   SPDILIHFVQLLSNAYTTHTPIKIGSRTFSAADIKHVIETKDLFVFPQANPDGRHYSMT
FT                   AESMWRKNRRPAPAGHTKPQCCGVDINRNYNFLWNFPQYFDPQSPIANSTDPCDYEVYI
FT                   GPSAESEPETQNAVWMFDTYPNIRYFVDLHSYSEDILYNWGDDEDQSSHPDMNFQNAAY
FT                   DGKRGIANDNAYREFIKSEDKKIAVHLANAMRDAIRASRGRVYKTEQSMSLYPTAGTSD
FT                   DYAFSRHIVDAKKAKVFSYTIEWGSPDNPTPFHPAYPEMKQIIDEVTSGLLAFCIEAN"
FT   gene            293935..294219
FT                   /locus_tag="Bphy_5784"
FT   CDS_pept        293935..294219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5784"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74850"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV73"
FT                   /protein_id="ACC74850.1"
FT                   /translation="MPVMKMETPADVATLRSASLADVELEHLERMVQYVVRRTESDDVS
FT                   KLDYEYWGKRLRKLAQTYDLVTTQRQRVIALLDLLEREAVYQARRTVAV"
FT   gene            complement(294247..294906)
FT                   /locus_tag="Bphy_5785"
FT   CDS_pept        complement(294247..294906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5785"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_C0260
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5785"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74851"
FT                   /db_xref="GOA:B2JV74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV74"
FT                   /protein_id="ACC74851.1"
FT                   /translation="MKDVVAAAETRKETKRARGRPASSASVGPDLILRNARKTFGKRGF
FT                   EATSVREIARDSGVDAALVAHHFGSKETLWLAVVEQIAEQMAPMIEATGALQRSRLGAR
FT                   ARVESAVVRFIDEVFSDPDVGIFFSTAATEEGERLNVLIERLVRPYHDALVPLFADAAR
FT                   HGEMKIKDASVMFFMLLNAISKTVAYSHLMRAFSSLPEHEKKFKHTVLETALGMLA"
FT   gene            295044..295439
FT                   /locus_tag="Bphy_5786"
FT   CDS_pept        295044..295439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5786"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_4135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5786"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74852"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV75"
FT                   /protein_id="ACC74852.1"
FT                   /translation="MSERVRIEPVADVWPRTVAAIRNFEVRREPIETPRPGGRRARAAA
FT                   SWDERSQPTVRVLDKPTPHTLTVSWCDARTGHYGYQTWRVHIARRAGTCVLTGRAIAAG
FT                   EMVYCPRANGTPPGNAGAMIVASDIGW"
FT   gene            295690..297156
FT                   /locus_tag="Bphy_5787"
FT   CDS_pept        295690..297156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5787"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   bxe:Bxe_A2914 signal transduction protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5787"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74853"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV76"
FT                   /protein_id="ACC74853.1"
FT                   /translation="MSPVVKSELLEKLWARMSERGDFPMLSQALRSTVSAMNNDDLDFT
FT                   SLVQVVLSDVGLTQKVLRLANSAMYVAFGGNITTVTRALMVLGMDTVGHLVVGMKIVDH
FT                   FHQSAPHRIDAKLELNRALLCGTVARRITEGFDLRVAEEAVVCALMRQIGRLLVAFYLE
FT                   GEWDRLRRTAASEEVDDSEACAMLLGVSFEDIGIEAARRWRLPETISAGMQAIGAPSDE
FT                   PLSEQVRWLRAVNSYATEVGNALVTHAPGDELAGRLTELAALYSDALRMDASRLAHLSA
FT                   ALIDEESSEGLMQEISELRAHADAIVRTGKSAQARLSAGLEDLRALPSSKALSPVLTLA
FT                   SETILAGLSLSRTLVFVRQADARYHARIGFGPDMERMLPTLNFGAGFQPDVFHLAIANP
FT                   VGIFIENAHEPRMEARLPDWFKAHLADAEAFVLLPVRAKDTTVALVYGDWTGPAAVHKI
FT                   TQPEMAVLNELTRELSRFFYGANLEEAEML"
FT   gene            complement(297221..297904)
FT                   /locus_tag="Bphy_5788"
FT   CDS_pept        complement(297221..297904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5788"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B1631 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5788"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74854"
FT                   /db_xref="GOA:B2JV77"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV77"
FT                   /protein_id="ACC74854.1"
FT                   /translation="MSAFAFDAVLFDCDGVLVDSETITNTVLADMLGELGWQLSVDEAM
FT                   SIFVGKTVMDEAPLIEAKTGVTITRAWLASFRERRNAALEREVTAIDGIVASVADLYAR
FT                   VDGRIAVASGADRLKIRLQLAKIGVLEFFDGHIYSGHETARNKPYPDVYLAAAAGLGVD
FT                   PARCAVVEDTVTGATAGRAAGATVFGYSPSEKGHSSKAALRTVGVAEVFEQMAHLPALL
FT                   AGWQR"
FT   gene            complement(298012..298110)
FT                   /locus_tag="Bphy_5789"
FT   CDS_pept        complement(298012..298110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5789"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74855"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV78"
FT                   /protein_id="ACC74855.1"
FT                   /translation="MPVQAEMGSSPFIGNAGANPQVVTRVGLRHRC"
FT   gene            298398..299198
FT                   /locus_tag="Bphy_5790"
FT   CDS_pept        298398..299198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5790"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bxe:Bxe_B0967 putative Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5790"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74856"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV79"
FT                   /protein_id="ACC74856.1"
FT                   /translation="MSSPIEQYRIYAVKYAHFERRSRDNFIGGDSHDVPMPLDYFVWAV
FT                   VGESRTFIVDTGFDQTMADKRGRTITNTVARGLNQIGIRADDVEDVIITHMHYDHAGNH
FT                   ALFPRARYHLQDREMAYCTGRCMCHHALSHPFEPEDVKSMVGRLFEGRVQFHDGASQIT
FT                   PGLSVHWVGGHTNGLQVVRVHTQRGWVVLASDASHFYANMQEHRPFPVVYNVGDMLEGY
FT                   EAAHRLASSPNHVIPGHDPAVLTRYPSHDRATEGWVVRLDAEAR"
FT   gene            299211..299996
FT                   /locus_tag="Bphy_5791"
FT   CDS_pept        299211..299996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5791"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B0969 putative short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5791"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74857"
FT                   /db_xref="GOA:B2JV80"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV80"
FT                   /protein_id="ACC74857.1"
FT                   /translation="MTLKGKGALVTGSSNGLGLAMARALAGAGCDIVLHGLETPQQMAR
FT                   TTDELAASFDVNVAYVQSDLASAAGVDALIDNAQARMKTLDVLINNAVVRHFAGLESFP
FT                   LEHWNNALAVNLTAAFRAIQLTLPGMRERGWGRIFNMTSVYGARAIANRVDYVTTKTAL
FT                   LGLTRSVAIETLNQGITCNAICPGSVLTPNIDSRIDAVMRERGLQRSDAVREFLKGKQP
FT                   TGELVDAAHVGELVVFLCGPSASQITGAMMPIEGGWLAG"
FT   sig_peptide     299211..299291
FT                   /locus_tag="Bphy_5791"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.553 at
FT                   residue 27"
FT   gene            299986..301371
FT                   /locus_tag="Bphy_5792"
FT   CDS_pept        299986..301371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5792"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: bxe:Bxe_B0971
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5792"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74858"
FT                   /db_xref="GOA:B2JV81"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV81"
FT                   /protein_id="ACC74858.1"
FT                   /translation="MQAEPVDAKALHGGALTRTLARFVAHTQWRDVPVAVRNEAKRSLV
FT                   NYFAVALAGAHDSTLDRAVAVYGRFRADESTTLAGRSERTDMLNAAALNAMSANVYDFD
FT                   DTHIPTIIHPTAAIAAALFALAESHPMSGKALLLAFVLGVDVACRIGNAVSPEHYQRGW
FT                   HITSTCGVFGAAAAVAKARGLDEDAIVWALGNASVQTGGLVETLGTMSKSISVGNAARN
FT                   GLLAALLAEDGFSGPDAPLEGDRGFLRVSASHPKWNALTEGLGREWELLKNTYKPYPCG
FT                   VVLNPVIDACLDVRRGARWSLNDIEQIELKGHPLLRERTDRPGVRTGRESQVSAQHAVA
FT                   VVLARGKAGLDEFSDAAVADPSLRMLARRLRFIDDLSWPVESAQVTIVLRSGERIAHRV
FT                   HAARGSLAAPLANGELADKLHQLAAYGRSGVDTHALIERLWNFETEHDAAAVMRLARAR
FT                   TTS"
FT   gene            301400..302323
FT                   /locus_tag="Bphy_5793"
FT   CDS_pept        301400..302323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5793"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: bxe:Bxe_B0972 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5793"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74859"
FT                   /db_xref="GOA:B2JV82"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV82"
FT                   /protein_id="ACC74859.1"
FT                   /translation="MSSSQASSQQRGPLLGFVGVGTMGRPMARRLIEAGHALVVFDRDE
FT                   AAVAELKAIGAQAAASVREIADSARIVFTSLPTPAIFRQVALGDGGLIEGSAIKVLVDL
FT                   STVGSRVEKEVAQGLLAKGVETVDAPVSGGAAGAKKGTLAIMAAGSPVALEEVRGLFDV
FT                   LGKAFVVGDKAGQGQLLKLLNNMLSSTAFAITSEAFVAGVRGGLDPEVMMSVINAGSGK
FT                   NGATLDKFPKHVLPGSFDFGFPVGSVCKDIGLAVDECQALGVPMWVGSVARQMWNYAAM
FT                   QDGAARDMTELVKYVERWSSVEGLED"
FT   gene            302354..302680
FT                   /locus_tag="Bphy_5794"
FT   CDS_pept        302354..302680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5794"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   bxe:Bxe_B0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5794"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74860"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV83"
FT                   /protein_id="ACC74860.1"
FT                   /translation="MIVEMRIYHCAPTRLPALLDRFTSTTLGFFEKYGIRQIGFWTTLI
FT                   GASNHALTYMIEWESLAEREEKWNAFQADAEWIAKRAASEAERPIVERIESHILTPTSF
FT                   SKLR"
FT   gene            302693..303580
FT                   /locus_tag="Bphy_5795"
FT   CDS_pept        302693..303580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5795"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: bxe:Bxe_B0974 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5795"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74861"
FT                   /db_xref="GOA:B2JV84"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV84"
FT                   /protein_id="ACC74861.1"
FT                   /translation="MTQRKRIGFIGLGMMGAPMVQCLVDAGFELYVDDADAARADALAA
FT                   QTGARRLKRDNAASLDALITMLPNSTIVESVLLGGGADGWASLLAQGAVVIDMSSSEPE
FT                   RSRKLGAVLEERGLAYLDAPVSGGVKKAKEGTLAILVGGHADVLEQCKPVLAAMGRSIL
FT                   HIGGAGAGHAAKALNNYVSAAGLAATVEALHVAQRFGIEPDVMTDVLNASSGRSNTSEN
FT                   KVKQFMLSGTFASGFALQLMNKDLKIARALAQAVGYPMVLGETCAAMWDEAAQHSTPAT
FT                   DHTEMYRLLDRDAR"
FT   gene            303603..305033
FT                   /locus_tag="Bphy_5796"
FT   CDS_pept        303603..305033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5796"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bxe:Bxe_B0975
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5796"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74862"
FT                   /db_xref="GOA:B2JV85"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV85"
FT                   /protein_id="ACC74862.1"
FT                   /translation="MSHAAQFYIDGCWVEPASARWFDLVDPSTEGPFETLAVGNADDVN
FT                   RAVAAARRAFPAWSATSVAERVALLRRVLQIYERRTDEFAEAMRREMGAPITFARNGQA
FT                   ARGPAHLNTLIDVLERFAFEEQRGSTRVVLEAIGVCGLITPWNWPVNQIVVKIAPALAA
FT                   GCTMVLKPSEYSPLSALLFAEVLDEAQLPAGVFNLVNGDGPDVGEAIASHPDIDMVSFT
FT                   GSTRAGVLVAQAAAPTVKRVAQELGGKSANILLDDVDLEEAVKRGVAACFTNSGQSCSI
FT                   PTRMLVPRHLMNDAAQIAKRAAQTYRVGPTDDPSTQLGPLVNRAQFERVQALIQRGIDE
FT                   GARLVAGGTGLPAGIDKGYYAKPTIFADVTPDMTIAREEIFGPVLSMMPYESEEEAIEI
FT                   ANGTDYGLAAYVQSADLTRARKVGRALRAGGVHLNYPPADFHAPFGGYKRSGNGREWGE
FT                   AGLREYLETKAIVGYGAS"
FT   gene            305164..305559
FT                   /locus_tag="Bphy_5797"
FT   CDS_pept        305164..305559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5797"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bxe:Bxe_B0976 putative gamma carboxymuconolactone
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5797"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74863"
FT                   /db_xref="GOA:B2JV86"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV86"
FT                   /protein_id="ACC74863.1"
FT                   /translation="MDSSERFDKGFENRKEVLGAGHVEKSWANADDFNRPMQKYVTECC
FT                   WGDIWGDRTLSFKTRSMLNLGMLTAMSQHHELAVHVKGALRNGVTQEEIRAVLMQAAIY
FT                   CGVPLALAAFRVASEAIKAYEAETSAA"
FT   gene            305637..306986
FT                   /locus_tag="Bphy_5798"
FT   CDS_pept        305637..306986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5798"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0977 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5798"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74864"
FT                   /db_xref="GOA:B2JV87"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV87"
FT                   /protein_id="ACC74864.1"
FT                   /translation="MKTLTATDIVQSEGEQSIETKRRNAIKGAFFSEYIDMFDIYLPVV
FT                   VLSPVLAFFQPPHLSSGMETILASLVFITTLLGRPIGALLFGMVADRIGRRKASIWSVS
FT                   GFGVVTLLIALLPGYESIGIMSYWLLVLLRFVDGIFLGGGYTGAMPLAIEYSKKEQRGF
FT                   VGGFIIAGFPAAYVSINLVAMLMFALFPLSGMNSPYAQWGWRIPFVLGAVLAGILAMYY
FT                   VHKVAESEIWKSEAADKGNQPDKLPLTDLLRGKSGRNLLQVLVMMTGFWLTQNIITIFL
FT                   PTGLLVKTLHLTGFQMTSTLMITYFVLFFSYIGSGLIAQAIGRRRFFAIVGPLIATVGA
FT                   GLLYVLANVDGLSLPAIIAIVCVLAVLVTSPWGVIVTYINERFVTDVRATGFGVGFSLS
FT                   VIIPSFYAFYMDWLSAFMPLRMTSVVLLCIGGLIGAIGALMGPETKDVDF"
FT   gene            307018..307938
FT                   /locus_tag="Bphy_5799"
FT   CDS_pept        307018..307938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5799"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_B0978 putative 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5799"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74865"
FT                   /db_xref="GOA:B2JV88"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV88"
FT                   /protein_id="ACC74865.1"
FT                   /translation="MNKERIGFIGLGNMGGRMTRRLVDAGISVLGYDTAPERVKAAGAQ
FT                   AASSIADVMKFADVVMMSLPDSKVVEAVVEGDGGVLAHCRARQIVVDLSTAAASSTIRL
FT                   ARRFTQSGVQYVDAGISGGAAAAEKGALTLMVGGDASAVDALKWAFAPISSKVAHMGES
FT                   GAGHTTKLLNNFLNAVSLSASAEVMVAGKKAGLDLHLLLDVLNSSSGVNFATLNRFPKI
FT                   VDGDYLEGGLTGKLMTKDVVLYVDRARELGVVSLNAAGPLASFGLGTALGYGDVISNRV
FT                   VDAIGDVSGGVRLFDGKICKEEKQA"
FT   gene            307935..308330
FT                   /locus_tag="Bphy_5800"
FT   CDS_pept        307935..308330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5800"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bxe:Bxe_B0979 conserved hypothetical protein with cupin
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5800"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74866"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV89"
FT                   /protein_id="ACC74866.1"
FT                   /translation="MKVFHGRAEGKMSEQRGETFSGTVWADPVMPPTDGVTINTVFFAP
FT                   RGRTYWHTHEQGQVLQVTAGKGWICKEGEAPQEIRQGDIVFIGPNERHWHGASDGSYMV
FT                   HIATSIGKATWQEEVAEADYPKGLVAR"
FT   gene            308393..309178
FT                   /locus_tag="Bphy_5801"
FT   CDS_pept        308393..309178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5801"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bxe:Bxe_B0980 putative gamma-carboxymuconolactone
FT                   decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5801"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74867"
FT                   /db_xref="GOA:B2JV90"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV90"
FT                   /protein_id="ACC74867.1"
FT                   /translation="MKQEPARAQREPQQIKDDFMRVHGVWNAAWDSMLRLDAGFVDAYV
FT                   QFSAVPQRRNHLDDKTRAFIALAADACATQLYGPGVAHHLERALVFGATREELMEVLEL
FT                   ISTIGIHTSNVGVPVLLEVLEEEGLRAGPAPLDERRRVLKEAFEKNRGYWHPTWEGLLE
FT                   LDPDLFEAYVEFSSVPWRTGVLSPKIKEFMYCAFDASSTHLYVTGLKLHMRNALRYGAT
FT                   ADELMELLEIVSTTGIHGAELGAPLLEAALAKRYAAADA"
FT   gene            309272..309955
FT                   /locus_tag="Bphy_5802"
FT   CDS_pept        309272..309955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5802"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B0982 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5802"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74868"
FT                   /db_xref="GOA:B2JV91"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV91"
FT                   /protein_id="ACC74868.1"
FT                   /translation="MSTDIGLVRPETLRHQVENVLRQAIMSGRFAPGARLIERELCETL
FT                   GVSRTSVREALRKLEAEKLVRSVPHKGPIVAVMSQQEASELYALRGLLEGFAAHEFARL
FT                   ASDDAIAQFGEAAKELRAQATAHDQAGVLKAKTALYDVLLDNCGNALVKEILNSLYSRV
FT                   NLLRATSLMHPDRLPSSLREIDKLYKALKARNADEAQELARQHVANAEKAAMRMLGESE
FT                   DAQQA"
FT   gene            310523..311062
FT                   /locus_tag="Bphy_5803"
FT   CDS_pept        310523..311062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5803"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: bxe:Bxe_B2414
FT                   putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5803"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74869"
FT                   /db_xref="GOA:B2JV92"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV92"
FT                   /protein_id="ACC74869.1"
FT                   /translation="MWLSAEARADVEAGKAKAQACVACHGPMGNSTDRQYPVLAGQPAR
FT                   YTYLQLKDFRERRRKDPRMSPIAAKLSKDDMQDLADYFAAQKPAPIDFKADSVAVEGGS
FT                   RKSATELCAKCHPNNFSGQNEVPRVAGQHYQYIVKQLQDFRSRIRTNDAGNMGSVARNL
FT                   TDEDIRNLASYIANLH"
FT   gene            complement(311059..312006)
FT                   /locus_tag="Bphy_5804"
FT   CDS_pept        complement(311059..312006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5804"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   reu:Reut_B4605 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5804"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74870"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV93"
FT                   /protein_id="ACC74870.1"
FT                   /translation="MPPTLVYTHAACLNHQPGPHHPESPKRLDTVLKTLRSPEFAALAW
FT                   RDAPMGTVEQVQLIHRQDFIDEVAESAPSHGYMPLDGGDTVMSPGSWEAVMRCVGAACA
FT                   GVDAVLAGEARNVFCATRPCGHHAEPSKAMGFCIFNQAAIAAAYAYEVHKLERVAVVDF
FT                   DVHHGNGTQAAFYNRPELFYASSHQSPLYPGTGKAAETGVSHNVLNVPLPPGCDSQLFR
FT                   SRIELDMLPALREFNPELVIISAGFDAHRLDPLAALRLDDDDFYWITRELVKIADDTCG
FT                   GRIVSILEGGYSMEGLSGGTRAHVLALMGQQPQR"
FT   gene            complement(312157..313275)
FT                   /locus_tag="Bphy_5805"
FT   CDS_pept        complement(312157..313275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5805"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bch:Bcen2424_6270 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5805"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74871"
FT                   /db_xref="GOA:B2JV94"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV94"
FT                   /protein_id="ACC74871.1"
FT                   /translation="MQQRAPAAATHHQGERPAHAAPAIAWREKRFAPSKLVALLDVTSQ
FT                   AGLDANAVLAGTELGADAVANPFTLTSSLQFLTAARNAVRMYGKPDLGVRVGRSLHASS
FT                   YGMYGYALLCSETMTQTFDTAVKYHQLANGMLDIRWAEHDDAATWIFPKRNEVRVPDVD
FT                   EPLYDFLIDLQFAVHVTVIKDVMGAWCVPARAMFTRAQPPHAALLADVLECPLVFEQPQ
FT                   NLLSYPAAWLSRTPQLANPITAAQVSTQCARLLEQFRWQAGITRRVYQELTRTPGRFPD
FT                   IEQIAESLCMTSRTLRRKLEAEGASYSELLTGVRKALAVDYLKTTALSVDDIALTLGFS
FT                   DAVSFRHAFKRWTGKTPNDVRRDGGASINERL"
FT   gene            313522..315210
FT                   /locus_tag="Bphy_5806"
FT   CDS_pept        313522..315210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5806"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bch:Bcen2424_6272 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5806"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74872"
FT                   /db_xref="GOA:B2JV95"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV95"
FT                   /protein_id="ACC74872.1"
FT                   /translation="MDDSRIEHRLCTRLCTNPPEERHWIASYGSIPVEIDADRHPSINA
FT                   LLEVAMRRFAAKPAFRAFGQTLTYADIDRLSTAFAAYLQKVAGVRKGDRVAVMLPNLLA
FT                   FPIAFIAIAKIGGVQVNVNPLYTARELEHQLNDAGVETIVVFDGSTCALAQALGSTKVK
FT                   TVITAGAGDGSGAVIPGPAADTALRNAITLPQALARGTRLEADPVGVDGNDLLFLQYTG
FT                   GTTGPSKGAVLTHRNLVANIEQFKAFMPDALRPGEETIVTAIPLYHIFALTVNFLTYFS
FT                   VGAENWLVANPRDVDPFIDVLKAARPTIFVGVNTLYACLAAHPRLPEVDWSRLRLSAGG
FT                   GAAVIDVVSQRWKSVTGSFIREGYGLSETSPVVSFNPQFIDAFTGTIGLPVPSTDVKLL
FT                   DDENREAAIGEPGEICVRGPQVMRGYWQQPEANARAFTADGYFRTGDVGVFDAKGFLRI
FT                   VDRKKDMVLVSGFNVYPNEVEAVATALPGVAECACVGVPDERTGEALKLFVVAAPGAGL
FT                   TQDALIAHCRASMAAYKVPKIIRFVEALPKSTVGKILRRELRGVD"
FT   gene            315257..315736
FT                   /locus_tag="Bphy_5807"
FT   CDS_pept        315257..315736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5807"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: reu:Reut_A0233 YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5807"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74873"
FT                   /db_xref="GOA:B2JV96"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV96"
FT                   /protein_id="ACC74873.1"
FT                   /translation="MRCIRFCAHHNPGGVVSIDMGNFTPVFSLAGGLVIGAAAAVLVLF
FT                   NGRIAGISGILGGLLRASCDDAGWRVAFIAGLIAAPVLASLFGKPITLDIQAGWGEIVV
FT                   AGFLVGIGTRYGSGCTSGHGVCGISRGSVRSLVATATFMGAGFLTVFVLRHLAGG"
FT   gene            315738..317231
FT                   /locus_tag="Bphy_5808"
FT   CDS_pept        315738..317231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5808"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; sulphate transporter; KEGG: bam:Bamb_4465
FT                   sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5808"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74874"
FT                   /db_xref="GOA:B2JV97"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV97"
FT                   /protein_id="ACC74874.1"
FT                   /translation="MRAFAVLLVSLLSGLLFGVGLMVSGMANPAKVLGFLDLAGRWDPD
FT                   CSTRGSGHKLVRVTLRRCGDEWAVPAVPSTRSVSLNPTGPRGGLGGTPDLRGNEVTCLI
FT                   GGACLLAILLLRRWLPSVPGILVAVVGATLAVALLDLDKRAGVAVVGSVPQGLPMPSFP
FT                   AVPFDQIFALVPGALAIGLISLADISVLSRVFAERSAEHVDRDQELVALGACNIVAGMF
FT                   QGFPVTGSSSRTPVAESAGAKTQLTGVVAALCVAALLIFAPALLRTLPQAALGAVVVAA
FT                   GLGLFEIHDVFRLLRLRRSEFLQSMACFAGVALIGPIQGIFIAVGLALMAFVWRAWRPY
FT                   DAVLGRVYGRKGYHDMMRHPDARTIPGLVLYRWDAPLFFANAEIFRDHVQRAIDNASPP
FT                   ASWVVVAAEPITDVDVTASELLRDFHAGLHERQIELCFAEMKGPVKDMLQRYGLFDVMG
FT                   EQHFFPTLGVAVDAYLAQHDVEWRDWEDEREPPSKGQQT"
FT   sig_peptide     315738..315821
FT                   /locus_tag="Bphy_5808"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.919 at
FT                   residue 28"
FT   gene            complement(317250..318350)
FT                   /locus_tag="Bphy_5809"
FT   CDS_pept        complement(317250..318350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5809"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bxe:Bxe_A3924 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase dimerisation and phosphoacceptor region; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5809"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74875"
FT                   /db_xref="GOA:B2JV98"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV98"
FT                   /protein_id="ACC74875.1"
FT                   /translation="MATPKNKPSCIARAASVSDAPLEDRYMLLIEAVQDYAIFMLDAGG
FT                   NIASWNPGAQRIKGYTHDEIIGRHFSTFYTEEDIAAGKPARELQIAAAEGHVEDEGWRV
FT                   RRDGSRFWANVTISAVRDANGALLGFAKVTRDMTDRMRLTELERASEVSAQVQITRENE
FT                   QKRIARELHDDLGQQLTALKMSVALIEATLAQKDDTAHLVPQTHALQKEIDAMAMSLRR
FT                   IAADLRPPLLDDLGLTAALEWLAEDFTKRYRVAATVHVEADEPQFNEFASTTLFRIVQE
FT                   ALTNVARHAAASHVRIELARDGATVSLEIEDNGVGAKPGLPSGNKSFGLLGIRERVRQL
FT                   HGTVSYISSPGAGFRMSIRVPIADVR"
FT   gene            complement(318608..318985)
FT                   /locus_tag="Bphy_5810"
FT   CDS_pept        complement(318608..318985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5810"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5810"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74876"
FT                   /db_xref="InterPro:IPR021947"
FT                   /db_xref="UniProtKB/TrEMBL:B2JV99"
FT                   /protein_id="ACC74876.1"
FT                   /translation="MRITLHLDTFECADPAAYAILWLDRDARKWSREGHAAVDLPEWGT
FT                   LALTKDCTRIVGTLGADRDRLCCELTGLDLLSPQGPFEGESGRALWYRYADRAPVVGQW
FT                   HVQWIDETDTEPEHGVFADEF"
FT   gene            complement(319334..320134)
FT                   /locus_tag="Bphy_5811"
FT   CDS_pept        complement(319334..320134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5811"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bte:BTH_II1244 transcriptional regulator,
FT                   Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5811"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74877"
FT                   /db_xref="GOA:B2JVA0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA0"
FT                   /protein_id="ACC74877.1"
FT                   /translation="MLAATDLDTAVALAPTSPAPRTATIVPIHPVARDERSPQRASRCS
FT                   TCAMRAVCMPAELSAAELARLDSIICVTRPVKRGDTLYRAGDAFHSIYAVRAGSFKTVV
FT                   MHRDGREHVTGFQIPGEALGLDGIGAGQHSCDAIALEDSAVCIIPFAHLEVICREMKPM
FT                   QHHIYQMMSSEIVRESSQMMLLGTMSAEQRVATFLLNLSRRFKARGFSAAEFHLRMTRE
FT                   EIGCYLGMKLETVSRMVSKFQREQLVRANGKTIRIVDPEGLARV"
FT   gene            complement(320148..320564)
FT                   /locus_tag="Bphy_5812"
FT   CDS_pept        complement(320148..320564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5812"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   bpd:BURPS668_A1635 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5812"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74878"
FT                   /db_xref="GOA:B2JVA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA1"
FT                   /protein_id="ACC74878.1"
FT                   /translation="MDMDTAVSTIVSKVYLVDAAVEVRRRLACLLGAIAGVEVAGEAQD
FT                   GDAALDGIVACDADIVVLDLRLGGGTSLDLIRALTRTHPAIVKIVLTNHTARALRAACE
FT                   AAGADFFFDKTSEFDAACHTVAGIARARGARARE"
FT   gene            complement(320677..321324)
FT                   /locus_tag="Bphy_5813"
FT   CDS_pept        complement(320677..321324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5813"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bur:Bcep18194_B1652 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5813"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74879"
FT                   /db_xref="GOA:B2JVA2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA2"
FT                   /protein_id="ACC74879.1"
FT                   /translation="MIKVILADDHTLVRDGLRHILQSASGFKVAGEACDSATTLALVRA
FT                   TDAHVLVLDLSMPGRNGIDLIRQIKDEKPALRILVLTMHAEQQYAVRAFKAGASGYMTK
FT                   ESASAELVGAVTKVAAGGVYVSLAMAERFAQNLTEPAEALPHQRLSPREFDVFRRIVAG
FT                   QTTTGIALELCLSVKTVSTHKAHILEKMQMPNENGLVRYAIRHKLIDGEADI"
FT   gene            complement(321642..322478)
FT                   /locus_tag="Bphy_5814"
FT   CDS_pept        complement(321642..322478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5814"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bvi:Bcep1808_6335
FT                   UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5814"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74880"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA3"
FT                   /protein_id="ACC74880.1"
FT                   /translation="MSYKTLLVHIDDSRRSDTRIALSLELAQRWDAHLIGLYVVCQDLF
FT                   RPIFRQDKTLSFAQIEAQEANRREKAENAFLAAAERAGRSAEWRAPPGPALDVAMLHAR
FT                   HADLLVLGQQDPNDPASFVAPHFVGDLVLGAGRPALVVPYAGEVRTLGENVLLAWDGSR
FT                   EAARAAADALPLLQRARHVGIEIVHAHGQAQSPDAPEGIDVAAWLETHGVRAAFSTTPH
FT                   HVGIGAGATLLNRASDLHADLLVTGAYGHARARERVFGGVTRTMLESMTVPVLMAH"
FT   gene            complement(322504..323343)
FT                   /locus_tag="Bphy_5815"
FT   CDS_pept        complement(322504..323343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5815"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bte:BTH_II1566
FT                   universal stress protein family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5815"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74881"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA4"
FT                   /protein_id="ACC74881.1"
FT                   /translation="MSYKSILVQLDTGVHAHPRLETALRVAHQFHARLTGLFTTYLPDP
FT                   HAFFVMAGTASYYAEHERQRNEHGAALERLFHAEAARAKIDGRWIAAAGYANDVVPPYA
FT                   RLADLVIAGQADPQDPESFIADQFAEHLLMSAGRPVLLVPATGTHATLGHRVLVAWDGS
FT                   REATRAIHDAMPFLSHAADVTLITVNATRNEPPSRRIPGADIALTIARHGVKVNVRELS
FT                   VENDAAIGDVLLSQAAESGCDMIVMGAWAHSRLHELVLGGATRTVLKSMTVPVLLSH"
FT   gene            323574..324614
FT                   /locus_tag="Bphy_5816"
FT   CDS_pept        323574..324614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5816"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bte:BTH_II1565 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5816"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74882"
FT                   /db_xref="GOA:B2JVA5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA5"
FT                   /protein_id="ACC74882.1"
FT                   /translation="MKALVYHGPGEKSLDERPMPELAAPTDAIVRMTRTTICGTDLHIL
FT                   KGDVPSCEPGRILGHEGVGVVHSVGSAVSGLAVGDHVLVSCISSCGQCEYCRRGMYSHC
FT                   TTGGWILGHRIDGTQAEFVRIPHAKTSLYRIPAGLDEEALVMLSDILPTGFECGVLNGK
FT                   VQPGSTVAIVGAGPIGLASLLTAQFYSPAQIVMIDPDSNRLEVAQRFGATACINNGHED
FT                   AVAQVMALTESTGVDCAIEAVGVPATFELCEALIAPGGTIANVGVHGVKCDLHLETLWD
FT                   RNISITTRLVDTVSTPMLMKTVRAGRLDPKQLITHRFALQDVIAAYETFSRAASTHALK
FT                   VLIEVS"
FT   gene            324718..325245
FT                   /locus_tag="Bphy_5817"
FT   CDS_pept        324718..325245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5817"
FT                   /product="putative flavodoxin"
FT                   /note="KEGG: bxe:Bxe_B0391 putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5817"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74883"
FT                   /db_xref="GOA:B2JVA6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA6"
FT                   /protein_id="ACC74883.1"
FT                   /translation="MSAAHKILVVYYSRSGTTQRIAELLASELGADIEAIREPGEHAAR
FT                   RGARGYVRSLLDALRHRDVRVMPPIHDLSAYDAVVVGTPVWASHASAPAVAWLKAQHAH
FT                   IRHLALFCTLGGRGSQPALDQMAKAVGKTPLAVCAVTAHDLRRRIDGTKRQGFGQKIRH
FT                   RLAKLRQTEWIE"
FT   gene            325306..325767
FT                   /locus_tag="Bphy_5818"
FT   CDS_pept        325306..325767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5818"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bte:BTH_II0442
FT                   universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5818"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74884"
FT                   /db_xref="GOA:B2JVA7"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA7"
FT                   /protein_id="ACC74884.1"
FT                   /translation="MYKTILVAVDGSHTSKQAVQEAVKMASLTSGTVHAVYVVDTSPLF
FT                   SDAGYFDPIVLTDALRDNGRVALEDAESVCKQSHVACVTELIETEQLNDDVAHALQRCA
FT                   GRIGADLVVLGTHGRRGMQRIVLGSVAERFLRMSKCPVLLVRGSEPEEA"
FT   gene            complement(325872..326570)
FT                   /locus_tag="Bphy_5819"
FT   CDS_pept        complement(325872..326570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5819"
FT                   /product="putative NADH oxidase (nitroreductase), NoxC-like
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_A1863 putative NADH oxidase
FT                   (nitroreductase), NoxC-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5819"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74885"
FT                   /db_xref="GOA:B2JVA8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA8"
FT                   /protein_id="ACC74885.1"
FT                   /translation="MTKPLFRIGAALLNTPAPRPVEGMPVPYIGFAPAHCTGGMPLLDA
FT                   LAARQTSREFADTPLDHDTLGDLLWAADGINRAGVGGRTAPSALGGYEIDIYVLLASGA
FT                   YRYDAAAHALTLVVPADLRAMTGYQEFLGHAPVNLVYVADLTRMHDIPHAQREAFASAS
FT                   AGAILQNVYLYCASAGLAAAARGWMNRTALAVNLKLPVGSVALLAQTVGHFAGRRGHRP
FT                   SDEDFATTAC"
FT   gene            complement(326714..327670)
FT                   /locus_tag="Bphy_5820"
FT   CDS_pept        complement(326714..327670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5820"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bxe:Bxe_A1890
FT                   putative universal stress protein, UspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5820"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74886"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVA9"
FT                   /protein_id="ACC74886.1"
FT                   /translation="MANPVDAEHDSVRAFQRVLLAVDGSEASLHAAQYTNALFSGRAAI
FT                   AVVSVVQNPRTLFPLGATTQAFLNAARDELISDARAALQRIEPVFCGAMLETEVIDLSK
FT                   RDGDIVHALLDAVAHWQADLLVMGARHHRGLLRWVEGAVSEPVTRRANSSLLLVPENSR
FT                   ARTDTPPQRILFALDGSAHSLGALRIGLQLASAQTQLRAIYVIDRAVHLFDIAPVDLLE
FT                   GAFYEEGRVTLDLAERIFSDEGHAGETALVETHRTGDDVPHAIVRDAEQWNADLLVVGT
FT                   HGRRGIARWFLGSVAARTLPLADTPVLLVSVPELAQR"
FT   gene            327880..328575
FT                   /locus_tag="Bphy_5821"
FT   CDS_pept        327880..328575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5821"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bxe:Bxe_A1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5821"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74887"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB0"
FT                   /protein_id="ACC74887.1"
FT                   /translation="MLAIDVMTPSVICAQPDMTVQEAAKRLVDNRISGMPVVDASGGLV
FT                   GMVSEGDLLHRVETGTETRRSRWLEVFSTTRDLASTFVKEHGRSVADVMTASVLTVDWQ
FT                   MPVADIADLMERRRIKRVPVMRGGKLIGIVTRGNLIRALASAGAPARPQDGQVVSDREI
FT                   AEAIVAALRDKRWALTKENVIVKDGVAHLWGVIQSEEEERALCVAALEVKGVKEARAHL
FT                   SYPTVMPLM"
FT   gene            328864..329610
FT                   /locus_tag="Bphy_5822"
FT   CDS_pept        328864..329610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5822"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_A2114 putative short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5822"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74888"
FT                   /db_xref="GOA:B2JVB1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB1"
FT                   /protein_id="ACC74888.1"
FT                   /translation="MSKLAGKVAVVTGASKGIGAGIAKALAAEGASVVVNYSSSKAAAD
FT                   AVVADITAAKGKAIAVGGDVSKAADAQGIIHAAVETYGRIDILVNNSGVYEFAPIEEFT
FT                   EDQFHRQFNINVLGLLLTTQAAVKHLGEGASIINISSVVTSITPPTTAIYSGTKGAVDA
FT                   ITGVLSRELGPKKIRVNAINPGIVITEGTHEAGIAGSDFETMAVSQTPLGRVGQPSDIA
FT                   SIAVFLASDDSGWLTGETIVASGGMR"
FT   gene            complement(329908..331377)
FT                   /locus_tag="Bphy_5823"
FT   CDS_pept        complement(329908..331377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5823"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: rso:RSc1857 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5823"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74889"
FT                   /db_xref="GOA:B2JVB2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB2"
FT                   /protein_id="ACC74889.1"
FT                   /translation="MAAHARVRHMPYMRDKMPHMPASSSSTRKRAARRPDWIADFTDNG
FT                   KARYLQIVDLIERAVADGKLNPGDRLPPQRKLAEMVGVDLTTVTRGFAEAHRRNLIESR
FT                   GPLGTFIAPPKATFLQQVDLSMNIPPPPADLDLAVLLKRGLSQVLVRSDIDLLMTYQLG
FT                   GGSDTDRQAGAAWLAPILGRVDPSRVIVTPGAHSALAALILSLTRPDAPIFTEQLIYPG
FT                   LPLIVRQLGRALGAIACDEYGMRPDALDEACARARGGVIYLNPTIRNPTAQTMPAQRRK
FT                   DILAVAARWNVPVVEDDPYWLFADSPPAPLAALAPQQVYYLSTLSKCISPGLRAAFLVL
FT                   PVAGAQEAFLKALRSLSLMSPPLTTSLVTQWILEGTATEVLTGILKESRERLLAASQIL
FT                   SSVNMAGSGGAIHVWQPLPAHWAAQSLAAAARTEGLVVAPSSAFCQSGDVPNAIRISLG
FT                   GCTRRTELNSALRKLAQLVARKSSDEDRLLI"
FT   gene            331573..332490
FT                   /locus_tag="Bphy_5824"
FT   CDS_pept        331573..332490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5824"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: reh:H16_A1643 bo3-type quinol oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5824"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74890"
FT                   /db_xref="GOA:B2JVB3"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB3"
FT                   /protein_id="ACC74890.1"
FT                   /translation="MRAARVAATGALGLLGGCSMALFNPKGTIGEQEKNLILIALGLML
FT                   LVVIPVIALTLYFAWRYRASNTKARYAPTWAHSNAIEVVVWTIPCIIVATLAVLIWKTT
FT                   HSLDPYKPIDSGVKPVRVEVVALNWKWLFIYPEYGVASVNQLALPVNTPVDFRLTAESL
FT                   MNSFFIPQLGSQVYAMSGMQTQLHLIANSAGIYAGRSSAFSGPGFSDMDFKTVVTSRGE
FT                   FDAWVARAQASPQALDVAAYDVLQQPGRKTAVTLYSNVVPGLFDGIVYQYMRDASGRPI
FT                   CTTANADMYVKPARLPSHAALVSE"
FT   sig_peptide     331573..331638
FT                   /locus_tag="Bphy_5824"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.965 at
FT                   residue 22"
FT   gene            332496..334496
FT                   /locus_tag="Bphy_5825"
FT   CDS_pept        332496..334496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5825"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: reh:H16_A1642 bo3-type quinol oxidase, subunit
FT                   I; TIGRFAM: cytochrome o ubiquinol oxidase, subunit I;
FT                   PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5825"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74891"
FT                   /db_xref="GOA:B2JVB4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB4"
FT                   /protein_id="ACC74891.1"
FT                   /translation="MFGKFTLEAIPYHEPIIMGTLGVVVLGGLALLGAITYVGKWSYLW
FT                   KEWITSVDHKRIGVMYIILALVMLLRGFADAIMMRAQQAIAFGDAAGYLPPHHYDQIFT
FT                   AHGVIMIFFVATPLILGLMNVVVPLQLGARDVAYPFVNSLGFWLSAVGAVLVMISMFVG
FT                   DFAATGWVAYPPLSELGYSPTTGVDYYIWSLQVSGLGTTLSGINFVVTILRMRAPGLNL
FT                   MKMPVFCWTALITNILIVAVFPVLTGTLALLTMDRYLDMHFFTNELGGNAMMYINLIWV
FT                   WGHPEVYILILPAFGAFSEIIATFSGKPLFGYKSMVYATSSIGILSFFVWLHHFFTMGS
FT                   GANVNAFFGIMTSIISVPTGVKLFNWLFTMYRGRIRYHTSTLWTIGFMVTFAVGGMTGV
FT                   LLAVPGADFVLHNSLFLVAHFHNVIIGGVVFGCLAGISYWFPKVFGFTLDEFWGKVAFW
FT                   CWLVGYWLAFTPLYILGFEGMTRRMNHYDVPEWHVWLIVALVGAAIIGMGILALLVQFA
FT                   VSIRNREHNRDVTGDPWDARSLEWSTASPAPFYNFAHVPVITSLEQHWDDKQSGRAYRR
FT                   PATYEDIHMPRNTAAGFVIAAFSLLFGFAMVWHMWLFAVAGLIGMIATFIARSYDQDVD
FT                   YYVSAAEVERIENARFELLRSDDHEQIAEMA"
FT   gene            334499..335113
FT                   /locus_tag="Bphy_5826"
FT   CDS_pept        334499..335113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5826"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   rso:RSc1860 probable transmembrane cytochrome o ubiquinol
FT                   oxidase (subunit III) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5826"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74892"
FT                   /db_xref="GOA:B2JVB5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB5"
FT                   /protein_id="ACC74892.1"
FT                   /translation="MANTPTYAAAAHHDARGHHDDGTRTTLGFWIYLMSDCLIFATLFA
FT                   TFGVLANATAGGPAGRQLFELPYVLGETLLLLASSFTFGMGMLSVYANRRGTVIGWLAV
FT                   TFVLGAAFIGMEVYEFAKLASDGAGPSTSAFLSGYFTLVGTHGLHVTTGLLWIGVMMHQ
FT                   IGRFGLTPVTRRRIACLSLFWHFLDLVWICVFSLVYLREFL"
FT   gene            335110..335487
FT                   /locus_tag="Bphy_5827"
FT   CDS_pept        335110..335487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5827"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: reu:Reut_B4576
FT                   cyoD2, RSc1861; probable transmembrane cytochrome o
FT                   ubiquinol oxidase (subunit Iv) oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5827"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74893"
FT                   /db_xref="GOA:B2JVB6"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB6"
FT                   /protein_id="ACC74893.1"
FT                   /translation="MSQTSELRQAHAHDASHGSVKHYVIGMLLSLALTFASFGVVMTHV
FT                   VPRAMGLTAVVALCVVQLLVQLRYFLHLGSSADQRSNTGIFVCTALLIAIIVAGSLWVI
FT                   HNANVNMMPTQISVERALARD"
FT   gene            complement(335583..335999)
FT                   /locus_tag="Bphy_5828"
FT   CDS_pept        complement(335583..335999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5828"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bvi:Bcep1808_6067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5828"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74894"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB7"
FT                   /protein_id="ACC74894.1"
FT                   /translation="MNGRTRIRILAAADHSSDDVEHVVALGNDADPLAHSDAIASADRV
FT                   ELRFPNFTDGRAFSQAYLIRRRLGFTGDLRATGDVLADQLIQMERTGFSSAVLSADVDP
FT                   ADAQRQLDRFAAFYQGDVARDAPFRQRDRKSGNQ"
FT   gene            complement(335996..337786)
FT                   /locus_tag="Bphy_5829"
FT   CDS_pept        complement(335996..337786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5829"
FT                   /product="Sulfite reductase (ferredoxin)"
FT                   /EC_number="1.8.7.1"
FT                   /note="PFAM: nitrite/sulfite reductase hemoprotein
FT                   beta-component ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; KEGG: bxe:Bxe_B0922
FT                   putative nitrite/sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5829"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74895"
FT                   /db_xref="GOA:B2JVB8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB8"
FT                   /protein_id="ACC74895.1"
FT                   /translation="MYQYNEFDKAFLLNRAAQFRDQIERWQDGRLSEDAFRPLRLQNGW
FT                   YVQRHAPMLRVAVPYGELSSAQLRVLARVAREYDAPEADVYRQALDAQRKLGTVRLPTH
FT                   HAHFTTRTNVQFNWIPLAKAADVMDLLATVDMHGIQTSGNCIRNISCDERAGVAPDEIA
FT                   DPRPFAEIMRQWTTLHPEFAFLPRKFKIAITGADDDRAATQWHDVGLRLRRGENGELGF
FT                   RVTVGGGMGRTPVIGTVLREFLPWQHIMNYIEAVVRVYNQYGRRDNKYKARIKILVKAE
FT                   GQKYIDEVEEEFRQIVEHDGGPHTIPRGELERVSAYFAQPVADSVARPVDPAARQAIHD
FT                   AALHNPPFARWLKRNVARHKNPLLCIVTLSFKRLLQAPGDASADQLDHLADLVDSFSAG
FT                   EARVTHTQNIVLPWVHENDLLALWEAAREVGLASANVNLLTDMIACPGGDFCALANARS
FT                   LPISQAITERYQDMDELEDIGEVDLHISGCINSCGHHHSGHIGILGVDKDGSEWYQVTL
FT                   GGSDGSHASGDAQPGKVIGPSFSAHEVPDVIEAVLRTYVERRTHSGSARETFIETVRRI
FT                   GPEPFKAAAHAVRTPVEVPA"
FT   gene            complement(338005..338466)
FT                   /locus_tag="Bphy_5830"
FT   CDS_pept        complement(338005..338466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5830"
FT                   /product="MEKHLA domain protein"
FT                   /note="PFAM: MEKHLA domain protein; KEGG: bpd:BURPS668_2037
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5830"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74896"
FT                   /db_xref="InterPro:IPR013978"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVB9"
FT                   /protein_id="ACC74896.1"
FT                   /translation="MDLRTDLTFFNLLTGSYARLLGASLVREREHAEDAAAWLYHDAPF
FT                   GLLAHNSADDPVFVYGNRRAQSLFGYDWDELTALPSRLSAEAPERSERQAFLDQVTRNG
FT                   YVSGYRGVRIAKTGQRFWIERATVWQLIDEHGKLHGQAAMIPHTTALRD"
FT   gene            complement(338561..339805)
FT                   /pseudo
FT                   /locus_tag="Bphy_5831"
FT   gene            340417..340758
FT                   /locus_tag="Bphy_5832"
FT   CDS_pept        340417..340758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5832"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5832"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74897"
FT                   /db_xref="InterPro:IPR016755"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC0"
FT                   /protein_id="ACC74897.1"
FT                   /translation="MIQPGNVFKDNLAQLPGIDGIERIDLVDGKGAVVASIENKPGKQG
FT                   SLAVYHYLREAFGALDVKAAEHGLAVFAEHTADARNRPGAHPNVDRLLEIAAGSEALRI
FT                   EVIAAARAR"
FT   gene            complement(340755..342224)
FT                   /locus_tag="Bphy_5833"
FT   CDS_pept        complement(340755..342224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5833"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   bch:Bcen2424_6692 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5833"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74898"
FT                   /db_xref="GOA:B2JVC1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC1"
FT                   /protein_id="ACC74898.1"
FT                   /translation="MQTSPGPAVRVFDAVKALAFIGDLSMGQPTDHSIRTAWLAVRLAR
FT                   AAELDDAAVAVCEASLLRWSGCTANAAGFAEATGDDVASREAMLALKPDWAGPLELHAD
FT                   LGAVIAPLARIHCEVSSEAARMLGLGQDTRAALRHVFESWDGSGSPDHLAGNAVPASVF
FT                   IVALAGELEIFSRTYNIERARALIGQRADSRYPDKLARLAIRLAPDWLDELEHTDAASI
FT                   DAALLTPNMSDATPVELVADIIDLKLPWMTGYSRSVAATAASCGARLALDSNAQHRLYC
FT                   AGLIHGMGRAAVPNPIWNTPSRLSQAAWEKLRLVPYWTSRAGRQTGTLAEGAELGSYVY
FT                   ERLDGSGYFRGASGAALPVEARILAASATWVALRAARPWRAAMTDREAAKLMQEEAAQG
FT                   RYDASVVDALIDAGTSQRRVVNPRAHNARLSAREIDVLRGISQGASNKEVARDLSLSPS
FT                   TVRTHVESVFRKLDCSTRAAATLKALALGLL"
FT   gene            342372..343151
FT                   /locus_tag="Bphy_5834"
FT   CDS_pept        342372..343151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5834"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5834"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74899"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC2"
FT                   /protein_id="ACC74899.1"
FT                   /translation="MNPLLRKCIASVMLAGSVLSLHAAQAAQPQDLKGKNVVLVHGAFA
FT                   DGSSWEKVIPLLEARGLHVVAVQNPLSSLADDAAATKRAIDAQNGPVVLVGHSWGGAVI
FT                   SQAGNDDKVKALVYVAAFAPDSGQSINDMLKGKPAPAWASELQKDSGNFLTLSSKAIDD
FT                   DFAQDLSPAQKRVVAATQGPWFAGATDDKVTNAAWHAKPTYYVVANRDRMIDPRLQDAM
FT                   AAQIKSKVTHVDSSHVPMLSKPEAVANAIIEAAAKAQ"
FT   sig_peptide     342372..342452
FT                   /locus_tag="Bphy_5834"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 27"
FT   gene            343454..344452
FT                   /locus_tag="Bphy_5835"
FT   CDS_pept        343454..344452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5835"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="PFAM: 2-keto-3-deoxygluconate permease; KEGG:
FT                   rme:Rmet_2588 2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5835"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74900"
FT                   /db_xref="GOA:B2JVC3"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC3"
FT                   /protein_id="ACC74900.1"
FT                   /translation="MVQIPIKRSIERVPGGMMIVPLLVGSLVATFLPGMPKFFGSFTNA
FT                   LFTGALPILAVFYVCMGASIDVKATPYLMKKGGALLVTKVGAAVIVGVLLGHLIGEQPV
FT                   SSGLFAGISTLAVVAAMNDTNGGLYMALMGQYGRSEDVGAYTLMSLESGPFLTMVTLGV
FT                   AGLSAFPWQTLVGSILPLALGMLLGNLDRDMRDFLAKAVPVMIPFFALALGAGLDLHKV
FT                   WQAGLLGIGLGIAVVIVTGIPLYFADRLTGGTGVAGVAAANTAGNAAAVPALVAAANPV
FT                   YNAAAQSATLLVAACVVVTAILSPILTSAVAKRYQQRQQAARSGNRQGLAR"
FT   gene            344449..345708
FT                   /locus_tag="Bphy_5836"
FT   CDS_pept        344449..345708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5836"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5836"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74901"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC4"
FT                   /protein_id="ACC74901.1"
FT                   /translation="MKILIIADDLSGAADCAIGFASAGHRTVVTLEATCMPAHDGADTI
FT                   AVDTDTRRLTPQDAATRTAAAYAEMSARGQRLYKKIDSTLRGNWAAEVAGLQALAGMAI
FT                   VAPAFPATGRTVRDGRVFVHGEPLEQTATWKLEHAGQPAGIAAQLEAVGLTTERLDAQA
FT                   LADEPETLAVCIGAMAANGVQALIVDTHSERALRALARATLRSDAPFFWVGSGGLAREI
FT                   AALDSRVDPAGRGPGNTTFPGGPILILVGSLSAVSERQCAMLRERGGVKELIVPPAVLR
FT                   AGATHRDWHVLQEQIGVSLKADVDLLLRIGRDDAFDPAEGAQLSAALAALVEPHFTRTG
FT                   GVIATGGETARAMLAAARIGNLQLLAEVEAGVAVARPLDATRTHCPGVVTKAGAFGTDH
FT                   ALYAAWLTLRNQTERDVVPH"
FT   gene            345718..346746
FT                   /locus_tag="Bphy_5837"
FT   CDS_pept        345718..346746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5837"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: rme:Rmet_2590 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5837"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74902"
FT                   /db_xref="GOA:B2JVC5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="PDB:4JQP"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC5"
FT                   /protein_id="ACC74902.1"
FT                   /translation="MNSTYSRDQIMSNYLPVIGITMGDAAGVGAEVVVKSLAHASVYAQ
FT                   CRPLVIGDAKRLERANQIVGGEMKIRRIEDASEARYEQGTIDCIDLGLIPDDLPFGQLS
FT                   AIAGDAAYQYIKRAVELAQSGKIDAICTAPLNKEALHAGGHKYPGHTEMLAHLTGVDEV
FT                   SMMLVAPQLRVIHVTTHIGIIDAIRKIEPGLVQRTIERGNATLVKAGIERPRIGVCGIN
FT                   PHAGENGLFGYGEEEEKIIPAVTLLQERGLDVTGPLPADTLFFRAGRGDFDLVVAMYHD
FT                   QGHGPVKVLGLEAGVNVTVGLEVIRTSVDHGTAFDIAGKGVVDEGSMLEALRQGAELAT
FT                   RR"
FT   gene            346816..347586
FT                   /locus_tag="Bphy_5838"
FT   CDS_pept        346816..347586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5838"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; KEGG: reh:H16_B0320
FT                   transcriptional regulator, DeoR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5838"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74903"
FT                   /db_xref="GOA:B2JVC6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC6"
FT                   /protein_id="ACC74903.1"
FT                   /translation="MKKTIDRHQAILDLVRARDANVEELCAALGVSEATIRRDLTALAR
FT                   QKRLVRTYGGATALVGVHEPEASLEERKSAQREQKESIAQAAAAHVLDGDTVLLDGGTT
FT                   CAALARHLSTREALHVVTNNLLAVTALANAPGVRLTLIGGELRGSSMSTLGPLAELILS
FT                   RLTVDRAFLGADGVVAGFGLCEASAQQAYLKECIVSRAAEIIVLADSDKLGRARQQHWT
FT                   PMQRDWRLITSASADDALLAPFRALDEVTVELAP"
FT   gene            347740..348714
FT                   /locus_tag="Bphy_5839"
FT   CDS_pept        347740..348714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5839"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bur:Bcep18194_A5010
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5839"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74904"
FT                   /db_xref="GOA:B2JVC7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC7"
FT                   /protein_id="ACC74904.1"
FT                   /translation="MRVHQGFTGCIGDTPLIRLAALSAETGCEILGKAEFMNPGGSVKD
FT                   RAALYIILDAERRGALKPGGTVVEGTAGNTGIGLAHLCAARGYRCVIVIPDTQSPAKME
FT                   LLRVLGAEVRPVPAAPYKDPNNYQKIAGRLARELDNAIWSNQFDNVANRLAHYETTGPE
FT                   IWRDTAGTIDAFVCSTGTGGTLAGVSRFLKEQDPQVRIALADPHGSGLYSYVKTGEIQV
FT                   EGSSITEGIGSSRVTANLEGTAIDDAFRIDDQSCVTMVYRLLREEGLYVGGSTGINVAA
FT                   AVALARQMGPGHTIVTPLCDRGELYRARLFNPEWLAQKGLVAR"
FT   gene            348791..349276
FT                   /locus_tag="Bphy_5840"
FT   CDS_pept        348791..349276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5840"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bpd:BURPS668_A1535 YbaK"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5840"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74905"
FT                   /db_xref="GOA:B2JVC8"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC8"
FT                   /protein_id="ACC74905.1"
FT                   /translation="MSMSATLQGCLTDKGSRYEIVRHPYSHSSMETAAAAHVPGDRLAK
FT                   TVLFEDEQGYVAAVLSSTHAVRLAELSSKTGRHLSLAKEGDLRELFKDCEYGALPPVCT
FT                   AYGMKTYLDESLVRQPDVYFESGDHEALVHMDGEQFLALMDGAERAHFGRRMQGMSV"
FT   gene            complement(349304..350089)
FT                   /locus_tag="Bphy_5841"
FT   CDS_pept        complement(349304..350089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5841"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bxe:Bxe_B0321 putative adolase/adducin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5841"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74906"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVC9"
FT                   /protein_id="ACC74906.1"
FT                   /translation="MAHTLDVKTSALSRRDALDSDAVHTARVELAACFQLAAQHGFEEG
FT                   VCNHFSAVVPGHDDLFFVNPYGYAFSEITASRLLICDFDGNVIEGEGKPEATAFFIHAR
FT                   LHKAMPRVKAAFHTHMPNATALCLIEGPPLLWLGQTALKFYGRTAVDEEYNGLALDTSE
FT                   GDRIANAMGDADILFLKNHGVMVAGASIAEAWDDLYYLERAAQVQLKAMQSNRPLKTVP
FT                   HAVAQLAYEQMRLGDKESARAHLDSGIRRLRDAGNRFET"
FT   gene            complement(350109..350813)
FT                   /locus_tag="Bphy_5842"
FT   CDS_pept        complement(350109..350813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5842"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B0322 HAD-superfamily hydrolase,
FT                   subfamily IA, variant2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5842"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74907"
FT                   /db_xref="GOA:B2JVD0"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD0"
FT                   /protein_id="ACC74907.1"
FT                   /translation="MSLENTRRPSWLTFDCYGTLIQWDEGLQNAVSAILASKHAAAIDP
FT                   RKFIAVYDRHEHALEQTPPHRSFREVAGEALRIALEEFDLHAEVSDIRLLTERISAMPP
FT                   FPEVVATLHALKEAGYRLCIVSNTDDDVIAGNVAQLGGHIDRVITAQQAGAYKPDRRLF
FT                   DYAHEQLGVAYDDVVHICASPHLDHAAARDIGFRCVWIDRGTGRQLLPDYTPDAILATL
FT                   GQVPPLFTSLGW"
FT   gene            350930..351778
FT                   /locus_tag="Bphy_5843"
FT   CDS_pept        350930..351778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5843"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0323 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5843"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74908"
FT                   /db_xref="GOA:B2JVD1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD1"
FT                   /protein_id="ACC74908.1"
FT                   /translation="MLDLELLKTLVCVVDEGSFTRAGDRVHRTQSTVSQQVRRLEERVG
FT                   RTLLMRDRTGNQVTATEHGELLTHYARRLIALSQEAQDALASDVSRVPIRIGVPEDFCA
FT                   KRMASILSGFVKARPDARLETVTGMSGDLQRKLSGGEIDIALVKREPGSGPSLAAWPES
FT                   LVWVRGRQVEVPSEEGEPVPLALFPQGCVYRKRAIRTLDQSKRSWRVAFGSHSLTGIQA
FT                   AVASGLGITVLPTTAVLPEHSLCFDLPRLPPTELALVGAGGALNAVQSALVDFLREAVT
FT                   V"
FT   gene            complement(351838..352017)
FT                   /pseudo
FT                   /locus_tag="Bphy_5844"
FT   gene            352307..352594
FT                   /locus_tag="Bphy_5845"
FT   CDS_pept        352307..352594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5845"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74909"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD2"
FT                   /protein_id="ACC74909.1"
FT                   /translation="MESHMNAKLFGALLTACSFAMPAFAGGYHAASDARTAGVIKASQV
FT                   RKAAPTVSPDGGTSSAGSRNHGAVGGTRSGKSESGRREQPDSIDPMYRGG"
FT   sig_peptide     352307..352384
FT                   /locus_tag="Bphy_5845"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.793 at
FT                   residue 26"
FT   gene            352739..353713
FT                   /locus_tag="Bphy_5846"
FT   CDS_pept        352739..353713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5846"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bpd:BURPS668_0781 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5846"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74910"
FT                   /db_xref="GOA:B2JVD3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD3"
FT                   /protein_id="ACC74910.1"
FT                   /translation="MDRIQAMEVFTRVVDANSFTRAAEQLGMPRATVTTTIQNLEAVLG
FT                   VRLMNRTTRRLSLTPEGAAYYEHCIRIITDIAETDASFQAGNRKPSGALRVHMPNSLGR
FT                   HLVIPALQSFHQRYPDIALDLGLSDRPVDPVEEGIDCMIRAGALEDSSMVARRIGTLKR
FT                   VTCASPDYLVRFGEPQSIDDLAMHHAVNFRVAHGTRPMPWIILVDGKPIEVRMNGVVTV
FT                   NDSEAYVKCGMEGFGLIQPMLFMVAPQLRDGSLKEVLPAFKPKPKPISIVYPNNRHLSA
FT                   KVRVFADWVAELFESTPALAGSEGRRIAVPRREAQPDHGPIAA"
FT   gene            353861..355228
FT                   /locus_tag="Bphy_5847"
FT   CDS_pept        353861..355228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5847"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bur:Bcep18194_C7098
FT                   major facilitator superfamily (MFS_1) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5847"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74911"
FT                   /db_xref="GOA:B2JVD4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD4"
FT                   /protein_id="ACC74911.1"
FT                   /translation="MDTVQPGATPLSEEDAHRQLRRAVIASTIGTTIEWYDFFLYSTVT
FT                   GLVFAKLYFPESDPLVGTLQAFLIYAVGFIARPVGAAIFGHYGDRIGRKATLIVTLLLM
FT                   GLATFAVAFVPTYATIGIWGAVLLTILRFIQGVGVGGEWGGSVLMSMEWARTNAHRGFV
FT                   ASWPQFGVPAGLFIANLAVLAMSQLSGSAFLTWGWRVPFFLSIVLVAIGLYIRLNILET
FT                   PIFARLLAERKIEKAPTLEVIRRQPKDILLSALSRMAEQAPFYIFTAFVFTYGVRTLGA
FT                   SRDLLLTAVLAASLLEFVTIPLFGHVSDLIGRKRMYMIGAAMAGLFGFVYFAMVDTKNP
FT                   TWIFAAIVLSLVPHSMMYGPQAALIAETFTGRLRYSGASLGYQLASVIAGGPAPLIATA
FT                   LFAYYHSGYAIAAYVFVCAVISLVAASRLGDYTNRDISREYDEARTMGDHGHAHAR"
FT   gene            complement(355527..356111)
FT                   /locus_tag="Bphy_5848"
FT   CDS_pept        complement(355527..356111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5848"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A2150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5848"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74912"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD5"
FT                   /protein_id="ACC74912.1"
FT                   /translation="MKIRFFVAAAVVAMTTGRAAMAQTQPSVEVERGNNKTTVRGTTTV
FT                   VATVTAIDPATRTVTLKNKNGKTEELKAGEQVRNFDQLKIGDIVTTEYHEARSLSLKKT
FT                   SGPRSSSEKQILLPAASGTKPGGTIRREVTIVGDVVAIDANGEHITVRGPQGKENVLVD
FT                   PEQLRDIHVGDQVEIVRSEAVAISVSPGVAN"
FT   sig_peptide     complement(356043..356111)
FT                   /locus_tag="Bphy_5848"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(356155..357327)
FT                   /locus_tag="Bphy_5849"
FT   CDS_pept        complement(356155..357327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5849"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bam:Bamb_3895 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5849"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74913"
FT                   /db_xref="GOA:B2JVD6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD6"
FT                   /protein_id="ACC74913.1"
FT                   /translation="MRPAGAMLLLIGTLLTGAGYGATFLLSMRFRSIGGNEFDTGIALA
FT                   GGVLGTFAGVTAVRSLAPRIGTARMASLSALGVGIGLAGFSAAIRDSSLEVMAGFLLGL
FT                   GWGAFYVAAPLALSERTHTANRGTWFLRFGTFQMAGIGGCPALAAYAIHFLHWSVNNAL
FT                   GVIAGLCAIASVLLEIFGRLSPHSPGETKKARWLGDLGAIARTRAVYPILMIALGACVF
FT                   SGIMTFQMSLVQGTHAQASTFFSLYTLTVVSMRWLLSRLVARVPTETATKMLLVVMVLG
FT                   IASMFAVPVHVFFQVTAAVLFGTGYGLVYPVMQTQLVNDTEVTHHNAVLTWFVTAYFIG
FT                   AFGFPTVGGWLLVHSGKGALLTVIAACGVAALLLAFLRDKRRVRALTIKA"
FT   sig_peptide     complement(357262..357327)
FT                   /locus_tag="Bphy_5849"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            complement(357564..358202)
FT                   /locus_tag="Bphy_5850"
FT   CDS_pept        complement(357564..358202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5850"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   bpd:BURPS668_1423 putative FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5850"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74914"
FT                   /db_xref="GOA:B2JVD7"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD7"
FT                   /protein_id="ACC74914.1"
FT                   /translation="MYLPSQFNEDNREVLHAHIAQHPFGMLVTHGKSGLDANHIPFELA
FT                   VEGESLGVLRAHVARANPVWQDVANGDEVLAVFRAGDAYISPNWYPSKHEAHRQVPTWN
FT                   YIVVHAYGRITVRDDERYVRGVVGRLTRKHEASQAQPWKMADAPKDYIDTLIQTIVGLE
FT                   IEITRLVGKSKLSQNKEARDIRGAGEALRARGQFQIGDAMLARLSDKPQ"
FT   gene            358316..359878
FT                   /locus_tag="Bphy_5851"
FT   CDS_pept        358316..359878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5851"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: bam:Bamb_4617 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5851"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74915"
FT                   /db_xref="GOA:B2JVD8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD8"
FT                   /protein_id="ACC74915.1"
FT                   /translation="MARTAGRVEIPWIGTLDRAAGNLSRQVAQALREAVRNGDVLPGDA
FT                   LPSTRLLAESLQIARGTVIEAYQQLIAEGFLESRGGAGTRVAHALAEAPPASEPRAVRG
FT                   RTARPVLPEPATAFAQIAQEFRPLPHVPFAISVPVGLTAPADIWRRLGNRLRAKGPGAP
FT                   AGYTDPLGALPLREAIASYVRKSRSVRCEPGQVIVTSGTQQGLFLACQVLLGPRDQAWV
FT                   ENPAYRGVTAILESTGRRDTMVRVPVDVEGIDVEAGIRKAPHARAAFVTASHQYPLGMP
FT                   MSMARRNALLAWARASHAWVVEDDYDSELRYEGYPFPSLQGLDPDRVIYLGTFSKILFP
FT                   SLRLGYAIVPDDLVDAFCGARVLMDRHPPNADQHVLAAFMAEGHLERHIRKVRNVYFEH
FT                   RVQLIETLETLLPKELAWIEPGDQGMHFVLWLAEGIDDRKVVDLAARAGVSVRAVSPTF
FT                   APGTARPGLILGFGGFSGAQMNVAAQRLADVIVAEAQSPGRRGAVREPSTGKVGSRRRT
FT                   SCN"
FT   gene            complement(359895..360263)
FT                   /locus_tag="Bphy_5852"
FT   CDS_pept        complement(359895..360263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5852"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bur:Bcep18194_A4812
FT                   NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5852"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74916"
FT                   /db_xref="GOA:B2JVD9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVD9"
FT                   /protein_id="ACC74916.1"
FT                   /translation="MKKRATVICRRGKRILLVARSQSKWALPGGILKRGEARTDAALRE
FT                   LKEETRLSGKSAKHLFDFRGKQKHHHVIACEISNRAKARPSNEIARCRWVHLDDLPGLM
FT                   TSGPTVNIVKLMSQRRWK"
FT   gene            360513..361427
FT                   /locus_tag="Bphy_5853"
FT   CDS_pept        360513..361427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5853"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bxe:Bxe_B0637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5853"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74917"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE0"
FT                   /protein_id="ACC74917.1"
FT                   /translation="MDMDGDWPLPRPTTFFKANRRPAGSSLGKTSSIASTFSSLATPVV
FT                   AEAVQRARELSTTCDVEGFHQLRVAFRRLRALYWAYSPYLGEEATAQATEEFKRLAAVA
FT                   GGTRDWDIAGELLQAAQESGASVELLAAAAREKRAQAVVHSQTMIRCDDVEAFLNDALH
FT                   RAQSALQLHCNDLPIRAFARERVRLAQRTLQKRSRRAGRRGEAAHEEALHDVRKAGKKL
FT                   RYLLEFFQPVIKGGYERTIKELTSVQNTLGRFNDIAASETLIRTTTFYEVPPEVVQESL
FT                   RWLQEQKGRRMRAASRRVRDIAR"
FT   gene            361470..362351
FT                   /locus_tag="Bphy_5854"
FT   CDS_pept        361470..362351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5854"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5854"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74918"
FT                   /db_xref="InterPro:IPR016980"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE1"
FT                   /protein_id="ACC74918.1"
FT                   /translation="MYATRVDRARAIAIAAAFYALTLTGCASSSLHSQYASRASQSQDA
FT                   SAASLDAAIRGPQRSSPARARDVYRHPKETLQFFDVGPAQAVLEIAPGGGWYTDVLAPY
FT                   LREAGQLYEAQYLSTSADLAAEDSATDAAYRRKLANDPSVYGKVVIGTLHAGQFIGFDA
FT                   NDRFDRVLTFRNIHNWIKDGQLDANLRAFYGALKHGGELGVEEHRARPGTTLQQMIDSG
FT                   YVTQAYVIERAEAAGFVLIARSEINANPKDTKDYPHGVWSLPPTYRGGEADRSRFAAIG
FT                   ESDRMTLRFVKP"
FT   sig_peptide     361470..361571
FT                   /locus_tag="Bphy_5854"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.685 at
FT                   residue 34"
FT   gene            complement(362579..365164)
FT                   /locus_tag="Bphy_5855"
FT   CDS_pept        complement(362579..365164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5855"
FT                   /product="aconitate hydratase 2"
FT                   /note="TIGRFAM: aconitate hydratase 2; PFAM: aconitate
FT                   hydratase domain protein; Aconitase B, N-terminal; KEGG:
FT                   bur:Bcep18194_B1125 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5855"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74919"
FT                   /db_xref="GOA:B2JVE2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE2"
FT                   /protein_id="ACC74919.1"
FT                   /translation="MLENFRAHVAARAALGIPPLPLTAQQTAELVELLTNPPAGEEQTL
FT                   LDLITNRVPAGVDEAARVKAGFLAAVAKGETACALISRARATELLGTMLGGYNIQPLIE
FT                   LLSDAEVGTVAADALKKTLLMFDAFHDVKELADKGNANAKAVLQSWADAEWFTSRPEVP
FT                   QSLTITVFKVTGETNTDDLSPAPDATTRPDIPMHALAMLKNARPGITPEEDGKRGPVKF
FT                   IESLKEKGHLVAYVGDVVGTGSSRKSATNSVLWFTGEDIPYIPNKRFGGVCLGGKIAPI
FT                   FYNTMEDAGALPIELDVSKMEMGDVVELRPYEGKALKNGEVIAEFQVKSDVLFDEVRAG
FT                   GRIPLIIGRGLTGKAREALGLAPSTLFRLPQQPADSGKGFSLAQKMVGRACGLPEGQGV
FT                   RPGTYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVKTH
FT                   QTLPNFISNRGGIALRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVA
FT                   FAAATGTMPLDMPESVLVRFKGKMQPGVTLRDLVNAIPLYAIKQGTLTVAKQGKKNIFS
FT                   GRILEIEGLPDLKVEQAFELSDASAERSAAGCTVHLNKEPIIEYLNSNITLLKWMIAQG
FT                   YQDPRSLQRRIKAMEQWLADPQLLSPDADAEYAAVIEIDLADIHEPIVACPNDPDDVKT
FT                   LSDVAGAKIDEVFIGSCMTNIGHFRAASKLLEGKRDIPVKLWVAPPTKMDQKQLTEEGH
FT                   YGVFGTAGARTEMPGCSLCMGNQAQVREGATVMSTSTRNFPNRLGKNTNVYLGSAELAA
FT                   ICSRLGKIPTREEYMADMGVLNANGDKIYQYMNFDRIEDFKQVADTVTM"
FT   sig_peptide     complement(365090..365164)
FT                   /locus_tag="Bphy_5855"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.690 at
FT                   residue 25"
FT   gene            complement(365640..367073)
FT                   /locus_tag="Bphy_5856"
FT   CDS_pept        complement(365640..367073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5856"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /note="KEGG: bpd:BURPS668_A2736 BNR/Asp-box repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5856"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74920"
FT                   /db_xref="GOA:B2JVE3"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE3"
FT                   /protein_id="ACC74920.1"
FT                   /translation="MRCNKPRVLLSGISIAVVLAAGMTAGRAATVSGPSLFASCAVGGP
FT                   GTNYVNAEVEPWIATNPKNPSNLIGVWQQDRWNNGGAHGLVASSSFDSGSTWTTPTALP
FT                   FSACTGLLGYERASDPWVSIGPDGTAYAVSISFNQSDNSNAVAASVSTDGGLTWAKPNI
FT                   IIANNEPTLQFFNDKESVTANPVKAGVAYAVWDRLELPNGNPYANLHTAAFRGPTLFSK
FT                   TTDGGSTWSTPTTIVTVPSRQQTIGNQIVINSQNGTLYDFFDLITPPFSKAAGKVAFIK
FT                   STDDGATWTRPTIISGLQTVSVFDPNTGEPVRSGDIIPEPAIDPASGQLYVVWQDSRFN
FT                   GGHYDEIAFSTSKDGGATWSAPIRVNTPSGRPAFNPSIRVNSSGTVAVTYYDFRNLADG
FT                   NTATLPTDIWQTTSADNGTTFGNEAHLAGSFDLKFAPNAEGFFVGDYQGLAAIGGTFVP
FT                   FFVKTNQDLNNRTDVFALP"
FT   sig_peptide     complement(366987..367073)
FT                   /locus_tag="Bphy_5856"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.869 at
FT                   residue 29"
FT   gene            complement(367208..367453)
FT                   /locus_tag="Bphy_5857"
FT   CDS_pept        complement(367208..367453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5857"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5857"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74921"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE4"
FT                   /protein_id="ACC74921.1"
FT                   /translation="MPVIRKRYQNAFGCYKKFPQYAFLRSKVLSTRLTNARHCEASHHR
FT                   AASVSTRRQNSLISSSEIVTDALAVISAGSPRQSKL"
FT   gene            367998..368459
FT                   /locus_tag="Bphy_5858"
FT   CDS_pept        367998..368459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5858"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: bpl:BURPS1106A_1892
FT                   TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5858"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74922"
FT                   /db_xref="GOA:B2JVE5"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE5"
FT                   /protein_id="ACC74922.1"
FT                   /translation="MKRYPACGLTTGAHRRTHHTSQRGAAAVEFAIVLPLLLLILFGIV
FT                   ELGIGLYDKAMITNASREGARAGVLLRTPKPTTQDITNVVLAYCQNYLVTFGSSNTPTV
FT                   SVPSGVGGTFGTPLTVTVSYQYSGLGLGAMLSALTGPITMTATTVMNNE"
FT   gene            368469..369587
FT                   /locus_tag="Bphy_5859"
FT   CDS_pept        368469..369587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5859"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0648 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5859"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74923"
FT                   /db_xref="GOA:B2JVE6"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE6"
FT                   /protein_id="ACC74923.1"
FT                   /translation="MHGMSKQKQRGSVAVITAVSMVSLLGLAALAIDIGNLLVSRNELQ
FT                   NAADAAALAGAPCLYQRAQCGNTTATEPDWTTATQKASSFATASTSNTVQGSVIKVAQT
FT                   GSGYWNITGSPGTLETVPFTPGTNDLPAIQVTITKSAANANGSVPVYLASILGVTSLSA
FT                   SATATAAVSRPGYVGPGGLFPLAMSKCLFDNYWDSSTNSPKLATSTAKIPGQDFNQTPN
FT                   TPYIFQVSSSYQVNGCEAGQWTTLTSQQNNVTFVRGLIAGQNTDSLGIGSQPGTYIQPG
FT                   EENTLYTAVNDCSAAGDHTCEYETVPVVSSLGTGSYQPVVAFACVHVLGAKKGSSPYVI
FT                   LQMSNQPDKCQAKNAGGVGPNYGAITPPRLVQ"
FT   sig_peptide     368469..368564
FT                   /locus_tag="Bphy_5859"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.674 at
FT                   residue 32"
FT   gene            complement(369791..371521)
FT                   /locus_tag="Bphy_5860"
FT   CDS_pept        complement(369791..371521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5860"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; KEGG: bxe:Bxe_C1126 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5860"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74924"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE7"
FT                   /protein_id="ACC74924.1"
FT                   /translation="MRWLIVASCAAAAVHGSPVAAQAYRDVAPQPAPQSPRSAQSKPQS
FT                   QTQGDASKVAVERLAGLVFEPAGVPPTMPPAQQRIVANALPVLDAAFLQNFTADLDKPL
FT                   TFGRLAEIRQAVIEHYRKAGKPLVDVYVPEQDVSSGVVRIDIAEFRLGRVRANGNRYFS
FT                   SGLLEREMPLASNEPILQADVSLGLAVLNANPYRRVDAIFAPGEATNTTDVVLQTDDRL
FT                   PVRANVGYDNEGVPSLGRDRLFAGLGYGNLFGLDQQIAYQFTASNDFVSGNPSIEGRPD
FT                   RARFMAHAFSYVAPLPWLDSIEFFGVYAQSTPRLPDTYGQTGISAQFSVRYDWRLPSTG
FT                   DWAQLVQFGYDFKRSNNDLEFGGFQVFNSNTHIHQFVAVYDISQQKDTGTAHAAATFVA
FT                   SPGGLDGDNSDTAFNTARQGATSRYTYVQLTGSDAFALGRGFTLAASGTFQWTPDTLLP
FT                   SEEIGLGGETSVRGYDPYVMLGDRGWNVQTELRTPALAIGASAVLAQPFVFFDAGRVWT
FT                   RIDQPAEYNPGMLASVGAGVRFRWSRFVDFRCTYAAPLRAATPDGSKAPMVMLYLSIGT
FT                   "
FT   sig_peptide     complement(371456..371521)
FT                   /locus_tag="Bphy_5860"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 22"
FT   gene            complement(371602..373881)
FT                   /locus_tag="Bphy_5861"
FT   CDS_pept        complement(371602..373881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5861"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin domain
FT                   protein; GLUG domain protein; KEGG: bxe:Bxe_C1127
FT                   filamentous haemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5861"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74925"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE8"
FT                   /protein_id="ACC74925.1"
FT                   /translation="MITDQRLVSHACDVRRNSNARSLCAHSFHPINTLRVAALLALCCA
FT                   ASAHAGGLLPAGGRFVGGSGSIATNGSTLTVNQSTGRAVVNWDSFSIGNGNQVVFANGS
FT                   GATLNRVTGGKASAILGALTASGSVYLINPQGIVVGPRGVIATNGRFVASTLDADPAAF
FT                   MKGGPLALAGNSNASIVNLGKIASNGGDVFLIARSAIMNDGMISAPNGTVELAVAKQVL
FT                   LQDSSTGRQVLVQSGAGGTLANTGAIQAAQISLQAVDGNIYALAGNHEAIRATGTATRD
FT                   GHVWLVAEQGTMRPGGVIGASGGTVDMNAKTLAFPQGGTTVDAKQWNLSAPTFTVDQMA
FT                   ANALSQGLGHGTSVKVQTTGANSSGGDLNVDSGIHWQGGASLTLAAYHTLTLGSDATLA
FT                   NQGNGNLTLRADAASLDNAGAVVNHGAIDWSRSTGIVNVLYDMNGAYSGGTLLGNPAWK
FT                   SAPSSGQLTQITGYKLVNNVNDLENIRQDLAGNYALGADIDAAAHVFAPIGNHTTPFTG
FT                   QFDGMWHTVSNATINIDDFSKDYSSGLFGVVGSAGVLRDVGIENGFVSTSNQGSGILAG
FT                   VNRGVIAYAHTSGRAGEVEQNGTDFGGLVGRNEGTVERSWSSATVSGSDANGGLVGYNL
FT                   GTILQSYATGAVSPVFSTGSGGGLVGINEGTVSQSFATGAVQTRSMPTHGVIAFGSGTL
FT                   APDVYWNRETSGQSVSGGDLPPANGLTTAQMSDPASFVGYDFGPNGAWLMPAGATHPVL
FT                   RLPAAH"
FT   sig_peptide     complement(373729..373881)
FT                   /locus_tag="Bphy_5861"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.972 at
FT                   residue 51"
FT   gene            374289..376715
FT                   /locus_tag="Bphy_5862"
FT   CDS_pept        374289..376715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5862"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin domain
FT                   protein; GLUG domain protein; KEGG: bxe:Bxe_C1127
FT                   filamentous haemagglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5862"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74926"
FT                   /db_xref="GOA:B2JVE9"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVE9"
FT                   /protein_id="ACC74926.1"
FT                   /translation="MRRAVRASSIRCVSRCEPSTGHLWIAFGVSIAELAFAHAAWAAGV
FT                   LPQGGRYVAGAGSIANGGNALVVTQPGSTRGIIEWNSFSVGGNNSVSFDNGTGATLNRV
FT                   TGGTPSAILGRLSATGSLYVINPQGILVGPSGVVTTGGRFVASTLDVCNCAFMKGGDAL
FT                   TLSGDSNASVVNLGRIRSGGGDVFLIARRAVVNAGDIEAPKGSAELASGSKVLLQDSTG
FT                   SRQVFVQTGSQGTVADRGVIQAAQISLQAADGNVYALAGGGTRVRATGTGTRDGHVWLL
FT                   ADGGHVAQSGVIVATSADGSGGTVDTQASQLTFGRNAAVHAAQWNLSTPSFTIDAAAAR
FT                   ALRHSLNAGTSVNVSTTGADGAMGDLNVATNLLWQGAASLRLAAYRNVSIAQGASIANR
FT                   GAGDLSLRADAASLDNAGSVANHGVIDWSRSTGTVSAFYDMNGTYLAGTQRGNAAWTPG
FT                   AYSGLLSQSTGYKLVNSLSDLERMASDLAGSYALGKNIDASATSNGSYMPIGNANTPFT
FT                   GQLDGQGKTIGSLTLAPWVPASPYAPKMVGLFGAIGSQGVVRNLNVTGRGALGENQYAY
FT                   MGMLAGQNAGTVLRVNVAGTLTSGSFSAIDYTIAGGLAGGNTGAILRSSSSVSLATGNT
FT                   LGGLVGANGGLIDQSFASGSVVSSSYINQGGGGLAGDNTGTISRSYATGPVSLYGYCRG
FT                   AAGTPCGGAGLVVTNEGTVNQSFATGLVTQPFYEPIGIARTNTGSISNDVYWNKDTTAA
FT                   SIGVKYGTPIPDANGLTAAQMRNPASFVSYDFSATGVWAMPAGATHPVLRWQLAQ"
FT   gene            377463..378608
FT                   /locus_tag="Bphy_5863"
FT   CDS_pept        377463..378608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5863"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_3003 40-residue YVTN family
FT                   beta-propeller repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5863"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74927"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF0"
FT                   /protein_id="ACC74927.1"
FT                   /translation="MKKPLLAVLLVATAVLAACGGGDNSTSTPTSSTPAPTPSRLLTTI
FT                   AVPNSTTPAFSFDIGYTEAGRYYLADRNNKSVDVVDTKSNTLIAQITGGFTGAGASTDA
FT                   SGPDGIVGVTGTNTLYVGDVDSVKIVDTAALKTVKTIPISTSGSRVDEGCYDPDDHLIM
FT                   FASPGETPPYVTFISTTTQAVVSKLTFTGSSGLEACTYDAASKSFLINNDGTTANPTGE
FT                   LDVITASSVTSGTPVVSKAFSLGKCEPSGIALGPNSDVLIGCDPSAGNPLITLILDRNT
FT                   GAQLASIPFGGTDQVAYDPGSNRYFLPARHWVTSGTAAASGFTPQMGVIDGATRKLLYT
FT                   VAVGTGAHSVAIDSGLGQVYVPFQPGAAAFPNGGISVFATK"
FT   sig_peptide     377463..377525
FT                   /locus_tag="Bphy_5863"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.550 at
FT                   residue 21"
FT   gene            complement(378877..379455)
FT                   /locus_tag="Bphy_5864"
FT   CDS_pept        complement(378877..379455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5864"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rle:RL1226 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5864"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74928"
FT                   /db_xref="GOA:B2JVF1"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF1"
FT                   /protein_id="ACC74928.1"
FT                   /translation="MVDRDGLMTRVLEERWLTRYYFARTAFSAVWVALAISIGERFPIV
FT                   AAALLVVYPAWDALANYIDASRSGGMAENRTQAMSVVISLATTVAVIAALRWNCVLGIF
FT                   GMWAVLAGLLQLATAVRRWQHLGAQWAMILSGGQSALAGVFFLLQARMPLQLATGRVAG
FT                   YAAVGAVYFLVSAVWLSVGQMRSKRVRTS"
FT   gene            complement(379434..379934)
FT                   /locus_tag="Bphy_5865"
FT   CDS_pept        complement(379434..379934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5865"
FT                   /product="Glutathione S-transferase-like protein"
FT                   /note="KEGG: sme:SMa2319 probable gst14 glutatione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5865"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74929"
FT                   /db_xref="GOA:B2JVF2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF2"
FT                   /protein_id="ACC74929.1"
FT                   /translation="MGQPYEVPLVSFNAMKEPAHRARHPFGQIPTYEEGALVLFESGAI
FT                   VFHIAEGRPGLLPDDPHARARAITWICAALNTVEPPILELQTARFMERDKSWYEQRLPI
FT                   VEHRIRNRLAELSDRLGTADWLDGEFSARSFDRYRHGAPSAMLPRDTFMESVREWLWSI
FT                   AMD"
FT   gene            381095..381463
FT                   /locus_tag="Bphy_5866"
FT   CDS_pept        381095..381463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5866"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5866"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74930"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF3"
FT                   /protein_id="ACC74930.1"
FT                   /translation="MHPYYATLAFTRRFPMRSIAMAIATVSALALPISALSQTDATPTR
FT                   AQVRAELQQLEQAGYDPARGENPNYPADIQAAEARVSSQSGATAYGGVTSGTSGSGSRA
FT                   ISRPASTDEMKQLYFGGN"
FT   sig_peptide     381095..381208
FT                   /locus_tag="Bphy_5866"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.838 at
FT                   residue 38"
FT   gene            complement(381824..383176)
FT                   /locus_tag="Bphy_5867"
FT   CDS_pept        complement(381824..383176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5867"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase
FT                   domain protein; KEGG: bja:bll3418 putative epoxide
FT                   hydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5867"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74931"
FT                   /db_xref="GOA:B2JVF4"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF4"
FT                   /protein_id="ACC74931.1"
FT                   /translation="MPQDTPQSSSRRQFVGMAAAALAAGSLNRLAFADTSPAIGKITEP
FT                   ANGDKSALRPFRVHVADAQLVDMRRRIKATRWPDRETVPDESQGIQLATIQNLAQYWAT
FT                   GYDWRKCEARLNSYPQFVTEIDGLDIHFIHVRSKHENAMPLIVTHGWPGSIIEQFKIID
FT                   PLVNPTAYGAPASDAFHLVIPSLPGYGFSARPTTTGWGPERTARAWVTLMKRLGYERFA
FT                   SQGGDLGGIVTNIMAQQAPPELIGIHVNFPASVPAQILKSLAAGDPMPAGLSDEEKHAY
FT                   EQLSANFKKKRGYAFEMGTRPQTLYGLADSPVALASWLLDHGDGYGQPAAALSAAVLGH
FT                   PVNGHSAGALTRDDILDDITLYWLTNTGISAARFYWESHANFFLAADVNVPAAVSAFPG
FT                   ENYQAPKSWTEKAYHNLIYFNKPETGGHFAAWEEPMIFANEVRTGLRSLRT"
FT   sig_peptide     complement(383075..383176)
FT                   /locus_tag="Bphy_5867"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.934 at
FT                   residue 34"
FT   gene            complement(383198..383299)
FT                   /locus_tag="Bphy_5868"
FT   CDS_pept        complement(383198..383299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5868"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5868"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74932"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF5"
FT                   /protein_id="ACC74932.1"
FT                   /translation="MTNDLFQLTGGKPMTIYDFVKVHVADFTRKATR"
FT   gene            384328..384774
FT                   /locus_tag="Bphy_5869"
FT   CDS_pept        384328..384774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5869"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bam:Bamb_3813 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5869"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74933"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF6"
FT                   /protein_id="ACC74933.1"
FT                   /translation="MYDRILVALDDSASAKMALGEAVKLAKISSGLVYALSVVDRGRWP
FT                   AEDSARFDFEPEPSAAANAATRIFEEAETLFRESGVSGKVRAIDAYGENVSEVLARAAE
FT                   ECDADIIVIGTHGRRGAQRFLLGSVAESLVRATERPVLLLRHDG"
FT   gene            complement(384964..385989)
FT                   /locus_tag="Bphy_5870"
FT   CDS_pept        complement(384964..385989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5870"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bte:BTH_II0428 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5870"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74934"
FT                   /db_xref="GOA:B2JVF7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF7"
FT                   /protein_id="ACC74934.1"
FT                   /translation="MSRHMKAAVVREFGSPLSIEEVAIPEVGPGQILVNIKASGVCHTD
FT                   LHAADGDWPVKPTLPFIPGHEGVGYVAAVGSGVKRVKEGDRVGVPWLYTACGQCEHCLS
FT                   GWETLCHEQKNTGYSVNGGYAEYVLADPNYVGHLPANVAFDEIAPILCAGVTVYKGIRV
FT                   TDTRPGQWLAISGIGGLGHVAVQYAIAMGLHVVAVDISDTKLELARKLGATLAVNANTT
FT                   DPAAFIQKEIGGAHGVLVTAVSRTAFAQALGMVRRGGTISLNGLPPGDFPLPIFSTVLN
FT                   GITVRGSIVGTRRDLQESLDFAAQGSVRAHVHRDRLENINAVFGALREGTVDGRIVMEL
FT                   D"
FT   gene            386203..386688
FT                   /locus_tag="Bphy_5871"
FT   CDS_pept        386203..386688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5871"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5871"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74935"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF8"
FT                   /protein_id="ACC74935.1"
FT                   /translation="MDSRKSGNGGRMTSAQVLLYAALASSILLDGCSTVSRETAFRTQE
FT                   IELSRGRQEASIACETAVACDEAWARTRTFIQTHSATRIVQADDSAIQTAFPHAFGFVY
FT                   LAASRSADEAGKIVIRLRTMCRGMYDSDGGAGLLYSTCARSIVSVETEFHAWVKESR"
FT   gene            387201..387506
FT                   /locus_tag="Bphy_5872"
FT   CDS_pept        387201..387506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5872"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   reu:Reut_A0374 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5872"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74936"
FT                   /db_xref="GOA:B2JVF9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVF9"
FT                   /protein_id="ACC74936.1"
FT                   /translation="MDLELAERIKSGPTYHELVRRRSRLGWTLTALVLVVYYGYVLLVA
FT                   FNKELLAAKMGAGVMTWGMPIGLFVIVFTVAITGFYVRRANRTYDELTDRIKQEAA"
FT   gene            387503..389164
FT                   /locus_tag="Bphy_5873"
FT   CDS_pept        387503..389164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5873"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: reu:Reut_A0375 Na+/solute
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5873"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74937"
FT                   /db_xref="GOA:B2JVG0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG0"
FT                   /protein_id="ACC74937.1"
FT                   /translation="MKPRHIIPASALFALSSSCFAAGGDLGQTVKQATNWTAISMFVVF
FT                   VIATLFITKWAARRTRSAAEFYTAGGGITGFQNGLAIAGDFMSAASFLGISAAVYSNGY
FT                   DGLIYSIGFLVGWPIITFLMAERLRNLGRFTFADVAAYRFKQAPIRAFAASGTLVVVAF
FT                   YLIAQMVGAGQLIKLLFGLEYWIAVVIVGALMMVYVLFGGMTATTWVQIIKACLLLAGA
FT                   TFMAFMVLWQFHFSPEALFAKAVEVHEKKASIMGPGNFIKDPVSAISFGIALMFGTAGL
FT                   PHILMRFFTVPNAKEARKSVFWATTWIGYFYILTFIIGFGAIVLVSTNSVFKDAAGKLL
FT                   GGTNMAAVHLASAVGGNVFLGFISAVAFATILAVVAGLTLAGASAVSHDLYATVFKHGK
FT                   ASSANELFVSRVTTLALGIIAVVLGIVFEKQNIAFMVSLAFAVAASANFPVLFMSVLWR
FT                   GCTTRGAAIGGFLGLFSAVLLTVLSKAVWVDVFHHASAPFPYASPALFSMAIGFAGIWV
FT                   FSVTDRSARARIDQAGFEAQAVRSETGIGAVEGASH"
FT   sig_peptide     387503..387568
FT                   /locus_tag="Bphy_5873"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            391804..392718
FT                   /locus_tag="Bphy_5874"
FT   CDS_pept        391804..392718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5874"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_4415 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5874"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74938"
FT                   /db_xref="GOA:B2JVG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG1"
FT                   /protein_id="ACC74938.1"
FT                   /translation="MRIPPVKAIVAFECIARTRSVNRAAEELGLTASAVSHQLSNLESI
FT                   IGQPLFQRTGRGLVLTPTGERYLADVTGSLADLSRATERASSRKEVDILRVHSSPSFGL
FT                   MWLMPRLASFQEANGDIQLNLACSYENVSFSNGYYDIDIRHGYGEWTHVEVKTLRGECI
FT                   APLASPKYLKQYPVKSPDDLLAHRLIFSETPLVQWRQWFGRVGVAGAQKTFDFSFDRSY
FT                   MSIETAALGLGIALESLMLASVKIREGALVPVFDDAHSVEVGAHHLVYPSQNADLPRVA
FT                   RFIAWIEQEIERTAPNASGKSRS"
FT   gene            392815..393564
FT                   /locus_tag="Bphy_5875"
FT   CDS_pept        392815..393564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5875"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_4414 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5875"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74939"
FT                   /db_xref="GOA:B2JVG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG2"
FT                   /protein_id="ACC74939.1"
FT                   /translation="MLLKNQVVIITGAASARGIGKATAKAMAARGARVAILDLKQADAE
FT                   SAARDLGDGHLGLACDVTDKAACVAAANAVIDTYGRIDVLVNNAGITQPIKTLEIAREN
FT                   FDAVIGVSLLGTLYMSQAVIPWMKKQQSGSIVCMSSVSAQRGGGIFGGPHYSAAKAGVL
FT                   GLAKAMAREFGADRIRVNSITPGLIQTDITGDKLTPEMRADIIKGIPLGRLGEANDIAN
FT                   ACVFLASDLSTYLTGITLDVNGGMLIH"
FT   gene            393711..395039
FT                   /locus_tag="Bphy_5876"
FT   CDS_pept        393711..395039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5876"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_6659 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5876"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74940"
FT                   /db_xref="GOA:B2JVG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG3"
FT                   /protein_id="ACC74940.1"
FT                   /translation="MKSKIASPMIGAELSASDDVVSFEARTYAKVARRLIPFLMLCYLG
FT                   AYLDRVNVGFAKLQMLNDLRFSETVYGIGAGIFFLGYFLFEVPSNVILHKVGARNWLAR
FT                   IMLTWALISASFVFVKSPTVFYVLRFLLGVAEAGFAPGVILYLTYWFPAARRAKALSMF
FT                   FMAIPLAGIVGGPLSGWIMHSFQGLHGLAGWKWLFMLEAVPSLVLGFAIILYLDNGIAG
FT                   AKWLTDDEKALLKRNVDKDRTQTTEHVSIRGFIADRRLWLMAAIYFCVVLGQYGLTFWL
FT                   PTIIRRTGVVDPLWVGILTAIPYICAIIALPLLGSSADKRRERRLHLAIPMLVSAAGFA
FT                   TLPMLGSVGASIVCVSVAAAGILASSSLFWALPTAVLGGMSAAAGIAAVNCFANLAGFF
FT                   SPAIVGWLNDLTGKSTAGLLFISSAVVLGAVMVFFVPARTVNR"
FT   gene            395069..395920
FT                   /locus_tag="Bphy_5877"
FT   CDS_pept        395069..395920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5877"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   bch:Bcen2424_6658 transketolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5877"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74941"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG4"
FT                   /protein_id="ACC74941.1"
FT                   /translation="MSTPVIEDVTLAERAYRIRRNALLMGEVQGQGYIGQALDIADVLA
FT                   VSYFGAMNYRSADPDWEDRDRFLLSNGHYAIALYAALLEAGILPPEELETYGSDDSRLP
FT                   MSGMASYTPGMEMSGGSLGQGLTIAVGRCLGLKRKGSTSFVYTLFSDGELDEGAIWEGL
FT                   MSAAHWKLDNLIAMIDVNNQQADGPSTQIMAFEPLVPKLEAFGWYVQRVNGNDIDAVKQ
FT                   AFDNARNLKEAKPRIIVCDTKMGCGVPFLEQREKNHFIRVDPNEWTLALEALDATFAGR
FT                   KA"
FT   gene            395917..396918
FT                   /locus_tag="Bphy_5878"
FT   CDS_pept        395917..396918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5878"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bch:Bcen2424_6657 transketolase,
FT                   central region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5878"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74942"
FT                   /db_xref="GOA:B2JVG5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG5"
FT                   /protein_id="ACC74942.1"
FT                   /translation="MNSVIDKKPRLKTSAMIASIAGEGQITRSAPFGHALAELARTKTN
FT                   VIGMTADLGKYTDLHIFAKAFPERYYQMGMAEQLLMGAAAGFAHEGAQPFVTTYAVFAT
FT                   RRAYDFIHQTIAEDDLDVKIVCALPGLTTGYGPSHQAAEDLALMRAMPNMTVIDPCDAL
FT                   DIEQMVPAIAAHKGPVYARLLRGNVPAVLDEYDYRFELGKAKMLRDGADVLIVSSGMMT
FT                   MRALEAAKALEADNVDVAVLHVPTIKPLDTESIIREARRSGRMVVVAENHTVVGGLGEA
FT                   VATTLLSAHVSCSFRQIALPDAFLDAGALPTLHDRYGISTSVMAANIKKWLA"
FT   gene            complement(397060..397407)
FT                   /locus_tag="Bphy_5879"
FT   CDS_pept        complement(397060..397407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5879"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: bxe:Bxe_B1624
FT                   putative phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5879"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74943"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG6"
FT                   /protein_id="ACC74943.1"
FT                   /translation="MKAFHFGSLLVVAACATSNVFAQASNAMPMASSPAGGSGKGATSD
FT                   KQLARDVRKALSKAPHFNVSNVFVKARGGVVTLSGSVSDGAQIQQATEVAMGVPGVTSV
FT                   NNHLTMYTKGY"
FT   sig_peptide     complement(397339..397407)
FT                   /locus_tag="Bphy_5879"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 23"
FT   gene            complement(397443..398783)
FT                   /locus_tag="Bphy_5880"
FT   CDS_pept        complement(397443..398783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5880"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter; KEGG: sfu:Sfum_2052 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5880"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74944"
FT                   /db_xref="GOA:B2JVG7"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG7"
FT                   /protein_id="ACC74944.1"
FT                   /translation="MSDWQIYLVVGVFSVVILVIAFDVIDMAVAALVGASALIALGILE
FT                   EKDLLATARTSAGPISLLFGGMIVARILSTTGLFDLVGDFYLRATAGSGKRFLLLLIVI
FT                   VAPLCALLPNATTVILLAPIIVRVARALDIDIVPPLILTAILSNAAGLLTLVGDPATFL
FT                   VGSSIGMTFGEYLRRASLGGVLAILVAIPLLPVMMPGIWRMARPLPPRTARAQLKRPVY
FT                   AVFALVVLMLMMVLFVMGEDLPTRIVPPVVAVIASALALLVAFAFKVEPTENVLRDVDW
FT                   KTLLFLSCIFCLVQGMAKTGLLEVMSVKLYEVFGTRLTLVALAMIFGIGVLSSVLANVP
FT                   VAAASIVMVKGYLVTAEFVPDAALSDQFTQWPPAVIPVFVGMMYGATLGGNATLVGSAA
FT                   NIVAAGICAREGTPVSFGRFLRYGLPVTACQLAVAAGYLVVLTKVLH"
FT   gene            complement(398802..399839)
FT                   /locus_tag="Bphy_5881"
FT   CDS_pept        complement(398802..399839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5881"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: azo:azo1331 putative amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5881"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74945"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG8"
FT                   /protein_id="ACC74945.1"
FT                   /translation="MNTPAWSFVAAVRAVLLAALLTGSAVATAAGSETLAHIKARGTLR
FT                   CGISEGIAGFSAADGAGHFSGIDADFCRAVAAAVLGDPNKVTFVPLKASARFPALRTDR
FT                   IDLLARNTTWTLLREGTLGIQFAGILFYDAQAFMVSRKNGTASSSLNGATVCVQQDTTS
FT                   ERNLMGYASANSLNVKPLVVGSVPELAQAFFSGRCSAATADASLLSVLKSRAPGGASTV
FT                   EILPERLSKQPLGPAVRGDDDAWLVVVRWVLFTLITAEELGVTRENYAARVRDPLVARA
FT                   LVPDATVTATLGIEPGWTLRALQSAGNYGEMFERNLGAGSPLGLERGLNNLWTHGGLMY
FT                   APPMQ"
FT   sig_peptide     complement(399750..399839)
FT                   /locus_tag="Bphy_5881"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.849 at
FT                   residue 30"
FT   gene            400190..400819
FT                   /locus_tag="Bphy_5882"
FT   CDS_pept        400190..400819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5882"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5882"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74946"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVG9"
FT                   /protein_id="ACC74946.1"
FT                   /translation="MKRSINWDLIETRESIRQSAYDLARSGLCDAWQDVWRALRARFSV
FT                   DQLAVIFDNPLCRLDIDQRCYRARNPGKVAREVQTDLDAIRQRAAPMVLSTKPAGLNGQ
FT                   KRRSERLASRIETLLADGSQCTAVELAERLGTSRNEILIAARDMLADGTLQVARYVASS
FT                   RGGRGARVFVRTGASAPKDHAPGLHSTWPQADSVVADAFDAIARCR"
FT   gene            400859..401194
FT                   /locus_tag="Bphy_5883"
FT   CDS_pept        400859..401194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5883"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   bxe:Bxe_A0676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5883"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74947"
FT                   /db_xref="GOA:B2JVH0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH0"
FT                   /protein_id="ACC74947.1"
FT                   /translation="MTQFIVTLNWTAVIEILIIDVLLGGDNAVVIALACRSLPERQRRR
FT                   CVLWGTGGAILLRVVLIAFVVALLNLPFLKLAGGVLLLWIGVRLMAPAHDYQSLDQGPI
FT                   HDSFRRV"
FT   gene            401465..402865
FT                   /locus_tag="Bphy_5884"
FT   CDS_pept        401465..402865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5884"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5884"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74948"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH1"
FT                   /protein_id="ACC74948.1"
FT                   /translation="MTSWRARSASALFLCPLVLTTMSSCADYGAAGSAPSGAVASGSAP
FT                   PGTVPAAAAPTGPTSMPSAPPSRLESSGPAPFKPEEIEALVAPIALYPDSVLAQVLMAS
FT                   TYPLEIVHAARWVKANPNVKGDAAVQAVADQPWDTSVKSMVAFPQILEPMSDKLDWTQR
FT                   LGDAFLAQQKEVFDAVQRLRSRAQESGNLTSNEQQNVIVEPAPAGSQAGTSTIVRIEPA
FT                   NPQVIYVPAYNPTVVYGAWSYPAYPPYYWPPYPAYYPGYYPGAALATGFAWGIGLAAAG
FT                   AIFSNCNSCWGGGDVNINVDKAANINRNFDRNKVQAQGGRWQHDASHRQGVAYRDNATR
FT                   DKFAGQSPRAGTRDQYRGRGADTGGRAGTSDRAAAGNRAATADRSAGANRGGSNRAGGD
FT                   VNRVSSGDRAGGVGGGRDSAFNGVGGSGRSAQRNFDRGRSSVQGSGFNRPSGGAGMRGG
FT                   GGGFRGRR"
FT   sig_peptide     401465..401545
FT                   /locus_tag="Bphy_5884"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.841 at
FT                   residue 27"
FT   gene            402876..403805
FT                   /locus_tag="Bphy_5885"
FT   CDS_pept        402876..403805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5885"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5885"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74949"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH2"
FT                   /protein_id="ACC74949.1"
FT                   /translation="MNVHSRVAPQRRTLKLASLVAVAVLSAATTTAAYAQKTFTSPEAA
FT                   MKAFGDAVVKDREDALRTIFGDDFRKLIPPAGAAVRDTFVAEWAKSHTIEPVEAGHTHI
FT                   VVGDSGWTFPVPLVKTGQGWRFDTRAGAEEMRLRRIGRNELAVIQTMLAIYDAQREYAQ
FT                   TAHDGEGVLAYASRMVSSSGKHDGLYWPTGPGEPASPLGDAFVDASSRNAKNAGYYGYH
FT                   YKLLDSQGPHAPGGAYGYVVHGKLFGGFAVIAWPVKYGETGIKSFMVSHAGQVYQRDLG
FT                   PDSAAKAEATKSFDPGPGWSKVPDADVQ"
FT   sig_peptide     402876..402983
FT                   /locus_tag="Bphy_5885"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.907 at
FT                   residue 36"
FT   gene            404159..406285
FT                   /locus_tag="Bphy_5886"
FT   CDS_pept        404159..406285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5886"
FT                   /product="putative D-(-)-3-hydroxybutyrate-oligomer
FT                   hydrolase"
FT                   /note="KEGG: bxe:Bxe_B2223 putative
FT                   D-(-)-3-hydroxybutyrate-oligomer hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5886"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74950"
FT                   /db_xref="GOA:B2JVH3"
FT                   /db_xref="InterPro:IPR016582"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH3"
FT                   /protein_id="ACC74950.1"
FT                   /translation="MMGIPLAVWSRRVLRNAALAIAGAALAHGAQAGDQDEGRGKLNRL
FT                   PPFVVADSLRTTVYDGVSDDLLTAGLGKTGLAGAAPAIANPAAPTAAELRRLAIWSNYR
FT                   ALVDMTANGGYGRFWGPNVDLSGGDTLGEGKIAGTEYLAYADDGTGRRNVSLLVQVPAA
FT                   FNPRSPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKGSGNGANELMTGLVTLI
FT                   DGRVADAATAGRSSLFTANVPADSLADYNQKYPYRYAFKHAHSQQNPEADWGRDTLAAI
FT                   QFAYWALNQQFGPRIGASAAGVRYEAGDITTIAASVSNGGGASLAAAEQDTRGWITAVV
FT                   VGEPQINVRLPGHAQVKEGGQPIAAAGKPLADYMTLANLLQPCAALADAAANAPYLTAL
FT                   PVATTNAIRTARCASLAAAGYVHGSDVQTQANDALALLHQAGYEADSDVLQAPMWDSQA
FT                   VPAVAVTYADAYTRSSVIDNLCGFSFGTTNASTGAAGVAPAVPPMPTVFGLGNGVPPTN
FT                   GINLVYNGASQSGADHRLATSDASFKGAACLRALWTGNDPRMRRSVEAISVNANLHGKP
FT                   AIIVQGRSDALVPINHASRAYLAANSQREGSRSRLSFYEVTNGQHFDAFLGVAGFDTRF
FT                   VPVHYYNIQALDLMWNHLKSGTPLPPSQVIRTIPRGGDPGKAPPLGVANLPAIVANPGS
FT                   NAISVDDGIVNVPH"
FT   sig_peptide     404159..404257
FT                   /locus_tag="Bphy_5886"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(406395..406766)
FT                   /locus_tag="Bphy_5887"
FT   CDS_pept        complement(406395..406766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5887"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5887"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74951"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH4"
FT                   /protein_id="ACC74951.1"
FT                   /translation="MCARMMIERMAFLQTNAVIAIVRINRRSPTATLSIRARQFRHQRS
FT                   RGKVHQDRLFAKRQPAVPRRVFLTSHEKQQDHSNDDMNPKGCLLQIREVMSHVSLPLKS
FT                   PTVSGSWMGSGSPSLSSRQ"
FT   gene            complement(406982..407710)
FT                   /locus_tag="Bphy_5888"
FT   CDS_pept        complement(406982..407710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5888"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   bxe:Bxe_A1873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5888"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74952"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR017080"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH5"
FT                   /protein_id="ACC74952.1"
FT                   /translation="MTTRRAQAKGAIMRALDIMTTSVVTATPDMSIHDAARLFVDNRIS
FT                   GMPVVDGEGQVVGIVSQGDLLHRVENGTGHGKRRWWLDFLLSSPREQAARYVKEHAHVV
FT                   GDVMCDRVISITEDMPLDRIADLMERRHLKRVPVLKDGKLVGIVSRSNLIRALASVAPP
FT                   ADAAAHDDASVRDAIVLEMHGQRWGLSKHGVIVKDGIAHLWGVVESEEEKRAICIAAER
FT                   VPGVKRVEHHLEFPNVIPTL"
FT   gene            complement(408141..409289)
FT                   /locus_tag="Bphy_5889"
FT   CDS_pept        complement(408141..409289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5889"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A2938 ABC branched chain amino acid family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5889"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74953"
FT                   /db_xref="GOA:B2JVH6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH6"
FT                   /protein_id="ACC74953.1"
FT                   /translation="MRFTKSLSPIAVVVGSLLAVAPLAAHADTVVKVGFAAPLTGPNAN
FT                   YGKDLENGVKMALDDAKAQGVKINGQPVTFQLVAEDDQADPRIGVQVAQKLIDEGVSVV
FT                   VGHFNSGTTIPASNLYEKAGLPDIDPAATNPTISSRGFKNMFMVISSDAQNAGTAGAYA
FT                   VETTKAKRIAVIDDRTAFGQGEADEFVKAVKAHGGDIIDREYTTNQATDFKTQLTNLKA
FT                   KNPDLIFVGALNPQAAGIMKQMNQLGIKAQYVGGGGVKDIDFIKLAGDVSEGAMAWEYG
FT                   RPLDSTPVGAKFAERFKQKFGEDVLSYAPFGYDAAWAAIKAMQAANSTKPDDYRSKLQS
FT                   ISFEGITGHIEFNANGSLKNGSSTVYQVKNGQWVTVKTVSGL"
FT   sig_peptide     complement(409206..409289)
FT                   /locus_tag="Bphy_5889"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            409683..409988
FT                   /locus_tag="Bphy_5890"
FT   CDS_pept        409683..409988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5890"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74954"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH7"
FT                   /protein_id="ACC74954.1"
FT                   /translation="MRCGLGSQANLMPQQGLKLLQSVMSDGARTRRPCRDAYQRLGYAG
FT                   FQQRCAHRSWRPSNALASRGVGMFVPVAAFGDWFGIANRRRADFGRHMSVRLPGAT"
FT   gene            complement(410009..410770)
FT                   /locus_tag="Bphy_5891"
FT   CDS_pept        complement(410009..410770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5891"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bxe:Bxe_B2688 putative short-chain
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5891"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74955"
FT                   /db_xref="GOA:B2JVH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH8"
FT                   /protein_id="ACC74955.1"
FT                   /translation="MNILSQAPLILITGGGRGVGAATARLAAAQGYDVAISFLSNESAA
FT                   LAVAADVKAHGRRALAVRADSADPAQVARLFAAIDREFGRIDVLVNNAAIIAQQSRLED
FT                   LEFERMQRIFAVNAIGPILCAQQAAKRMSRRHNGRGGSVINISSASARLGSPNEYVDYA
FT                   ASKGAVETFTTGFAKEVARDGIRVNCIRPGHIYTEMHASGGEPGRVDRVKESIPMGRGG
FT                   QPDEVARAILWLASAEASFVTGTFLDVTGGK"
FT   sig_peptide     complement(410705..410770)
FT                   /locus_tag="Bphy_5891"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.296 at
FT                   residue 22"
FT   gene            complement(410852..411694)
FT                   /locus_tag="Bphy_5892"
FT   CDS_pept        complement(410852..411694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5892"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5892"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74956"
FT                   /db_xref="GOA:B2JVH9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVH9"
FT                   /protein_id="ACC74956.1"
FT                   /translation="MLSYTGGIVLFAALLHASWNAILHGNRDRFLSITWMSIAIAVAAT
FT                   LVVLVNPWPPRASWPYIVASGLVHIFYNMSLVRSYRRHDLAVAYPIARGSSPLLVTLGA
FT                   ALFAHEAIGPLHALGVAMISGGIVALALQGHRVSRTGAMAALTTGATIALYTVIDGIGV
FT                   RLSDGRSFSYTAWMFLFYWLMPVLFVAVRGFTPLWTPVREQPLSIGSSMVGGMVSIAAY
FT                   GIVIWALQSGAMGAVSALRETSVVFAVLIGQMFLRQAVSGTRWLACLVVAAGAVCLGL"
FT   sig_peptide     complement(411641..411694)
FT                   /locus_tag="Bphy_5892"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.499 at
FT                   residue 18"
FT   gene            411817..412704
FT                   /locus_tag="Bphy_5893"
FT   CDS_pept        411817..412704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5893"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_C0010 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5893"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74957"
FT                   /db_xref="GOA:B2JVI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI0"
FT                   /protein_id="ACC74957.1"
FT                   /translation="MKRILPPLNALRAFEAAGRLGSFKEAAAELHVTHGAVSQQVRLLE
FT                   AWLGVSLFERRNRRVTLTHAAKAYLEEVGPLFEQLSQATARYGVPDTVARTLSVNAPAT
FT                   FTLRWLVPRLARFRAAHPDVEVKVETSNGPLESLKENYDIVIRGGPDTFYGYAMRSFLS
FT                   EERLPVCSPALLQRVPLRSPADLRQHTLLHTSSLPRLWPDWLASAQIPAMRPAATLTFD
FT                   HFYLTLQAAIDGIGVAMGPTALVSDDLAAGRLVAPFSAPRLPSRSYCSYVPDEKSGDEL
FT                   VGLFRTWLEREGAC"
FT   gene            complement(412723..413892)
FT                   /locus_tag="Bphy_5894"
FT   CDS_pept        complement(412723..413892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5894"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpl:BURPS1106A_A1647 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5894"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74958"
FT                   /db_xref="GOA:B2JVI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI1"
FT                   /protein_id="ACC74958.1"
FT                   /translation="MNTWSTSSERQAMAACAPAARLATRLAFLVAGFGVACWAPLVPFA
FT                   KQRLGVDDGALGLLLLCIGLGSVIAMVVTGALSARYGSKPIIVAGGVGMAVVLPLLTVV
FT                   DTPITLGVALLAFGAFLGSLDVAMNIHAVDVERTEGRPLMSGFHALFSVGGFAGATVMT
FT                   FLLSLHIGTLASTVPCAVLMVVAIAVARSRLIVTVQASSGPLFALPRGIVLMLAGLAAI
FT                   TFLVEGALLDWSALLITGTGLVAAPQGGLGYMFFSIAMTAGRFGGDALTARIGDRATMF
FT                   WGGVLAALGFVVLLTAPVAAIAMTGFVLIGLGASNVVPVLFRRAGSQRAMPSTLAVAAI
FT                   TTTGYAGHLAGPAGVGFIAKAAGLPGAFWLLAALLCLVPICARPVTRES"
FT   gene            complement(413889..414671)
FT                   /locus_tag="Bphy_5895"
FT   CDS_pept        complement(413889..414671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5895"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; KEGG:
FT                   bmn:BMA10247_A1228 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5895"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74959"
FT                   /db_xref="GOA:B2JVI2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI2"
FT                   /protein_id="ACC74959.1"
FT                   /translation="MNDDIPLARRDEIANRLAQGQPVVAAALAAEFNLSEDAIRRDLRA
FT                   LAAEGRCRRVYGGALPVTPASVPMASRIDKALERKSALARAAVPLIEVGELLFLDSGST
FT                   NLALVDLLPEDAGLTVATNSVDIGAAVLRRSDIQLVVIGGAVDPAVGGCVDANAVQTVT
FT                   QMNIDRCFVGTCAISPKSGISAFDLADATFKRAVLAASKHSVVLALTEKFDTRAPYKAA
FT                   TIGEIDCVVVEHDLPRAARQALSKAGTSVVAADVPDSP"
FT   gene            complement(414752..414958)
FT                   /locus_tag="Bphy_5896"
FT   CDS_pept        complement(414752..414958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5896"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="KEGG: reu:Reut_B3549 AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5896"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74960"
FT                   /db_xref="GOA:B2JVI3"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI3"
FT                   /protein_id="ACC74960.1"
FT                   /translation="MTLLPFWPARLYRHLESPRTSLYYNLEVSATRYPGKAAIHYYGTA
FT                   ISQARLRSDADALAGFLQHRSAA"
FT   gene            complement(415313..415768)
FT                   /locus_tag="Bphy_5897"
FT   CDS_pept        complement(415313..415768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5897"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   bxe:Bxe_B1532 putative guanyl-specific ribonuclease SA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5897"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74961"
FT                   /db_xref="GOA:B2JVI4"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI4"
FT                   /protein_id="ACC74961.1"
FT                   /translation="MKSAWAFGCIVALSVTLGGCGKGGSQNAAEASGASASQAPAQPAQ
FT                   VASSPPAASGVLAAVTKAQLPAEAAETLRLIKAGGPYPYSEDGVLFRNSAQLLPQHPRG
FT                   YYHAYTVRTPGSADRGQRRIVCGGPRKQVGDCYYTDDYYVSFKRIAD"
FT   sig_peptide     complement(415682..415768)
FT                   /locus_tag="Bphy_5897"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.467 at
FT                   residue 29"
FT   gene            complement(415892..416242)
FT                   /locus_tag="Bphy_5898"
FT   CDS_pept        complement(415892..416242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5898"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   nmu:Nmul_A1193 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5898"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74962"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI5"
FT                   /protein_id="ACC74962.1"
FT                   /translation="MRNASYLTSRLLIVAALAFPAVVLMNGCKSATTTTPSQNAQGANA
FT                   TDDAALAVRVKQSLAADPELKSLPMSVATYKGVVQLSGYVDSEGQMQKALAVTRGVPGV
FT                   LSVSNDLHLRPH"
FT   sig_peptide     complement(416150..416242)
FT                   /locus_tag="Bphy_5898"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.798 at
FT                   residue 31"
FT   gene            complement(416647..419403)
FT                   /locus_tag="Bphy_5899"
FT   CDS_pept        complement(416647..419403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5899"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: bvi:Bcep1808_5745 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5899"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74963"
FT                   /db_xref="GOA:B2JVI6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI6"
FT                   /protein_id="ACC74963.1"
FT                   /translation="MDAASTRHQAAPDLNRHFTRTAAIALAAALVICLAVGAAISATFS
FT                   RGADDLRLRNALTVASELETLLTLHVAANTDFLEGVGIAGYSSRGWPIRRAAAVAGTYD
FT                   RLERELTGGSGALKKLRQLRRLSSAWPQELDSAARNLALANAGAEVQPTLLQHANKTLS
FT                   SIMTLIGDLRSDEREQIADMQFRAQGQLVQQRISLAVAAAASALLLLFALFTRQRASLT
FT                   RITSQIVATEAQRRFREYFEQHPVSMLIFDVHSYEILTANAAAQRQYGATLQQLRSMPV
FT                   DQLRPSSDVEEFRRDLQQQLESGSRGGTGGVRRHRRADGEIFYVDVTYHLLDFAGRQAC
FT                   FVTAHDVTAHEHAKESLRIRSRALDASRNAVIISRKIDGNSTITYVNAAFERITGRSAT
FT                   EAIDAELWNLIGCDISTPDARSVRMAMRAECEGARLLQCRKPDGSIYWIDLHVAPVLDE
FT                   QDRPTHFVTVFSDVSERVRYQEQLRIQAHEDALTRLPNRLGLKATLADMFGRAVAEGNK
FT                   LALVFLDLDNFKEVNDTLGHTAGDQVLCEVARRLSGAVSRDEIVVRYAGDEFVAALYGR
FT                   GDIDRFMAAATAMKETLTHALTVDNRLIVPQASVGVAVFPDHTQDPDTLLQYADAAMYR
FT                   AKSAGPNSILLFNHDIAIQDNRRATLAQALRHAVASEAFSLAYQPRVNPATGKASGFEA
FT                   LVRWHDPEHGDISPSLFVPIAEETGLIVQIGQWVFEQACRQTRTWAASLHPDIVVSVNV
FT                   SPVQFERSDLPAMIASTLERTGVSARNVELEITEGVLMAPGSLATLRALREMGLSIAID
FT                   DFGTGYSSLGYIRSFLADRLKLDMSFVQGIGRSHADEVIVRAVLAMGRTLGMRVVAEGV
FT                   ETLGQLEFLIDNGCDEVQGYWFARPMDANWAHAYLVQDSVRASTRVM"
FT   sig_peptide     complement(419260..419403)
FT                   /locus_tag="Bphy_5899"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.364 at
FT                   residue 48"
FT   gene            complement(420468..421364)
FT                   /locus_tag="Bphy_5900"
FT   CDS_pept        complement(420468..421364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5900"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B1359 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5900"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74964"
FT                   /db_xref="GOA:B2JVI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI7"
FT                   /protein_id="ACC74964.1"
FT                   /translation="MRVRIRHRERRPASFYWLALLFGLFVLFLYGPVITIFILSFQGPQ
FT                   GGLTFPMRGVSLHWFAVLRDGVGDVDIWPAFGRSVKLALAVTVLTVLFSVSAGLAFRRR
FT                   FRGDTTVFYVSVASLIMPSIIVSLGIGLTFRLLDTLIRYLANEWGFQSFADGWTTSMGL
FT                   YTSALGAHLTWTLPFGLLVMFAVFNRFSPAFEEAARDLGASPWQSFRHVVLPIIGPSVI
FT                   GIAMFGFTLSWDEIARTSQAIGDQNTLPLELQGLTTSVTTPVIYALGTMTTLISLAVMV
FT                   GGLLIARSIARKRATTA"
FT   gene            complement(421366..422280)
FT                   /locus_tag="Bphy_5901"
FT   CDS_pept        complement(421366..422280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5901"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B1360 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5901"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74965"
FT                   /db_xref="GOA:B2JVI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI8"
FT                   /protein_id="ACC74965.1"
FT                   /translation="MATVDYLQQTKQTSLRHRGVSAWLQATPLTLTFAFFFIVPLAITL
FT                   IVSFWDFNEYQIIPAFTLKNYAAIFDGCGSLTDVCVTFKTYWSTLRFCAIVWAVTLVLG
FT                   FTIAYFIAFHVRTTAMQTVLFLVCTIPFWTSNVIRMISWIPLLGRNGLVNQAMMSAHLV
FT                   DQPVEWLLYSDFSVVLAFVHLYTFFMIVPIFNAMMRIDRSLLEAARDGGASGWQAIRDV
FT                   VLPLSKTGIVIGSIFVVTIVMGDFLTVGVMGGQQIASVGKIIQVQTGYLQFPAAAANAI
FT                   VLLAAVLMIVWTLTRAVDIRKEL"
FT   gene            complement(422312..423613)
FT                   /locus_tag="Bphy_5902"
FT   CDS_pept        complement(422312..423613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5902"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /note="KEGG: bxe:Bxe_B1361 ABC spermidine/putrescine
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5902"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74966"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVI9"
FT                   /protein_id="ACC74966.1"
FT                   /translation="MNDDKTAAAVQHVEAETVGKGMSRRTFIKGAVAAAGITGFPYVHA
FT                   QEKITLRYLGTAVNQSAEIAKKFKEDTGIEIQYIPVTTDDVTKRIITQPNSFDIVDTEY
FT                   FALKKLIPAGTLAGMDAKRIKLADKITPVLTKGEVDGKKIGDQGTAPKKVMFLKGARST
FT                   EFSAMPTEWMTLIPTTYNADTLGIRPDLIARPVTTWADLLNPQFKGKAALLNIPAIGIM
FT                   DAAMAIEAMGRVKYGDKGNMSKAEIDQTIKILIEAKRAGQFRAFWRDFNESVNLMASGE
FT                   VVIQSMWSPAVTKVRTMGIACKFQPLKEGYRSWASGFGFPRSLQGKKLDAAYEFVNWFQ
FT                   DGWAGAYLMRQGYYPGVTETAKSHMQAYEWDYWMEGKPAAQDIKAPDGQLLEKAGSVRD
FT                   GGSYSQRMGAIACWNAVMDENIYMVQKWNEFIAA"
FT   gene            complement(423660..424715)
FT                   /locus_tag="Bphy_5903"
FT   CDS_pept        complement(423660..424715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5903"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bxe:Bxe_B1362
FT                   ABC spermidine/putrescine transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5903"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74967"
FT                   /db_xref="GOA:B2JVJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ0"
FT                   /protein_id="ACC74967.1"
FT                   /translation="MVLPASTVVHASPADIELVHVSKRYGDSLAVDAIDLRIPGGAYCC
FT                   LLGPSGCGKTSTLRMIAGHEWVSEGDVLIGGRNVTREQPAGRGTAMVFQSYALFPHLSA
FT                   LDNVAFSLKMRGVAKEARRKRAGELLELVAMSAYAQRRPAQLSGGQQQRVALARALLNE
FT                   PRCLLLDEPLSAVDPFLRVQMRTELKRWQKELGITFVHVTHSQEEAMALADLVVVMSDG
FT                   HIEQSGTPFDVFNRPRTEFVARFLGSHNVLGANGTLFTVRADRLRIAPQGVAPGTSAGE
FT                   GGLSRIGGLACTVREAEYQGTHLRITLDPLDGSPALVSLMSDADYDPQRLGPDARVTVW
FT                   WDEQSAHPLAA"
FT   gene            425015..425956
FT                   /locus_tag="Bphy_5904"
FT   CDS_pept        425015..425956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5904"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bxe:Bxe_B1363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5904"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74968"
FT                   /db_xref="GOA:B2JVJ1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ1"
FT                   /protein_id="ACC74968.1"
FT                   /translation="MNDYKREPCASLGSLKTHGRFDYQPIHEGDGYLWPNGARLAVYLG
FT                   FNLEHFAFGEGLGAALGPLSPQPDVLNYSWREYGNRVGAWRCIDLFDSLDMPAGTLINT
FT                   SLYDHCPALIDACVARGDELIAHGHTNAQRQSDLDLEGERALLAHCRARIQQRSGVIPQ
FT                   GWLSPWISESHRTPDLLAETGYRYTLNWSHDDRPVRMHTSGGPLWSVPYPQELNDLPMI
FT                   MARQMDMRDFADMIVDQFDEMLEQTQCSRNSQALVMGIALHPYIVGQPYRLRHLRRALA
FT                   HIAGLRDDIWLTTPGAIARHVEEAVPASAKAA"
FT   gene            425953..426687
FT                   /locus_tag="Bphy_5905"
FT   CDS_pept        425953..426687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5905"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_B1364 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5905"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74969"
FT                   /db_xref="GOA:B2JVJ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ2"
FT                   /protein_id="ACC74969.1"
FT                   /translation="MSTLHAPMRHGKRDNAGADGRIYQSIFEGVLNRRLTPGTKLPEPE
FT                   LCALFGVGRAVVRRALEKLAHDGIVVLRPNKGAVIAQPTREETREIFEARRAVERALVE
FT                   LAAQRASVDDIGALRKQLADEHEAMHRFDQPSWARLASEFHLRIAALSGNAILERYLTE
FT                   LISRTSLIVGAYERVGNAPCEHDEHTAILDCLESRDAEGAIAHMTAHLQSLEARIETSH
FT                   MPGTKRLAHLLGIEPDRSTPME"
FT   gene            426689..427276
FT                   /locus_tag="Bphy_5906"
FT   CDS_pept        426689..427276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5906"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5906"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74970"
FT                   /db_xref="GOA:B2JVJ3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ3"
FT                   /protein_id="ACC74970.1"
FT                   /translation="MEIDFEAITEYQRYKLMASLIVPRPIALVTTLGADGTVNAAPFSM
FT                   FNMLGEEPPIVMLSVNRLADGALKDTAVNIAREREFVVHLADEPIAQKMHRCGERFAPN
FT                   VSELEEVGFTALVSTRVKPPRIAEAPVAFECELWETLQTSSRHIFIGKVLMLHARDELI
FT                   DPESWRVRLQHYFPVGRFGASDYVTTRDRFEL"
FT   gene            427634..428050
FT                   /locus_tag="Bphy_5907"
FT   CDS_pept        427634..428050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5907"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5907"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74971"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ4"
FT                   /protein_id="ACC74971.1"
FT                   /translation="MLKLLIPVLGREGALEAARHAAFLFAEKCVAQVELIEVLEEVGEG
FT                   RAVAFQSRAALRRSEKLSMRDALTRTCAVLDDAGVPYRWKRVFGAPEKTIAAYAAAHDS
FT                   DLVILDASGLGFFRRWGILARLWRLSPKPITMLH"
FT   gene            complement(428266..428619)
FT                   /locus_tag="Bphy_5908"
FT   CDS_pept        complement(428266..428619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5908"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5908"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74972"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ5"
FT                   /protein_id="ACC74972.1"
FT                   /translation="MKRSDTRRLNTDVRLERDATAALALYDGSIRHGHRHIALLRYMDA
FT                   RDLAAPLTQRHHEYAQKVASSLSATDVERICGQAIDRSRQRQRAAAKKEADDACVNIDA
FT                   AASLSRRNAGEVN"
FT   gene            428888..429316
FT                   /locus_tag="Bphy_5909"
FT   CDS_pept        428888..429316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5909"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5909"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74973"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ6"
FT                   /protein_id="ACC74973.1"
FT                   /translation="MRSRHFLTYQQIFDHAVEHLFGQGRAALLPRGGGAYRGYCGGCPV
FT                   GSFIRPRDYMTAMEGVPVRYIGKEASDVIPAYMDVGIGALRKALLRANINVYDPVTIEL
FT                   LSCLQNVHDVFGKWEWRERLHSIARQFALSADLVKAAA"
FT   gene            429326..429619
FT                   /locus_tag="Bphy_5910"
FT   CDS_pept        429326..429619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5910"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5910"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74974"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ7"
FT                   /protein_id="ACC74974.1"
FT                   /translation="MLAFKAIQERVCEVTIMNSHQQTLRQLIEKWLSPTPATPVRVTRF
FT                   SRTRDSNRRYVCVEVARSACPVAIVFFRHGDGVWRVFPPDRERPAMACPQAA"
FT   gene            429703..430362
FT                   /locus_tag="Bphy_5911"
FT   CDS_pept        429703..430362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5911"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: tbd:Tbd_1399 two
FT                   component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5911"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74975"
FT                   /db_xref="GOA:B2JVJ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ8"
FT                   /protein_id="ACC74975.1"
FT                   /translation="MEPVNTVLLIDDHALFRKGVAQLIQMNPAFRVVGEASSGRVGVDL
FT                   AVRLKPDVVLIDLNMPDMNGIETLEMMRQHGVDARFLMLTVSDNERDVVAALRAGASGY
FT                   LLKDMEPEELCLNLQKALQGTAVLSEAVTGKLFHALSAGQPLPANQSNLSVREQEVLDY
FT                   LVEGMCNKEIARKLDISVGTVKVHVKHLLHKLDLHSRVEAVVWHHEQAARRNPPGA"
FT   gene            430497..431138
FT                   /locus_tag="Bphy_5912"
FT   CDS_pept        430497..431138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5912"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: rxy:Rxyl_2505
FT                   transcriptional regulator, XRE family with cupin sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5912"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74976"
FT                   /db_xref="GOA:B2JVJ9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVJ9"
FT                   /protein_id="ACC74976.1"
FT                   /translation="MKSEIEPDPTTQMEDTGDGRSIESFLGKVVKEHRTNQGLTIADLA
FT                   EQSGLSRSMVSKIENGQVSTSLDSIVSLARALGISISALFKNFEHREGNAQHVKAGKGM
FT                   EVVRRGTTKGHTYHLLAYDQGPVKLFEPFLITMDDEAEVFPTFEHPGTEFIYMLQGKME
FT                   YRHGNRSYLLQPGDALTFRGSVAHGPERLIKLPIRFITVIMYGQSPDLDT"
FT   gene            431463..432353
FT                   /locus_tag="Bphy_5913"
FT   CDS_pept        431463..432353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5913"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: azo:azo3742 Official Name
FT                   formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5913"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74977"
FT                   /db_xref="GOA:B2JVK0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK0"
FT                   /protein_id="ACC74977.1"
FT                   /translation="MIPLRIDYTMSSNTHRFTLTLSCPDRIGIVSAVSTFLAEHRGWII
FT                   EATHHADEVEKRFFMRHEIVAESLPFGIGGFRERFAHIAKEFAMDWKISDNSVKKRVVI
FT                   LVSKLEHCLYDLLARWKAGELDIEIPCVISNHETWRSFVEWHGIPFHCVPVTPDNKAQA
FT                   YDEVQRLFEDAHADTMVLARYMQVLSPKLCADYPGRIINIHHSFLPSFVGAKPYHQAYS
FT                   RGVKLTGATCHYVTEELDQGPIIEQDVIRVSHSDRPDDLVRLGRDIEKTVLARGLRYHI
FT                   EDRVLIHGNKTIVLR"
FT   gene            432425..433666
FT                   /locus_tag="Bphy_5914"
FT   CDS_pept        432425..433666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5914"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mfa:Mfla_0452 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5914"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74978"
FT                   /db_xref="GOA:B2JVK1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK1"
FT                   /protein_id="ACC74978.1"
FT                   /translation="MPWRLVRFALSKKHPEPRMFTRHDTLRRSYDVVIIGAGGHGLASA
FT                   YYLAKEHGIKNVAVLEKGYIGGGNTGRNTTIIRSNYLTPEGVQFYDESVKLWQDLSQDF
FT                   DLNLFYSTRGHYTLAHTDSAMRTMRWRAEVNKHYGVDSEVVGPNEVKKAAPMIDISCGG
FT                   VAPIMGALYHAPGAVARHDAVAWGYGRGADQRGVEIHQQTEVLGIDVAGGKVKGVKTSR
FT                   GYISTGKVLCAVAGSTPRVTDMVGVRTPIFIHPLQAMVSEPLKPWLDPILVSGSLHVYI
FT                   SQSARGELVMGASLDPYELHSTRSTLDFVEGLTAHMLEMFPFLSQAKVMRQWAGMADMT
FT                   PDFAPIMGKTPVEGFYLDAGWGTWGFKATPVCGKTMSHTVVNDAAHPLIEGFSLDRFRR
FT                   FSLTGEKGAASVGH"
FT   gene            433681..433938
FT                   /locus_tag="Bphy_5915"
FT   CDS_pept        433681..433938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5915"
FT                   /product="Sarcosine oxidase delta subunit heterotetrameric"
FT                   /note="PFAM: Sarcosine oxidase delta subunit
FT                   heterotetrameric; KEGG: pst:PSPTO_2451 sarcosine oxidase,
FT                   delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5915"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74979"
FT                   /db_xref="GOA:B2JVK2"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK2"
FT                   /protein_id="ACC74979.1"
FT                   /translation="MKIMTCPVNGARPVSEFAYWGEVRPMPDPSTASDAQWADYVFCRN
FT                   GAAGVKQEWWCHTPSNTWFIAERDTAKDLVLRTWLASGEA"
FT   gene            433939..436905
FT                   /locus_tag="Bphy_5916"
FT   CDS_pept        433939..436905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5916"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; FAD dependent
FT                   oxidoreductase; glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   rxy:Rxyl_2496 aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5916"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74980"
FT                   /db_xref="GOA:B2JVK3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK3"
FT                   /protein_id="ACC74980.1"
FT                   /translation="MRLTPHRGEWIERNTRIEFSYEGRPYSGLAGDTITSALWASDVRV
FT                   LGRSFKYHRPRGVLSLANHDVNVMLQDGQRLNVRADVTALTPGGKWHSVNTFGGVEADR
FT                   ARIVGKLSAFLPVGFYYKAFYSKRWFPRWERMFRAMTGLGTVDFNAPHIRTPKRYGFCD
FT                   VLVIGAGPSGLSAALAAAQAGADVVVVDENARVGGSGGYQLGGDEQRFDVSRTLETHVL
FT                   GHPRIRVMTNTLAAAYYADLWVPLVDSTRITKMRAKAVIVASGAFEQPAVFRNNDLPGV
FT                   MLASAAQRLAYRYAVAPGKRAVVLAANADGYRAALDMLARGIEVVAVVDLRASHASGDI
FT                   ERELRTKGVDVMASSCVVEAVADKTGGRLTGVRVGAFSTQSSLRDSTANTRLIECDTLL
FT                   MSVGWAPAANLLYQAGTKMQFDHAVEQFVPEQLPPGVFACGRVNGVYTLGHKLQDGERA
FT                   GLQAAAHCGFGDGRTAGAMQARIAEHESPSHPWPIVGHASGKNFVDFDEDLQLKDFENA
FT                   VQEGFDNIELLKRFSTNGMGPSQGKHSNMNGLRVLARLTGKEPQQVGTTTARPFFHPVP
FT                   MSHLAGRGFNPERRTPLHAQHQLLNAVWMAAGVWQRPEYYAVAGKARAACIEEEALAVR
FT                   NGVGIIDVGTLGKIEVRGPQAAEFLERVYVSKYAGLKAGMTRYAVMCDESGVVIDDGVI
FT                   ARLADDHFYFTTTTSGAAAIYRELSRLNTIWQLDCGIVNVTGAFAAVNLAGPASRAVLS
FT                   KLVDLDLSSAAFPYLGVRVTGVTLGQNRVPARLMRVGFVGEWGYEIHIPADYGAALWRA
FT                   LLETGNPYGVRPFGVEAQRLLRLEKGHVIVSQDTDGLTTPRDAGMAWAVKMDKPFFVGK
FT                   RSLQIIDQTPAKQCLVGFALDAGVRDSSLRECHLVIERGEIAGRVTSVAWSATLQKTIG
FT                   LAFVRPSQAEPGTRITFRANGGRMVSATVVPTPFYDPESERQKDAVTITAAAPRKETA"
FT   gene            436902..437561
FT                   /locus_tag="Bphy_5917"
FT   CDS_pept        436902..437561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5917"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5917"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74981"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK4"
FT                   /protein_id="ACC74981.1"
FT                   /translation="MNAPLRMSPMCDAWKSPGLRSSVREGMRVEEQVDAADTVRAATLG
FT                   IADVSFLPRTGFKGKGAAAWLQAQEIPVPEQPNSWAPLAGGGVVLRLGLSEYLIEDGLT
FT                   QGSSARMAHLDTPVHVYPVLHQDVALVLCGDAVHELLLQTCNVNFAALDPAGRPVVLTS
FT                   MAGVAVTVMPGVRAGRPYYRIWADGTYGLYLWESLAGIARELGGGPVGVAAITEID"
FT   gene            437657..438985
FT                   /locus_tag="Bphy_5918"
FT   CDS_pept        437657..438985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5918"
FT                   /product="glutamine synthetase, type III"
FT                   /note="TIGRFAM: glutamine synthetase, type III; PFAM:
FT                   glutamine synthetase catalytic region; KEGG: reh:H16_B2191
FT                   glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5918"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74982"
FT                   /db_xref="GOA:B2JVK5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017536"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK5"
FT                   /protein_id="ACC74982.1"
FT                   /translation="MTPEDARKFLKDNEVKYILAQFVDIHGVAKTKSVPAAHLDSILTA
FT                   GAGFAGFAVWGLGIDPQGPDFMAVGDINTLQLVPWQPGYARIVCDGHVKREPWPFESRV
FT                   TLKKQVSRLEDRGWILNTGLEPEFSLLRKGADGGIVPCDHTDALPKPCYDYKGLSRSRV
FT                   FLEKLTDALIKAGIDVYQIDHEDANGQFEINYTYTDCLKSCDHYVFFKMAAAEIANELG
FT                   LVCSFMPKPFANRPGNGMHMHMSISDGKKNLFADDHDETGLGLSKLAYHWTAGILKHAA
FT                   ALTAICAPTVNSYKRLVVGRSLTGATWAPAYVSYGDNNRSSMVRIPGGRIELRLPDAAC
FT                   NAYLATAAVIAAGLDGVENRLEPGKPCNANLYEMSPEQLKENGISILPQNLEAALCALE
FT                   RDEVMLEALGPAGGEFLRLKHMEWIEYMRHVSDWEQKTYLEFF"
FT   gene            439036..439944
FT                   /locus_tag="Bphy_5919"
FT   CDS_pept        439036..439944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5919"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   azo:azo3011 amido phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5919"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74983"
FT                   /db_xref="GOA:B2JVK6"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK6"
FT                   /protein_id="ACC74983.1"
FT                   /translation="MCGIVGLLVKKPALRERLGELMVPMLLGMTERGPDSAGLAVFTEP
FT                   VADGVRKISLYSGLTEEGADFNWQGLVHELNQHLGAKASVQVRDNHAVLSVAIDAETVK
FT                   HWIRETHPGLHVLSTGRMIDLYKDTGTPGQVADRYAFSGLTGTHLVGHTRMATESAVTP
FT                   DRAHPFTAGEDFCLVHNGSLSNPNGVRRMLEPHGIRFDTDNDTEAACRFLEYRLREGDD
FT                   LEVALQKGFEQLDGFYTFLMGTPDKLALIRDPFACKPAVVAETDDLVAIASEFRSLAHL
FT                   PDIKHARVFEPAPEEMYVWTV"
FT   gene            439932..440630
FT                   /locus_tag="Bphy_5920"
FT   CDS_pept        439932..440630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5920"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: reh:H16_B2193 glutamine amidotransferases
FT                   class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5920"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74984"
FT                   /db_xref="GOA:B2JVK7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK7"
FT                   /protein_id="ACC74984.1"
FT                   /translation="MDSVNFDLASASVTDVNGFLHREAAKAGTRRVLISNPDGAHNIAV
FT                   GIDCPIEVEIDGHAGYYAAGMNKEAKVTISGSASTGVAENMMSGRVHVKGFASNAAGAS
FT                   AHGGLLVIEGDAGLRCGISLKGADIVVKGSVGSFSAFMAQAGRIVICGDAGDALGDSLY
FT                   EAVIYVRGKVKSLGADAREEPMQPADVEAVAQLLRAAGPAFAEIDPKEFRRVASARSLY
FT                   HWNADANQEY"
FT   gene            440646..442013
FT                   /locus_tag="Bphy_5921"
FT   CDS_pept        440646..442013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5921"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; ferredoxin-dependent glutamate synthase;
FT                   KEGG: rxy:Rxyl_2501 ferredoxin-dependent glutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5921"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74985"
FT                   /db_xref="GOA:B2JVK8"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK8"
FT                   /protein_id="ACC74985.1"
FT                   /translation="MEIKPVHMKHIATEESWGFDRKTIDYIQNAAAHGLYEIRGLGAKR
FT                   RVPHFDDLLFLGASLSRYPLEGYREKCVTKTVLGTRFAKKPIELAIPITVAGMSFGALS
FT                   ANVKESLGRAATELGTSTTTGDGGMTQEERRSSKTLVYQCLPSRYGFNPDDVRKADAIE
FT                   VVIGQGAKPGGGGMLLGQKISPRVAKMRTLPEGIDQRSASRHPDWTGPDDLQIKILELR
FT                   EMTDWQTPIYVKVGATRTFNDVKLAVHAGADVIVVDGMQGGTAATQTCFIENVGIPTLA
FT                   ALRQAVDALEDLNMKGQVQLIISGGIRSGADVAKALAMGADAVAIGQGVLVSLGCNSGS
FT                   YIENGQHVSALDDYARLGTAPGFCHHCHTGKCPVGITTQDAVLQERLKPEVGAQRLKNY
FT                   LKTVNMELTTIARACGKQNVHHLEPEDLVALTVEAAAMARVPLAGTNWIPGLNGAR"
FT   gene            442010..442909
FT                   /locus_tag="Bphy_5922"
FT   CDS_pept        442010..442909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5922"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: nmu:Nmul_A0357 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5922"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74986"
FT                   /db_xref="GOA:B2JVK9"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVK9"
FT                   /protein_id="ACC74986.1"
FT                   /translation="MTAQLIDGRHLARRLRARFRERVAALSARGVVPGLAVVLVGDNPA
FT                   SELYVANKVKACADCGVRSFMHRFHMDCRETELLDRIAALNVERGTHGILVQLPLPPQI
FT                   NARRVLESIVVDKDVDGFHLYNVGALVVGNSIFPPCTPYGVQLLLETTGIDVAGKNVVV
FT                   VGASNIVGKPMALMLLQREATVTVCHVKTRDLAQHTIHADILVVAAGKPGLIKAEMVKE
FT                   GAIVIDVGINRMADGRIVGDVDFEPVRERASWITPVPGGVGPMTVTMLIENTLRSAERF
FT                   ADGEAFHPPQPFWQVPAG"
FT   gene            442937..444388
FT                   /locus_tag="Bphy_5923"
FT   CDS_pept        442937..444388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5923"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   sme:SMb21414 putative amino acid decarboxylase,
FT                   pyridoxal-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5923"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74987"
FT                   /db_xref="GOA:B2JVL0"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL0"
FT                   /protein_id="ACC74987.1"
FT                   /translation="MADDTRNALETAAQLALAFHDARGSRPTGPVASFGELHAAFGGPT
FT                   PEQGEPASAVIARLAAIAQPGLLGTAGPRFFGWVAGGSHPAGVAADWLTSVWGQNAATY
FT                   HGAPAAAVAEQVVAQWLLDLLDLPRSCSVGFTTGATMSNFVCLAAARDAVLRRAGWDVE
FT                   ADGLCGAPRISVYVGEGVHASVRAALRYLGIGERSVIEVAADEAGRMQPSALRDAVARH
FT                   DGPLIVIAQAGHMMTGAFDSVGEIAACAHEHGGWVHVDAAFGLWARACPERMHLAAGIE
FT                   HADSWAADAHKWLQAPYDTGCAFVRDADAHRRAMSIRASYLPQAEDGARDPAHYTPELS
FT                   RRARGFSLWALVRTLGREGIAAMIARHCALACRIARRLARGPGVALLNEVELNQLIVRF
FT                   GSAYDGSLADELTLRTVQRIQAQGVCDVREAVWQGRTVMRLSVISWATTERDADCAADA
FT                   ILSVWDQVHGEYLCQEREAMALALG"
FT   gene            complement(444466..445443)
FT                   /locus_tag="Bphy_5924"
FT   CDS_pept        complement(444466..445443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5924"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: gbe:GbCGDNIH1_0055
FT                   malyl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5924"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74988"
FT                   /db_xref="GOA:B2JVL1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL1"
FT                   /protein_id="ACC74988.1"
FT                   /translation="MSFTVIEQAKARLHRSELAVPGSNTAMFEKAARSAADIVFLDCED
FT                   AVAPDDKEQARKNIVEGLNEIDWGTKTMMVRINGLDTHYMYRDVVDIVEACPRLDMILI
FT                   PKVGVAADVYAVDMLVTQIEAARRRTKKIGFEVLIETALGMANVERIAQSSRRLEAMSF
FT                   GVADYAASTRARTTVIGGVNRDYGVLTDKNERGERDYFWADQWHAAQTRMMVACRAYGL
FT                   RPIDGPFGDFSDPDGYDAAARRAAVLGYEGKWAIHPSQIELANRVFTPAEAEVTKARRI
FT                   MDAMAQAAKEGKGAVSLDGRLIDAASIRMAEALLATADAIGNNR"
FT   gene            complement(445490..448330)
FT                   /locus_tag="Bphy_5925"
FT   CDS_pept        complement(445490..448330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5925"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   mpt:Mpe_A3255 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5925"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74989"
FT                   /db_xref="GOA:B2JVL2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL2"
FT                   /protein_id="ACC74989.1"
FT                   /translation="MRPLHAGSHTAVDGLHKLAAASASLPALSADEYEHAVIELLSELL
FT                   RDIARARQPEVERTLRGEAAHESMSELMRERMDDRTARVVLRRMLQAQGMWFQLLSIAE
FT                   QSTAMRRRREIEIEGGYDRLPDSFARVIAEVAQAGVPASEVRDVLGHMKVRPVLTAHPT
FT                   EAKRVTVLEIHRRIYRRLMELESPRWTPRERHTLVLALRNDIELLWMSGELRLEKPTVA
FT                   QEVAWGLHFFGETLFEAVPLLFDKLESALERHYPGERFDMPRFFQFGSWIGGDRDGNPF
FT                   VDDSVTRATLHENRLACLKRYRLRLVELAQTLSITSEALPVPDSFHEALARALMASGEP
FT                   ASIASRNPGELFRQYLTCILRRLDASLANASRPGDGAPVQGGYTSADELAADLLVIEQT
FT                   LLATESGQLARMLIRPLRHEVETFRFSTVQLDLRQNTTVIEQALHGLWRATCGTSGAPP
FT                   ASDSPEWKAWLLGELAQPSDSEAERERRFQSLPPDEAQTLQIFRTVRAMRQQVDRNAFG
FT                   AFILSMTHRASDVLGVYLLAKEAGLFSDAAGTESCTLPVVPLLETIDDLRRAPDILREL
FT                   LAVPMVRRSIRAQGGVQEIMIGYSDSNKDGGFFASNWELSKAQTKIRRLGDELGVAIAF
FT                   FHGRGGSVSRGGIAAGRAIAALPAGSVNGRFRVTEQGEVVSFKYANRGTAQYHVELLAS
FT                   SVLEHTLKSEREDALQPKGEFDEAMEALSGASRAAYAKFIEQPGMLAYFQAASPLEELS
FT                   MLNMGSRPARRFGAKSLQDLRAIPWVFAWAQNRHALTGWYGVGSAIDGFLCVRQERGLD
FT                   LLRRMFQESRLFRLVIDEVEKTLAQVNLEIAREYANLVPDEQIRDTIFTQIEAEYRLTL
FT                   KMVQAVTGSPGPGTRFPKFSARLQRRLPAIDLISRQQIELLRLYRSAQTERQRRAYQVP
FT                   LLLSINCIASGFGATG"
FT   gene            complement(448380..449285)
FT                   /locus_tag="Bphy_5926"
FT   CDS_pept        complement(448380..449285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5926"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: mpt:Mpe_A3256 succinyl-CoA
FT                   synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5926"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74990"
FT                   /db_xref="GOA:B2JVL3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL3"
FT                   /protein_id="ACC74990.1"
FT                   /translation="MSILIDETTRVIVQGFTGDKASFHAKEMIAYGTNVVGGVTPGKGG
FT                   KHHLERPVFDTVKDAARETGATASLVFVPPPYCADAIMEAADAGLKLVCVITDGIPAQD
FT                   MMRVKRYLLRYPKEARTMVVGPNCAGIISAGRAMLGIMPGHIYRRGNIGIVSRSGTLGY
FT                   EAAAQLNALGLGVTTSVGIGGDPINGSSFLDHLKLFEQDPDTEAVVMIGEIGGPQEAEA
FT                   ARWVSEHMTKPVVGYVAGLTAPKGRRMGHAGAIISAAGDSAAEKAQIMQSYGLSVAPSA
FT                   SELGATVASVLESHVARRVA"
FT   gene            complement(449297..450484)
FT                   /locus_tag="Bphy_5927"
FT   CDS_pept        complement(449297..450484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5927"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: mpt:Mpe_A3257 succinate--CoA ligase
FT                   (ADP-forming); TIGRFAM: succinyl-CoA synthetase, beta
FT                   subunit; PFAM: ATP-citrate lyase/succinyl-CoA ligase;
FT                   ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5927"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74991"
FT                   /db_xref="GOA:B2JVL4"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL4"
FT                   /protein_id="ACC74991.1"
FT                   /translation="MDIHEYQAKDLLAGFGVPIQRGAVAYTPDQAVYCATELGGWHWAV
FT                   KAQIHSGARGKAGGIKLCETYHDVHEAATSLFGKHLVTTQTGPEGKVVERVYVEVAEKF
FT                   DREIYLGIVLDRKAERVRVIASAQGGMDIEDIVHTNPEAVHQIVVEPAVGLQPFQAREI
FT                   AFGLGLSIKQVSRAVSTIMGAYRAFRDLDATMVEINPLVVTTDDRVIALDAKISFDDNG
FT                   LFRHPHVAEMRDAAQEDPREAEAAQFGLNYVGLDGDIGCIINGAGLAMATMDTIKYAGG
FT                   EPANFLDVGGGASPERVAAAFRLVLSDQNVSAVLVNIFAGINRCDWVAEGVVQAARGLR
FT                   VPLVVRLAGTNVEEGRRIINESGLPIIAAESLLEAAQKAVEASKAHRARLAGNHR"
FT   gene            complement(450534..451490)
FT                   /locus_tag="Bphy_5928"
FT   CDS_pept        complement(450534..451490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5928"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: mpt:Mpe_A3260 putative
FT                   2-hydroxyacid dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5928"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74992"
FT                   /db_xref="GOA:B2JVL5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL5"
FT                   /protein_id="ACC74992.1"
FT                   /translation="MQHEIVFLDRSTLNADVRRPAFDHHWVQYASTSAHEVEQRLDGAT
FT                   IAITNKVPLRANVLDRHPSIRMIAVAATGYDCVDTAYCRERGIAVANIRGYATHTVPEH
FT                   TFALMLALRRNLLAYRSDVQRGRWQQARQFCFFDHPISDLHGATLGIIGGGALGQGTAQ
FT                   IARGFGMRVIFAEHDSQRTRVPAADYVPLDTLLRTSDVISLHAPLTPATRNLIGLDQLR
FT                   MMKPSCLLINTARGGLVCEASLAAALKEGLIAGAGFDVLSQEPPVAGNPLLELDLPNFI
FT                   LTPHVAWASNDAMQSLADQLIENIEAFARGEPRNLVM"
FT   gene            complement(451558..452823)
FT                   /locus_tag="Bphy_5929"
FT   CDS_pept        complement(451558..452823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5929"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /note="PFAM: aminotransferase class V; KEGG: mpt:Mpe_A3261
FT                   serine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5929"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74993"
FT                   /db_xref="GOA:B2JVL6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL6"
FT                   /protein_id="ACC74993.1"
FT                   /translation="MSNTSGSRIAGRNILAVPGPTNVPDAVLRAMVVSMEDHRSTKFPE
FT                   LAHGLLSDLKKIYRTAEGQPFIFPSSGTGAWEAALTNTLSPGDRVLVPRFGQFSHLWAD
FT                   MAQRLGFDVEILDVDWGEGVPVERIAEILKADGQHTIKGILACHNETATGVTSDIGALR
FT                   RAMDDARHPALLFVDGVSSIGCIDFRMDEWGVDLAVTGSQKGLMLPAGLGILCVSQKAL
FT                   KAISHAKSRRCYFDLADMVRTNATGYFPYTPALSLLYGLRAALDLLFEEGLENVFARHH
FT                   YLAAGVRAAVTEGWGLELCAKAPRWHSDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAG
FT                   LSKVAGKVFRIGHLGDLNELMLMSAIAGAEMAMLDAGIDVRPGSGVGAAGQYWRTHTPG
FT                   AQADHASVQPAANPAPRRVAAA"
FT   gene            complement(452870..454186)
FT                   /locus_tag="Bphy_5930"
FT   CDS_pept        complement(452870..454186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5930"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   glycine hydroxymethyltransferase; KEGG: nmu:Nmul_A0004
FT                   glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5930"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74994"
FT                   /db_xref="GOA:B2JVL7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL7"
FT                   /protein_id="ACC74994.1"
FT                   /translation="MFSYKNTLAVTDPELQHAIAAETQRQQDHIELIASENYTSPAVLE
FT                   AQGSQLTNKYAEGYPGKRYYGGCEHVDVVEQLAIDRAKQLFNADHANVQPHSGSQANQA
FT                   VYLSALTPGDTILGMSLAHGGHLTHGASVNVSGKLFNAVSYGLDAETEEIDYDTAQRLA
FT                   EQHRPRMIVAGASAYSLVIDWQRFRAIADSVGATLLVDMAHYAGLVAAGLYPSPVGIAD
FT                   YVTTTTHKTLRGPRGGLILSRAETAKAIDSTIFPGIQGGPLMHVIAGKAAALREAMTDE
FT                   FRQYQQQVLVNARTIAQTLQQRGLRIVSGRTDSHVFLVDLRAKNVTGKEAEAALGRAFI
FT                   TVNKNAIPNDPQKPFVTSGVRIGSPAITTRGLREAEAEQLAHLIADVLDAPGNDLVIRR
FT                   TADAVLALTARFPVYRDAPDALRDDAPRDGRAAAGDGAH"
FT   gene            454452..455375
FT                   /locus_tag="Bphy_5931"
FT   CDS_pept        454452..455375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5931"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: nmu:Nmul_A0687 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5931"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74995"
FT                   /db_xref="GOA:B2JVL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL8"
FT                   /protein_id="ACC74995.1"
FT                   /translation="MLHLTLRQLRVFEASARHLSFSRAAQELHLTQPGVSSQLKQLETS
FT                   IGMPLFEQVGRRVFLTAAGKELYSHTRLLQQQLSVLETSLDQLRDMKQGKLKVSLVSGT
FT                   ANPLALQLIAKFTRAFPGVRVSLSVGNRECVLNELASNETDLAIMGLPPEGQGLAAVRV
FT                   ARNPLVMIAPPDHALVRERRIALDMLERETFLVRESGSGTRRAMERFFAEHRVSFRPGM
FT                   EVSSNEAIKWAVQAGMGLSVVPLATIMAELETLRLKVLDVEHLPIVRYLYVVHRESKQL
FT                   STAASAFRDSLVSGAHEAGERVAMEV"
FT   gene            complement(455383..456207)
FT                   /locus_tag="Bphy_5932"
FT   CDS_pept        complement(455383..456207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5932"
FT                   /product="formylmethanofuran dehydrogenase subunit C"
FT                   /EC_number="1.2.7.12"
FT                   /note="KEGG: mpt:Mpe_A2626 formylmethanofuran
FT                   dehydrogenase; TIGRFAM: formylmethanofuran dehydrogenase
FT                   subunit C; PFAM: glutamate synthase alpha subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5932"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74996"
FT                   /db_xref="GOA:B2JVL9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR017550"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVL9"
FT                   /protein_id="ACC74996.1"
FT                   /translation="MKRITLRLKQAPALRIDARELLPARLAELATRDICAIALWHGAER
FT                   ISVGELFAVEVGEGTRDAPQLVFEGDMQRFDRLGMRMHAGHILVDGDAGDFVGLQMSAG
FT                   TVLVEGHCGSFAACELTGGRIEIRGNAGDFAGAALPGDMDGMRGGTLVVHGDAGARLGD
FT                   RMRRGTIAVFGSAGAFVASRMVAGTIAITGKVGEHPAYGMRRGSLVLLDPAWPTTPRFA
FT                   ENSSDIDVFWRLLVPTLAREGGPFAMLSRAHAPQRLRGDVSVQGKGEILLPR"
FT   gene            complement(456204..457178)
FT                   /locus_tag="Bphy_5933"
FT   CDS_pept        complement(456204..457178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5933"
FT                   /product="formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /note="KEGG: mpt:Mpe_A2625
FT                   formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase; TIGRFAM:
FT                   formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase; PFAM: formylmethanofuran:
FT                   tetrahydromethanopterin formyltransferase (Ftr)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5933"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74997"
FT                   /db_xref="GOA:B2JVM0"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM0"
FT                   /protein_id="ACC74997.1"
FT                   /translation="MSVTTSPRSVRGVSIDDTFAEAFPMKATRLIVTARDATWARNAAL
FT                   AATGFATSVIACGCEAGIERELSPDETPDGRPGVALLLFSMSGKELAKQVERRVGQCVL
FT                   TCPTTAVFSGIENGEPIALGRNLRFFGDGWQIAKMIDGKRFWRVPVMDGEFVAEETTSV
FT                   LKGVGGGNLLFLARDTDAALRAAQTAVRAMRGVPNVIMPFPGGVVRSGSKVGSKYPALP
FT                   ASTNDAFCPGLAELALRTELHGDVRSVLEIVIDGLSEADVAEAMRVGIDAATGGDAGVA
FT                   HGLVRISAGNYGGKLGPFHFHLHQLCDQLRDQLRDQLTEPEGR"
FT   gene            complement(457178..458866)
FT                   /locus_tag="Bphy_5934"
FT   CDS_pept        complement(457178..458866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5934"
FT                   /product="formylmethanofuran dehydrogenase subunit A"
FT                   /note="TIGRFAM: formylmethanofuran dehydrogenase subunit A;
FT                   PFAM: Amidohydrolase 3; KEGG: mpt:Mpe_A2624
FT                   formylmethanofurane dehydrogenase, A subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5934"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74998"
FT                   /db_xref="GOA:B2JVM1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012027"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM1"
FT                   /protein_id="ACC74998.1"
FT                   /translation="MSTFRLRGGRVYDPASRIDGQIMDICVRDGKIVDLPEQEPVDYDY
FT                   DASGMIVMAGGIDMHSHIGGGKVNLARLLMPEDHRNRRAPENPLELASCGDCTPGTFAT
FT                   GYRYAEMGYTAAFEPAMIASNARHTHLEMGDTPIIDHGAYVMLGNDDLFLRMLAEHTDY
FT                   ERLRDYVGWSINASRALGVKVVNPGGISAFKFNQRSLDVDERHTHYGITPRNVLHVLAR
FT                   ALTDLGVPHPLHIHASNLGVPGNIDSTLATIDALEGLPGHLTHIQFHSYGDDGPMKFSS
FT                   AAHRVADAVNANPNISIDVGQIMFGQTVTASGDTMKQVKQAAFASPRKWIAGDIECDAG
FT                   CGVVPFRYRETSYVNALQWTIGLELFLLVTNPWQITLTTDHPNGGPFTSYPHLIRLLMD
FT                   KSFRDEQLAKLHPDVAAQSPLASITRELDLNEIAILTRGAPARLLGLADRGRLDAGAAA
FT                   DIAVYREHADREAMFRTPAYVFKDGELVAREGRIVATPAGGTHYVEPEFDRSIEKIVQD
FT                   HGDAYLATNMRRAPISRDELCLCGNGGRLLPAACGIHRQPRAESA"
FT   gene            complement(458863..460203)
FT                   /locus_tag="Bphy_5935"
FT   CDS_pept        complement(458863..460203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5935"
FT                   /product="formylmethanofuran dehydrogenase"
FT                   /note="KEGG: mpt:Mpe_A2623 formylmethanofuran
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5935"
FT                   /db_xref="EnsemblGenomes-Tr:ACC74999"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM2"
FT                   /protein_id="ACC74999.1"
FT                   /translation="MTSNRSPTFWTCPFCPLLCDRLSIATDTTLTLNGTDCPRAKRALA
FT                   QFDTRAARTQPSLDGKALGFDDAAGLAAQWLAQARQPLFAGMATDVAGTRALYRLANAS
FT                   AAIIDHAHGRSLMRSLTAMQDRGAFTTTFSEVRTRSDLIVCFAATPTARYPEFFQRCGI
FT                   GAAPRDASGSAQREVIFVGSDIDADLARDAQPATVLQRAIPLHGDLYETVALLNLHVDQ
FT                   LLQDKPHAGRAPELADLASRMLAARYVTLIWNTADLPGDHAALLVEALDRLTKSINLRT
FT                   RAGYLALGGDDGAATVNQTLTWMSGLPLRTGIHRNGLEHDPHRYDTARLLADHAVDALV
FT                   WVASFGVDLPPPQSGVPTIVLGHPGLAPICSDRQGPTLFIPVSTPGIGSAGHLFRADGG
FT                   IVLPLVPVYEDTLPAVAHVAAQIAQALGASRAGASWAARCASKEPAR"
FT   gene            460395..461447
FT                   /locus_tag="Bphy_5936"
FT   CDS_pept        460395..461447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5936"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   mpt:Mpe_A2621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5936"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75000"
FT                   /db_xref="GOA:B2JVM3"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR024710"
FT                   /db_xref="InterPro:IPR040803"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM3"
FT                   /protein_id="ACC75000.1"
FT                   /translation="MEHECRGTKRDDLHREQAMKRILLYEHLSACGDADGGVSAELRMQ
FT                   GRAMRDAVARDLVRSGHIALTCVAGHDEALDVMEVSQETDWCRAPFAIPPTRFLAAEAR
FT                   RHDAVWVIAPETGGVLSALCEAVDSARWIGCDAATLHIASSKRRTSRHLAQAGIATPRA
FT                   WSQSAPLEVACNASAWVVKPDDGAGAVDTRVYRDYRQAEYVFLRRAMSGESVTLEAWID
FT                   GDALSLSLLCSRGHMQLLGINRQHIRIDDGQLSYDGVTANAIPPSDDKAATCSALAARI
FT                   ARALPGLAGFVGIDLVWHPQRGPVVIEVNPRVTCAYPALSRMLDFNLGASVVAGHVDLG
FT                   DDFEWRRHAA"
FT   gene            461437..462498
FT                   /locus_tag="Bphy_5937"
FT   CDS_pept        461437..462498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5937"
FT                   /product="H4MPT-linked C1 transfer pathway protein"
FT                   /note="TIGRFAM: H4MPT-linked C1 transfer pathway protein;
FT                   PFAM: Hydantoinase/oxoprolinase; KEGG: bxe:Bxe_B2458
FT                   tetrahydromethanopterin biosynthesis protein, putative
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5937"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75001"
FT                   /db_xref="GOA:B2JVM4"
FT                   /db_xref="InterPro:IPR002756"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM4"
FT                   /protein_id="ACC75001.1"
FT                   /translation="MQRDLVIGWDIGGAHVKAARVESGRVCDVMQWVCPLWQGLAHLDA
FT                   VFDAVAQRWPDHGDAEHAVTMSGEMADIFDDRATGVSALANRLAHRFGPRTSFYAGCAG
FT                   WQPYEAVTDRWADVASANWHATAALIAARVPAAVLVDIGSTTTDFIAIREGMLVSRGSD
FT                   DAQRLRSGELVYQGVVRTPLCALAQRIRFGGELHNVMNELFATTADIYRLTRELDPLHD
FT                   QHPAADGGEKDRLGSCRRVARMIGRDAREASMADWECFAREWRKAQLAHLSANLAQVLG
FT                   RVGLGHDVVLVAAGSGAFLADELAAQFGRDVMPFASLVDADDTAARWAQVCAPAVAVAL
FT                   LRADERCAANATV"
FT   gene            462529..463119
FT                   /locus_tag="Bphy_5938"
FT   CDS_pept        462529..463119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5938"
FT                   /product="tetrahydromethanopterin biosynthesis protein,
FT                   putative kinase"
FT                   /note="KEGG: bxe:Bxe_B2457 tetrahydromethanopterin
FT                   biosynthesis protein, putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5938"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75002"
FT                   /db_xref="GOA:B2JVM5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM5"
FT                   /protein_id="ACC75002.1"
FT                   /translation="MWVVKIGGSMSRDPLLEEWLTDLVDFGGGRVVIVPGGGDFAEQAR
FT                   EHQDIWRFDDVAAHNMAVLAMAQCALMMHGISRRLVIAATDAQIRAALHAGRVAVWAPL
FT                   DLLYQEPNRLTSWDVTSDSLAAWLANRLNAERLLIVKSCEIERDRSIDEYAALGIVDRS
FT                   LAGFTHDAPYPVDLLSRTDGARVRDLLLHATTD"
FT   gene            complement(463101..463874)
FT                   /locus_tag="Bphy_5939"
FT   CDS_pept        complement(463101..463874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5939"
FT                   /product="protein of unknown function DUF556"
FT                   /note="PFAM: protein of unknown function DUF556; KEGG:
FT                   bxe:Bxe_B2456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5939"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75003"
FT                   /db_xref="GOA:B2JVM6"
FT                   /db_xref="InterPro:IPR007565"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM6"
FT                   /protein_id="ACC75003.1"
FT                   /translation="MIRMLASVRNLDEARDAARAGADLIDLKEPGAGALGAVSAPRIAH
FT                   IVQSLRAGFPHLPISAAIGDLQPGDDAGLEFRAAQAGRCGVDYVKAGVPADGGSFDVAC
FT                   RTLASMRELQWNMVPVLLVDNGLDLRIVDYASELRFAAVMVDTATKKRGNLFQCVPLAV
FT                   LDRVVQIARSHNVMAGLAGSLLSGHVPLIRALGPDIAGFRTALCDGSRTGRLNAARVHD
FT                   LRARLSYPAHTPGAASPAANDTGFGTVAVGQSVVA"
FT   gene            complement(463871..464464)
FT                   /locus_tag="Bphy_5940"
FT   CDS_pept        complement(463871..464464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5940"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5940"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75004"
FT                   /db_xref="GOA:B2JVM7"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM7"
FT                   /protein_id="ACC75004.1"
FT                   /translation="MIHETVVTTVTPEGKPHIAPMGVRQQGDTFLLMPFLPSATYDNVI
FT                   STGCAVVNFTTDVRVFAGCVTGRRTWPTVAARHVRCVRLADTLAHAELRLASVEYDSQR
FT                   PTLVMECVARCTNAPFTGLNRAQAAVIEGAVLISRLTMLPREKIDAELAYLSIAIGKTA
FT                   GPRELQAWQWLMDAVHAFFARPAEADHVPTEEAL"
FT   gene            complement(464467..465852)
FT                   /locus_tag="Bphy_5941"
FT   CDS_pept        complement(464467..465852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5941"
FT                   /product="dihydropteroate synthase DHPS"
FT                   /note="PFAM: dihydropteroate synthase DHPS; KEGG:
FT                   mpt:Mpe_A2616 pterin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5941"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75005"
FT                   /db_xref="GOA:B2JVM8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM8"
FT                   /protein_id="ACC75005.1"
FT                   /translation="MEHIVFLTGRLAQPALERVLHSLAPAPFSWEIREIGLQVAALMTA
FT                   DMIRRRVAAPIAADRVIVPGRCRGDLDALAAHYGIPVQRGPEELKDLPGWFDCGTRAVD
FT                   LTKHDIAIFAEIVDAPHLSVDAICARAASLAADGADVIDLGCLPATPFPHLADTIHALK
FT                   SQGYKVSVDSMDIKELVRGGRAGADYLLSLTADTLWVLNDIDSTPVLIPREPGDEASLY
FT                   EAIDTMLQQGRTFLADPILDPLPFGLLKSLTRYQRLRERYADAPILMGTGNVTELTEAD
FT                   TSGIHAVLLGIGVELGIAGILTTQVSGHARCAIREADVARRMMYAAREGRTLPKGITRQ
FT                   LMTVHAKHPFPDTPEEIAATAAAIRDPNFRVQVSTDGIHVYNRDGHHLAADAFALWPYL
FT                   RLQADGAHAFYMGVELARAELAWRLGKRYSQDQPLEWGCAIPPDTAGLLAQCAPGATRR
FT                   KEA"
FT   gene            complement(465852..466433)
FT                   /locus_tag="Bphy_5942"
FT   CDS_pept        complement(465852..466433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5942"
FT                   /product="flavoprotein"
FT                   /note="PFAM: flavoprotein; KEGG: bxe:Bxe_B2440 putative
FT                   dihydromethanopterin reductase (AfpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5942"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75006"
FT                   /db_xref="GOA:B2JVM9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVM9"
FT                   /protein_id="ACC75006.1"
FT                   /translation="MTTTHMQHTPRFAWAITGSGHGLVESIDMAATLLPHVDLFLSRAA
FT                   EEVLPLYKIELAQLKARFRVFRDNSASAVPVGMLYDENRYHTVVVAPATSNTVAKCALG
FT                   ISDTLPTNMFAQAGKLGIPGIVFACDTQPVVVTMSPLDWVELRPRRIELDNVERLKRID
FT                   HCRVVCSLDELRAALAARIGEIDVTCCAGA"
FT   gene            466635..467048
FT                   /locus_tag="Bphy_5943"
FT   CDS_pept        466635..467048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5943"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: bxe:Bxe_B2438
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5943"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75007"
FT                   /db_xref="GOA:B2JVN0"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN0"
FT                   /protein_id="ACC75007.1"
FT                   /translation="MNVIDKSVLARPHLPASEMDLIFIEGFEGDTVIGIDPDELTSLQP
FT                   VRIDLWAGVPHSHACDTDLIGDTIDYSKVHAALASLLATHKMQLLEALAETVAQMLIVD
FT                   FGAHWARVSLAKPAKFANVKAVGVTIERTVRWP"
FT   gene            complement(467077..468015)
FT                   /locus_tag="Bphy_5944"
FT   CDS_pept        complement(467077..468015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5944"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /note="PFAM: triphosphoribosyl-dephospho-CoA protein; KEGG:
FT                   bxe:Bxe_B2435 putative triphosphoribosyl-dephospho-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5944"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75008"
FT                   /db_xref="GOA:B2JVN1"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN1"
FT                   /protein_id="ACC75008.1"
FT                   /translation="MSATRADAIADAFAWACALDVLCAKPGNVSFGAPGHRMTADLFIA
FT                   SAQAAGPAVTACGASVGERIERAVSLSMQAAGCNTNLGIVLLCAPLAHAFENLRTAHRA
FT                   PTAHEAHLAVRDTLSRLDLNDACAAYRAIALANPGGLGEAPSQSVGTAPTVDLLSAMTL
FT                   ARDRDSIARQYASGFADVLGYGVIQLRAALGAAPIEVTDQPRLLRAVLKTWLAFLSHWP
FT                   DSHIARKHGIAVARAMTRDARAWHMQTALDFGKLAAWDDALKCEGINPGTTADLTVATL
FT                   FAAACLDPSLLHVRCMDAAVRAASVDIAAAG"
FT   gene            complement(468015..468968)
FT                   /locus_tag="Bphy_5945"
FT   CDS_pept        complement(468015..468968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5945"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: bxe:Bxe_B2434
FT                   tetrahydromethanopterin biosynthesis protein, putative
FT                   glutaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5945"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75009"
FT                   /db_xref="GOA:B2JVN2"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN2"
FT                   /protein_id="ACC75009.1"
FT                   /translation="MTGTPLAVAIMTDETGWHTSRLKRALRERGAQGRCVDLADCRFDT
FT                   THAPHGLAIPGYGRSLPDAVIVRGIAGGTFEQVTVRLGILHALRELGVPVYNDARAIER
FT                   SVDKSMTTFLLHRAGIPTPPTWVGESAPFAQRVLMREATQGHEVVIKPLFGSQGKGVMR
FT                   IGASREGCEPLPALKAYGQLAYLQRFVRPVSEPGYDWRVMVIGGKAVTAMRRISAHWVH
FT                   NVAQGARCEAAELGAPLAALAERASAALGLDYAGVDLMPCDDNAFGATVIEVNGVAAWR
FT                   GLQSVTSFDIAGCIVEDLLSRRMARGLRAAGIQEVA"
FT   gene            complement(468970..469998)
FT                   /locus_tag="Bphy_5946"
FT   CDS_pept        complement(468970..469998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5946"
FT                   /product="methenyltetrahydromethanopterin cyclohydrolase"
FT                   /EC_number="3.5.4.27"
FT                   /note="KEGG: mpt:Mpe_A2609 methenyltetrahydromethanopterin
FT                   cyclohydrolase; TIGRFAM: methenyltetrahydromethanopterin
FT                   cyclohydrolase; PFAM: Methenyltetrahydromethanopterin
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5946"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75010"
FT                   /db_xref="GOA:B2JVN3"
FT                   /db_xref="InterPro:IPR003209"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN3"
FT                   /protein_id="ACC75010.1"
FT                   /translation="MLTSSSLADVSPPPSFLSVNTLVQPLITSLLERHTELGIDVKRDE
FT                   RGVTIVDAGIDTPGSVAAGIAIGEICMGGLGRVALRSAASRNATDEWPTFVDIASAQPA
FT                   LACLASQYAGWSLAASKEETGGKKFFALGSGPARSLACKEPLFDELDYRDVVSTGCLVL
FT                   EVDHTPPAVVIDKILRDCNLQPRHLTLILTPTSSRAGTTQVVARALEVALHKAHELGFA
FT                   LGDIREGSASAPLPPPAPDGIEAMGRTNDAILYGGRVHLSVTGSDDAARDLARRLPSSA
FT                   SKDFGRPFADVFKEYEYDFYKIDPALFAPAEVWVSNLTTGRTFHAGAARFDLLRPLWLD
FT                   EV"
FT   gene            complement(469973..471154)
FT                   /locus_tag="Bphy_5947"
FT   CDS_pept        complement(469973..471154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5947"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   bxe:Bxe_B2432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5947"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75011"
FT                   /db_xref="GOA:B2JVN4"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016677"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN4"
FT                   /protein_id="ACC75011.1"
FT                   /translation="MSPPVVVVAALSARMLAESARRAGWRVIVLDLFGDTDTRRASGMW
FT                   YPIGDAASLSIDPRRVRDALDAASRFPNVIGWIAGSGFEAHRELLDDRHIALVHIGNTR
FT                   EAHEAVRDPMRFFALLDDAGIPHPDTQWQAPADATGWLLKRANGTGGVHIRHAMKTGTD
FT                   GDGYFQRHHAGRSMSALFIADTRRAAIIGFNEQLIVSSCTHPFVYGGALGNIDVPQSLR
FT                   EQIARAVNAIVSRSGLKGLNSLDFIFDGERCFVLEVNARPSATLSLHDRDASPSLLALH
FT                   TRVCAGAPLHADDLDSLGQPLPMRGELIVCADRDRKISPEFVQRALNLGWCHDIPVTGS
FT                   AVAEGAPLCSVSARSAHGTPPATLRAELAARAATLLSIDNTRKSGHADLLLSR"
FT   gene            complement(471162..472037)
FT                   /locus_tag="Bphy_5948"
FT   CDS_pept        complement(471162..472037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5948"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: Methylene-tetrahydromethanopterin
FT                   dehydrogenase; KEGG: mpt:Mpe_A2607 methylene
FT                   tetrahydromethanopterin
FT                   dehydrogenase/methylenetetrahydrofolate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5948"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75012"
FT                   /db_xref="GOA:B2JVN5"
FT                   /db_xref="InterPro:IPR015259"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037089"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN5"
FT                   /protein_id="ACC75012.1"
FT                   /translation="MSPFDVNMAVDAGYQVVVPYTDVDAKLIGPLTQDAIFSRGPKGVA
FT                   HTGIFIGGRDVMLATDMLRLSREAMVPPFEVSVFADPSGSFTTAAALVASVEWQLRHAF
FT                   DTCLDGKRVLVFGGTGPVGLIASVLAAQAGARVSLASSRGLDAARSACERATAHFRAAL
FT                   DGADASSAEALQETLQSVDVVFATAAAGVEVMSAQQVSDAARLLVAADVNAVPPAGIAG
FT                   VGVMDNGKRIGQHGALGIGALAIGNVKYEVQQRLFVQMLAAKQKVYLGFQDAMDMARRV
FT                   VAERSSLAAA"
FT   gene            complement(472105..473124)
FT                   /locus_tag="Bphy_5949"
FT   CDS_pept        complement(472105..473124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5949"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase family"
FT                   /note="TIGRFAM: beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase family; PFAM: GHMP kinase; KEGG: bxe:Bxe_B2430
FT                   beta-ribofuranosylaminobenzene 5'-phosphate synthase
FT                   (MptG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5949"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75013"
FT                   /db_xref="GOA:B2JVN6"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN6"
FT                   /protein_id="ACC75013.1"
FT                   /translation="MSLHGTAESTKHTSIVTVNAPGRLHLGFLDPGASLGRRFGSLGLV
FT                   IDGISTTLDACLSSDDEDHYGAVPSARDELPRVKAHIDTLRNLTGHDTPVDIRLRRTLP
FT                   AHAGLGSGTQLALTVGHAFARLHGLDLSAAQLAPALARGARSGVGIAGFERGGLIVDGG
FT                   PRGPGVLPPVLSRFDFPSTWRVMLVFDDARTGLTGPAERQALAALPPFPQALAAHACHL
FT                   TLMQILPAVAEHEFAPFAQGVSALQDGIGRYFAKSQGGIYTSPDVGRVLDWIGARYCAG
FT                   IGQSSWGPTGFAIMESQEEAEHALRSARDAQEIGPGLRVEIVRGLNAGATVTWASAQH"
FT   gene            complement(473317..474288)
FT                   /locus_tag="Bphy_5950"
FT   CDS_pept        complement(473317..474288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5950"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B2423 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5950"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75014"
FT                   /db_xref="GOA:B2JVN7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN7"
FT                   /protein_id="ACC75014.1"
FT                   /translation="MLNLLRNLTLRQLQIFAAAAQYESFARAAEVLHLTQPAVSMQIKQ
FT                   LEEAIELALFERIGRRIALTEAGATLSHHAKRILGDIKDAENAMRALASADGGTVSIGL
FT                   VSTARYFVPRQISRYAERHPKVDIHFSIAERDTLLRQLQDNAIDLAVMGRPSVELDAHC
FT                   EPLAYNPHVIAASTSHPFVDAARFDLHELRHDTFLMREPASDTAAVANEMFQQHLFKPA
FT                   RTLALDSHETVKQAVVAGMGVSLLPLHTLRLELLAREIAILHVNGTPIDRVWHVVHMNA
FT                   KQLSPACAAFRRFLIEKTGAWLEGQFADLTPTAQVASPFVQT"
FT   gene            474490..475563
FT                   /locus_tag="Bphy_5951"
FT   CDS_pept        474490..475563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5951"
FT                   /product="Fructose-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: dar:Daro_3628
FT                   inositol phosphatase/fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5951"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75015"
FT                   /db_xref="GOA:B2JVN8"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JVN8"
FT                   /protein_id="ACC75015.1"
FT                   /translation="MECAQPALSDFLADHLAPRRAQGPGVVHAADAEGLCAVIDEIAGT
FT                   VKRIAARIAQGAIGGARPAMPGDTALGIAVQDLLIAMCERSAGIAGLVLPGMAAARPTS
FT                   AGRYVLFADSLDGAANAESNVALGTVFSIRHAGAASADGGCVIAGSRQLAAGYALYGPA
FT                   TIFVITVGRGTHGFTLCRERGGFVLTHRSMRVPEQGAELAVNGGNERFWEPPVQRYVSE
FT                   CRDGSAGVRQRDFETRWIASLVADTHRTLMRGGLCLLPRESRCAPRAARQPLLYHAQAL
FT                   AWLVEQAGGLASTGRARLLDAAAGQDTHARTPMFLGTRCEVERIERYHREHERGEDLPF
FT                   TSPLFNERSLFRPEARV"
FT   gene            475578..476450
FT                   /locus_tag="Bphy_5952"
FT   CDS_pept        475578..476450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5952"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   bxe:Bxe_B2449 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5952"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75016"
FT                   /db_xref="GOA:B2JVN9"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVN9"
FT                   /protein_id="ACC75016.1"
FT                   /translation="MSIEHPIVAVTGSSGAGTTTVMNSFQHIFRREKLNAQIVEGDAFH
FT                   RYDRLAMRAAMKEAEQTQRQFSHFGPEANLLEELAALFAEYAATGRGRVRKYLHDEAEA
FT                   AQYGLEPGMFSPWMDLEPPTDLLFYEGLHGGFVGRGIDVAQHADLLVGVVPIINLEWIQ
FT                   KLHRDKTLRGYSQEAVMDTILRRMPDYAHHICPQFSRTHVNFQRVPTVDTSNPFTARDI
FT                   PSADESFVVIRFTNPKGIDFPYLLTMLHDSFMSRPNVIVVPGGKMGLAMQLIFTPMILQ
FT                   MIDRQRRAA"
FT   gene            476498..477271
FT                   /locus_tag="Bphy_5953"
FT   CDS_pept        476498..477271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5953"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   dac:Daci_0743 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5953"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75017"
FT                   /db_xref="GOA:B2JVP0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP0"
FT                   /protein_id="ACC75017.1"
FT                   /translation="MQVMPRNLPIDAVLFDLDGTLLHTSPDIGNALNRALAENGLPLLA
FT                   PGVAQTLIGGGSEILVDRALTLLGVESRPATLDLVLRRYESCYHQICRGEDQLTQPYPG
FT                   AEATLDSLRGMGLKLGLVTNKETRFVDPLMWRFGLQAWFDMVVDGNARLPRKPDPEPLL
FT                   HACEALGVDPAHTLFVGDSVTDALAAQAAGMPMVCVSYGYSSDHPVTELPCMRVIDSIG
FT                   ELTELIGGPRKWHRPTRGDHAAAGMDMQMHSHLAN"
FT   gene            complement(477303..479336)
FT                   /locus_tag="Bphy_5954"
FT   CDS_pept        complement(477303..479336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5954"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B2439 sigma54 specific
FT                   transcriptional regulator with GAF sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5954"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75018"
FT                   /db_xref="GOA:B2JVP1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP1"
FT                   /protein_id="ACC75018.1"
FT                   /translation="MSSCQPLAGQTSQVEAIMRTRPGGFAPSAPVVRSWTRCIEDYRLD
FT                   PDVCLPPPVMTSAELASRREQNASLVDCAKLEMATLYQQLGDSELAVVLTDSDGVILHL
FT                   ASSPEFAGEVEDWGLCAGAVWNEREAGTNGMGTCLAEGEAIAVRQHEHFYQRYTSLTCA
FT                   AVPVFDEGGSIAGVLDVTSRSPLLQQHSLVLVGMSRQMIENRLLDARHTHAFRIQFHSR
FT                   PEFVGTLHAGKLTVDDDGMILGANRSALAQLGFATLDEIAGKPVTDVFNASLAEIVARS
FT                   TRSSFYPVAIYRTHASSRFFVVAQEPRDRAAREAIAPARAEASNHDASSALTRRPARAT
FT                   RTASPLRQGTARVEFGDAQIASQFDLGARVIDRGIAVLVHGETGSGKEVFANALHAASE
FT                   RSNGPFVAVNCASLPEHLIESELFGYRAGAFTGAQREGRRGKILQADGGTLFLDEIGDM
FT                   PLALQARLLRVLEEREVTPLGSESVVKVDFQLVSASHRDLNELVESGQFREDLYYRLNG
FT                   VMLELPPLRARKDKLALIRHLLEKERTPALRLSADVRQILLDSDWPGNIRQLRNVLRTA
FT                   TALCDGDELTTAHLPAWLVQREKNLNRPRAAGASTALSDTDDCADMEEVSNAPLNAILQ
FT                   AEREALLALLDKHRWNVSQVALALGITRNTLYRKMRRVNIKT"
FT   gene            complement(479577..480224)
FT                   /locus_tag="Bphy_5955"
FT   CDS_pept        complement(479577..480224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5955"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: maq:Maqu_3089 two
FT                   component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5955"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75019"
FT                   /db_xref="GOA:B2JVP2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP2"
FT                   /protein_id="ACC75019.1"
FT                   /translation="MVPHTVLLIDDHALFRKGVAQLIQMNPSFEVTGEATSGQDGIEMA
FT                   VRLKPDVVLIDLNMPRMNGIETLEGMRQAGVDARFIMLTVSDNERDVVAALRAGAHGYL
FT                   LKDMDPEDLCVSLQKALKGTAVLSESVTGSLVHALSGGQRIPAAQNDLTARELEVFDYL
FT                   VAGLCNKAIARKLDISVGTVKVHVKHVLRKLDLHSRLEAVLWQQEHGSRSHH"
FT   gene            complement(480443..481393)
FT                   /locus_tag="Bphy_5956"
FT   CDS_pept        complement(480443..481393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5956"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: xau:Xaut_0921 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5956"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75020"
FT                   /db_xref="GOA:B2JVP3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP3"
FT                   /protein_id="ACC75020.1"
FT                   /translation="MSGILVIAEHRQGQLRPVSTELIGAAREAGGERVTVAVLGATPAA
FT                   FVDALKLAGVDEIVTVQTASDAFDPDTYQAVTQALIEARQPSLVLLPHTIDTLGYAAPL
FT                   AVKGNYGFTTDAFGLARDGDDWIATRSGYGQKVNMEIEFPGRATAVVTVRPGAFKSPDA
FT                   SGAPEVSAFDAPAVTPRSAHLSFEEPAASGDVDIVGADFIMSIGRGIGEETNVEQFREL
FT                   ASSLGATLGCSRPIADSGWLPKAHQVGQSGKTAAACKLYIAMGISGSVQHMAGMKHVEN
FT                   IIAVNTDPEASIFSIAKYGIVGDIFDIAEELRGHF"
FT   gene            complement(481393..482193)
FT                   /locus_tag="Bphy_5957"
FT   CDS_pept        complement(481393..482193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5957"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: xau:Xaut_0920 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5957"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75021"
FT                   /db_xref="GOA:B2JVP4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP4"
FT                   /protein_id="ACC75021.1"
FT                   /translation="MKILVTIKQVTSLDEDFELRDDARDVEADFHVFDLNEWDHYALEE
FT                   ALRLKEGANGGGIEVVVVTVGPERADEELRKCLAKGADRAIRIWSDELDEADPVGVARA
FT                   LAALARREAPDMIFAGVQASDHAYGATGMALAGLLDWPHAAVVAGLEYAPGAGTASARR
FT                   ELEGGAYANVTVQCPAVLTLQLGINTPRYASLRGIKQAASRPIEAVTPDALGLPAEHTG
FT                   ARGSLSRIRRVYVPELGRAQMIDGTPAEQAARLAGIIKELRGEA"
FT   gene            complement(482190..483746)
FT                   /locus_tag="Bphy_5958"
FT   CDS_pept        complement(482190..483746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5958"
FT                   /product="leucine rich repeat variant"
FT                   /note="KEGG: xau:Xaut_0919 leucine rich repeat variant"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5958"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75022"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP5"
FT                   /protein_id="ACC75022.1"
FT                   /translation="MTPTANLADSPPRAANAARADARLRRHWRELMRLALDAPDALACA
FT                   MLHPHARGAELKRLEARMFGARSERLALAACPYAPSAVLARLCMFATADADSTLATRLA
FT                   RHAATPADGLQTLAASLEGLMPEQVAQRFAQLIARHPLAPPALLQKIAAHADSIETLRS
FT                   LCENVGVQPDLLAQLAGRGIAPLQRLLAIHFATDARTLNQLWHSTRESAVRAQVLRHRA
FT                   CPDELLRTVPASSAERRSLASNVRTADEILTALARDDDPAVRRAAATNPATPAGALVLL
FT                   CFDADSLVRRAVAVRDDLPLKVVEWLAEDGDVWVRSSLARNRACPRSWLDRLARDPDAD
FT                   VRRSVTRHAGCPIALLTLLASDEVAWVRAGVALRDELPGSVLHRLLQDDDIDVLAGVAR
FT                   HRGTPQATLARLAQHASPDVRRAVILNRHAQRRVLLPLRDESYPLHRVLVFMHPSLTDA
FT                   DRWRMRFEPDMEARARMYGHLAGTLAAARERERQQGRTADEAGSTERDTHQLTTSVEEA
FT                   G"
FT   gene            complement(483777..485939)
FT                   /locus_tag="Bphy_5959"
FT   CDS_pept        complement(483777..485939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5959"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: xau:Xaut_0918 protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5959"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75023"
FT                   /db_xref="GOA:B2JVP6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP6"
FT                   /protein_id="ACC75023.1"
FT                   /translation="MSSAANFDPVNVTRILFEGFPTFAIVLFYLAGVGAMAAFAWGVYV
FT                   QVRKYRRGKPVGGPIDLRERVGAMVRVVLSHRTIARRDPAAGRAHRFIFYGFAGLFLGT
FT                   ATVTVDYDITARFLGFHFWNGNFYLFFKLAMNLAGLSLVGGLIYMMVRRGWIKPPKLDY
FT                   TRPDRKPGDPDYDRSGYRREDWAFLWSLVLIGITGFVLSGLRLVWLQDRAVVWDTRWWS
FT                   PVAALLAEIMRGAGLSAPAAYVLRTGLWWVHGALALTFIALIPYTKVKHIFTASGSLLM
FT                   RDPLAAQRLPKVEADAPRAGYKTITDFTWKHLLNLDACTKCGRCHEACPARAVGAPLSP
FT                   RDVILSLREFANEALEKNTLPDEVKLDVHGKDIGQVFMETVWSCRTCMACVEICPVAVE
FT                   HVPIIVQLRRNLVEDGNMEPQVQKTLQAIHKNGNSFNESKRKRAAWTKSLPFPVKDARK
FT                   EPVDLLWFVGDYASFDPRNQRVTQAFATLLHDTEVDFGLLFEGEANAGNDVRRVGEEGL
FT                   YEVLATQNIATLGTSQFRRIVTTDPHSYNTIRNEYPDFGGHFEIEHYTSLVARMLAEGR
FT                   LRPKRKLGYRVTFHDPCHLGRFNKGYDAPRQIIEALGCELVEMKRSRDNSFCCGAGGGR
FT                   IWMNDPVGQEKPSQNRMKEAASIEGLEVFVVCCPKDLTMFEDALKTSGYEGRFVVRELI
FT                   ELIAESLVDVNDDAPPADDIRVTADA"
FT   gene            complement(486102..488294)
FT                   /locus_tag="Bphy_5960"
FT   CDS_pept        complement(486102..488294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5960"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: xau:Xaut_0917 NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5960"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75024"
FT                   /db_xref="GOA:B2JVP7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP7"
FT                   /protein_id="ACC75024.1"
FT                   /translation="MPRDPRHDVLFQPIQIGPKTLRNRFYQVPHCIGAGSNLPGFQAAH
FT                   RSMKAEGGWGAMNTEYCSIHPESDDTHRLSARIWDEGDVRNLRAMTEEVHKYGALAGIE
FT                   MWYGGAHAPCMESRATPRGPSQYASEFETLTYCKEMDLDDIRDVQQFYVDAALRARDAG
FT                   FDIVYVYGAHSYLPLQFLSPYYNKRTDGYGGSLENRARFWLETLEKVRRAVGSDCAIAT
FT                   RFAVDSLYGSGGIEVEKDGMKFVEMADSLVDLWDVDVGDIAEWGEDAGPSRFYLQGHQV
FT                   PWTRFIKEVSRKPVLGVGRFTDPEKMTEIVTKGIADIIGAARPSIADPFLPKKIDEGRV
FT                   DDIRVCIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPEKFAECGSNDSVLVVGAG
FT                   PSGSECARVLMQRGYTVHLVDQAEKIGGHLNSVVTLPGLGEWGYHRDYRETQITKLLKK
FT                   NRHSQLALGQKPLTADDVLDYGAEKVVIATGSHWVGDGTNCLTHDPIPGADASQPDQLT
FT                   PEQVLSGKKAIGKRVVILNADTYFMAPSLAEKLAAAGHEVTIVSGVHLANYMHFTLEYP
FT                   NMMRRLHELGVHELGDHFASRIEPGRIQIYNIWGDGSRRTYKGAGQLPRDENKTHRWLE
FT                   FDSLVLVTARRSNDGLYRELKQRESEWDGKGIKAVYLIGDAEAPRLIADATFTGHRLAR
FT                   EIEEKNAQFPLPYKREVAVWGTPHKPGGTFEIVYKK"
FT   gene            complement(488459..489571)
FT                   /locus_tag="Bphy_5961"
FT   CDS_pept        complement(488459..489571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5961"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein barrel; KEGG:
FT                   mfa:Mfla_0439 aminomethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5961"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75025"
FT                   /db_xref="GOA:B2JVP8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP8"
FT                   /protein_id="ACC75025.1"
FT                   /translation="MTRQSILNARHRELGSKLDGDSWNDMPIPWYYSGDPYDDVVAVRT
FT                   AAGLYDISALNIVRVSGPDAAAVIDSICAVDVSRMKPGTARLAAEVDERGGVCDDLMVI
FT                   YDAPQHFRLSHGGGTTQSLLERAAHKRNVEWRQDFDVHMLSLQGPRSTDILQPHIGIEL
FT                   NKLPYFAHVETQLFGRNIIVSRGGYSGEQGFEVSCAAADAVALWDGILDAGKPHGAVPA
FT                   SWMSLEIARIEAALLFYPFDMPEGDTTPWELNLDWMVDLDKAGDYVGKEALLAARGKER
FT                   VKQAGVVVRHDAAVSAGSPIYIGDEQVGVVTSAIFSRYLMQSLAMVHLKPNHTALGTKV
FT                   EIRDAAGQFSGVVSKTPFYDPMRLRTRVAA"
FT   gene            490075..491031
FT                   /locus_tag="Bphy_5962"
FT   CDS_pept        490075..491031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5962"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: xau:Xaut_3181 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5962"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75026"
FT                   /db_xref="GOA:B2JVP9"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVP9"
FT                   /protein_id="ACC75026.1"
FT                   /translation="MNASRTIPVRVARVEGVTQDVRRFTLECASGGRLPAYSAGSHVVV
FT                   TMRGKERVWRNAYSLTTPAGARDAYQIMVRRVPQSRGGSAFMHSEVREGSELDISMPSN
FT                   FFPIARRGAKHVMIAGGIGLTPFLSMLPELAQAGARVEMHLCCRPEDEASFSELIAQRT
FT                   TGGIAVYTDLCDASERFGAMLARQPAGTHLYTCGPEGLMSGVASTARALGWPASHFHQE
FT                   SFGGGSHGAPFTAVLAQSGREVRVRSDESLLEALEREGVDAPYMCRGGACGTCALDVLE
FT                   GEPDHRDFCLGEAERATGCQMLPCVSRARGERLVLNI"
FT   gene            491047..492117
FT                   /locus_tag="Bphy_5963"
FT   CDS_pept        491047..492117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5963"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: xau:Xaut_3180 conserved hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5963"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75027"
FT                   /db_xref="InterPro:IPR021848"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ0"
FT                   /protein_id="ACC75027.1"
FT                   /translation="MAIDFKTDETFRDTYTFRNSDEAILRFPFPFPEDAYMYSINIEPH
FT                   VKEGNSPVFLSTFDIDEHYVAECRDRALTLERDPLRCQVLDHMDPAQWDTLELIMESLA
FT                   EDYPEHFSLTRNGDQWTWINRPLGLEQTFTFGDASTLPCSPFEYITRQAQGDYVLIDHR
FT                   DDNLFMDGGMVTTQADWSLDFDLGMNFMEWHGPVPLAHQAGIFERALKFLLRLQLGAPV
FT                   RRLNWTMTVNPRLDTSPEHYHEWGRDRASVTPQNVGDKLHLRVELQTLFRLPRSNAILF
FT                   CVRCYLIGVGELARVPKWGKRLHRVLSTLPPELAEYKGITRYRQTAIDWLAPLDDGAAL
FT                   SKGTHPEVERLGEEVA"
FT   gene            492299..493978
FT                   /locus_tag="Bphy_5964"
FT   CDS_pept        492299..493978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5964"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   xau:Xaut_3183 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5964"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75028"
FT                   /db_xref="GOA:B2JVQ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ1"
FT                   /protein_id="ACC75028.1"
FT                   /translation="MSAVSEDYAAEAADGTLHRKISWTGAFWVASGVPALVLFSIGSIA
FT                   ATVGKLSWAVWIVSIGLGFIQSFSYAEIAGLFPHKSGGASVYGAIAWVRYSKLFAPLSV
FT                   WCNWFAWSPVLAIGSGLAAGYILSVLFPADAAINTWQVTLVSLDWIRSGLSLRINSTFI
FT                   LGAVVLLVTFAIQHRGILNAARIQTILGVAALVPLILVGTVPLFSGDLPLHNLFPLVPF
FT                   TKDSAGQIVDGTWDRAGITLMAGGLFIAAWSTYGFETAVCYTREFRDPKVDTFKAILYS
FT                   GLLCIFVFTIVPLAFQGVLGLGHMVTPAVKDAAGNIVTPAVYDGMLSPDIYSGMGVAKA
FT                   MAPMIHGGLLVERVLIVMLVLALVLAIMTSMAGSSRTLYQASVDGWLPKYLSHVNEHGA
FT                   PTRAMWTDLCFNLVLLLMSDYVFVLAMSNVGYIIFNFLNLNSAWIHRLDRPDWSRPFRA
FT                   PNWLLALGTLFSFVNLALLGMGADIWGSGTLISGLCFAALILPVFLFRHYVTDKGHFPD
FT                   AMKEDMQLVGSQRVARRAGILPYVTVAAGIVVVAVTHSLAIY"
FT   gene            493990..494598
FT                   /locus_tag="Bphy_5965"
FT   CDS_pept        493990..494598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5965"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_3182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5965"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75029"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ2"
FT                   /protein_id="ACC75029.1"
FT                   /translation="MDETAMMSTNKSRPEYARLAPDLQGTRHWFITDGASAEDCVRASL
FT                   ALAGLSPMEVWEVHDAARHASGVTFHEAKERVFADAAALYAAFDEALRDPAVATIGLRI
FT                   YVLGSEPFIWSIRRIAEHHALAAEAVRLQRSGTLQRRVYCIHCHAFNEAVTRNVVTCCG
FT                   CGLQLLVRDHFSRRLASFMGVQADAEVPGELPAITQPYL"
FT   gene            494740..495882
FT                   /locus_tag="Bphy_5966"
FT   CDS_pept        494740..495882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5966"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bch:Bcen2424_6717 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5966"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75030"
FT                   /db_xref="GOA:B2JVQ3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ3"
FT                   /protein_id="ACC75030.1"
FT                   /translation="MNELPRYAALFALCLCASGTSYAQSAVTLYGVLDDGLNYTSNAGG
FT                   HHAFAMVSGDTAETSFGLKGTEDLGGGLSAIFTLESGVNINSGQLNEGGRLFGRQAFVG
FT                   LSSAPAGTLTFGRQYDATIDMWSPFTAAGNSIGDLAAHPFDNDNADFDFRLSNSVKYVS
FT                   PTLAGFQLEGVYGFSNATNFASNRAYSAGVTYGTGPLSVALAYLHLNGAGTGTNGAVTS
FT                   DSVFVATRQQNIVAGVKWTFSNNANVALAYSHVDVRSPTGNGYAPDIGTQTWTSWKFDN
FT                   IEINGQYYFMPDLSLTGAYTFTHGKLESTAGSDSPNWHQVALMLNYSLSKRTSVYVQGA
FT                   WQHTNANTGTDLDAAHIVGSAGLSSSGNQAVARLAMSHKF"
FT   sig_peptide     494740..494811
FT                   /locus_tag="Bphy_5966"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.893 at
FT                   residue 24"
FT   gene            complement(495879..497696)
FT                   /locus_tag="Bphy_5967"
FT   CDS_pept        complement(495879..497696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5967"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: mfa:Mfla_0444 signal transduction histidine kinase,
FT                   nitrate/nitrite-specific, NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5967"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75031"
FT                   /db_xref="GOA:B2JVQ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ4"
FT                   /protein_id="ACC75031.1"
FT                   /translation="MNIDKSARIHRYPLYAKVCLLLACIVALITVLYLGAFMQTRGSEG
FT                   FRQTLFSLDEAMRLDRKAASLQTASPDTARALRELADSLVSNDTLLTDWRQRGAPTPEI
FT                   GGALAAANASAAPEHTGKPDAKLAALGALRAHVAYQREVHAAVLGLLQACTVCLLIFGV
FT                   VSLAWGARRTLVARPRAALQALVETGLSVPQGRDEIERLLKLQAELAVRLRTEQDESVR
FT                   LKRIVEDYITFADQSLELLHHICAQLAEEEPSGRTLEALLQRLVGVLRAQRIALVVTES
FT                   TAQLLDIDPVVAPNGDVPAIVRSRVTNELMTLAGTHTFPPLDNGEVPPPVLAAPVRVPL
FT                   ASYGVLIAEGEPETRFELRHLYLIETIASVLAHAISNLSRDVRDRRMALFEERNAIARE
FT                   LHDSLAQSLSYMKIQLARLQAVLPPELSQSDIAEIARGIREGIDSAYRQLRELLTTFRS
FT                   PMHAHGLASTLEELAEEFGSRSEVQISIDNRVPRMRLSVNEEMHVAQIVREALTNVLRH
FT                   ARATTAQVQLMSDGRTMTVSIDDDGRGINRTEGDEHHYGLSIMRERARSLGGRLEVKPA
FT                   ERGSRVVLTFVPTALAAYKARATSGAGMR"
FT   sig_peptide     complement(497586..497696)
FT                   /locus_tag="Bphy_5967"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.743 at
FT                   residue 37"
FT   gene            497781..499649
FT                   /locus_tag="Bphy_5968"
FT   CDS_pept        497781..499649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5968"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: mfa:Mfla_0443 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5968"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75032"
FT                   /db_xref="GOA:B2JVQ5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ5"
FT                   /protein_id="ACC75032.1"
FT                   /translation="MSVYLFATVLLAAVAALVIPRLGYSPDNNDLLYVSIGLAGCLAAF
FT                   LLSMAYGARRTAPRVVRTTESPELGAFAANLSTPAVLLDNDALVFVNSAFLKHARWESY
FT                   ADEIVGMPFSNLVHPQSLLDLTALLTQSRDGEERTSGSLRIAYGDGSFRLHPVTALRAR
FT                   GSRMTLLQFPAPHTSADAQRSELQLLQHCKDAVLQLPQPLFRVDRELRLIFSNPAWRSL
FT                   MRAVGSDAELKPFSSFFHPEDAETLNARVKALLDGSLSELVTEARLIRADNTTAHVELR
FT                   LHAVTDDEGVLDGAVGLATDISNRRRNEEALRASRRSLRTLLSNLRAMIYRGQNNRDWS
FT                   MEFVSEGCFDLTGYEAFELIDESRLAFRSLIHPDDREFVWNEVQARVVAREPYELTYRI
FT                   VDRSGQTKWVWDQGCGVYSARDELMGLEGFIVEVARRQMVEENARRRLTFEHSTGLASA
FT                   SMFVGRMEFAAAISARTALPCAIFAINVGELEHVAARFGQDYADRVMIDLGRRLEATQG
FT                   QLNCAALLDPHVFVVMVVDFSTDALAWCGDAQALAQRAAANPDAVLDELQDELRGLLEA
FT                   PVRIEGHEFSVPTRIGCASIGHGKGDPKNVLDHVLAASGWEATGEA"
FT   sig_peptide     497781..497852
FT                   /locus_tag="Bphy_5968"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.745 at
FT                   residue 24"
FT   gene            complement(499656..500144)
FT                   /locus_tag="Bphy_5969"
FT   CDS_pept        complement(499656..500144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5969"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5969"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75033"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ6"
FT                   /protein_id="ACC75033.1"
FT                   /translation="MDRTAYIASIKAAYEGELYGEAWFAAMAREAKAPDRQRKLATLAR
FT                   LEAQTAMRMMPLMTRLGIAGIDEAAQREKGIRLAQRHAGQSWPVFIAWFIEEIGRFVTL
FT                   YDELARNTAPEDAAILAELARHERALLEFARLEAEGMPDRSLEPVLALLDMRSSMSMP"
FT   gene            complement(500185..501825)
FT                   /locus_tag="Bphy_5970"
FT   CDS_pept        complement(500185..501825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5970"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   reu:Reut_B5831 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5970"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75034"
FT                   /db_xref="GOA:B2JVQ7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ7"
FT                   /protein_id="ACC75034.1"
FT                   /translation="MSATEEIHRLEGLADDGMRSTLKRSLTWKDAFWVASGSPAFVLFT
FT                   LGAIAATVGQPAWIIWIASISIGFIQCFTYAEISGLFPHKSGGASIYGAIAWVRYSKLL
FT                   APVSVWCNWFAWSPVLALGTGLGASYVLSALFPVDAAINTWSFTLMKLDFIKDGLSLRI
FT                   NSTFILGAALLLLTFFVQHHGAERAAKLQKYMGIVALIPLSVFGLEPLLTGTVHMSNWF
FT                   PLLPLAHDAKGNVVPGTWNAAGWTLMMGGLFVAGWSTFGFETAVCYTREFKNPKTDTFK
FT                   AIFYSGLLCLAVYILVPLSFQGAMGLKGLLAPEIYDGTGVAAAMARIIGGGAAIFYLIV
FT                   VMLVFTLLLSVMTSMMGSSRTLYQASVDGWLPRYLSHVNEHGAPTRAMWTDLCFNLILL
FT                   MMSDNVAVLAMSNVCYFAFVFLNLQAGWIHRLDRPTWARPFKCPNWLLALGALCGFIDL
FT                   VCVGAGADIWGPGTLRNGLMAIALIIPVFIYRHYVQDKGRFPDAMLDDLELRPDHGTTR
FT                   RRAAWLPYATLVASVLVVWLSHHFAVFPA"
FT   gene            complement(502003..503133)
FT                   /locus_tag="Bphy_5971"
FT   CDS_pept        complement(502003..503133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5971"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: pmy:Pmen_3456 glycine cleavage T
FT                   protein (aminomethyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5971"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75035"
FT                   /db_xref="GOA:B2JVQ8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ8"
FT                   /protein_id="ACC75035.1"
FT                   /translation="MANSWRISALADRHRALGSSLEDWNGMGTAWTYSTDLADHHEAIR
FT                   TKAGLMDVSGLKKVHYVGPHAESLLDWATTRDIGKLYPGKSAYAAILNEEGKFIDDCIV
FT                   YRTGPNAFMVVHGAGTGYERLVRSAQGRQVAVLFDDDLHDLSLQGPQAVDFLAEHVPGI
FT                   RDLPYFHHVQTRLFGRPVMISRTGYTGERGYEIFCKAADAPLIWDTILAEGAAFGIVPC
FT                   AFLALDWLRVESYLLFYPYDNSEMYPFADEKAGDTLWELGLDFTVSPGKTEFCGAREHF
FT                   RLAGKERFRIYGVDIAASKAASAGDTLWRDGEQVGVVTCGMYSRLTNRSLAIARMNVAH
FT                   ARNGVALEVKGSLDARATAAALPFDDPEKKKRTANG"
FT   gene            503533..503967
FT                   /locus_tag="Bphy_5972"
FT   CDS_pept        503533..503967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5972"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5972"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75036"
FT                   /db_xref="GOA:B2JVQ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVQ9"
FT                   /protein_id="ACC75036.1"
FT                   /translation="MKVIRATWQALCVFGSISLYVAAFFLWSAIAAGAGWMLAHLPDVW
FT                   SEHLDSESSMGLAIAAITSYAVVAGALFLAFCCGIVQMLADAYTAMLLCVRKRRSRLAS
FT                   PPIQRRRPFFVRRPAAGSASARIDSPPAATGAEAKIGAGR"
FT   sig_peptide     503533..503628
FT                   /locus_tag="Bphy_5972"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.599 at
FT                   residue 32"
FT   gene            504159..504335
FT                   /pseudo
FT                   /locus_tag="Bphy_5973"
FT   gene            504595..506109
FT                   /locus_tag="Bphy_5974"
FT   CDS_pept        504595..506109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5974"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bxe:Bxe_B2609 hypothetical protein; PFAM: KaiA
FT                   binding; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5974"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75037"
FT                   /db_xref="GOA:B2JVR0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR0"
FT                   /protein_id="ACC75037.1"
FT                   /translation="MERSEPASLNSTDEPGRISTGVAGLDDVLNGGLIPNRIYLVEGVP
FT                   GAGKTTLGLHFLLDGIRRGESGLYITLSETAVELAAVARSHHWSLEGLSIHELVSEDGL
FT                   AADAGQSVLHPSEVELGETVDEVRRKVLDLNPRRIVFDSLSELRLLAQDALKYRRQVLA
FT                   LKQFFSTRGCTVWLLDDKTSQLGDLQLHSITHGVIELDQRVQEYGAEQRRLRVVKMRGI
FT                   KFVGGHHDFRLDTGGITVYPRLVAASHRREFNNTAQSTGVKELDALLGGGLIPGTSTLL
FT                   VGPSGVGKTTTSVRCALTALQRGEAVKYLLFDETLRTLMSRSRQLDMALDGYIDNGQLS
FT                   LQQIDPAEMSPGQFATVVREAVEQDGASMVVLDSLNAYMQAMPGHRYLLLQMHELLSYL
FT                   NQQGVTTLLVLGQHGLIGNVASEVDLSYLSDALLLFRFFESAGEVLSALSVLKSRTSEH
FT                   ERTIREFRVDSGGLRVGPPLKDFEGVLTGLPSYRGAQPLLGERTGD"
FT   gene            506119..507693
FT                   /locus_tag="Bphy_5975"
FT   CDS_pept        506119..507693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5975"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: afw:Anae109_1492 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5975"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75038"
FT                   /db_xref="GOA:B2JVR1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR1"
FT                   /protein_id="ACC75038.1"
FT                   /translation="MEERILIVAPRGRDAEVVAQVLSRERMECVVCTNVGQLVATLPEG
FT                   AACALIADEALDALALRSLDGWLSTQPPWSDFPFVLLVGNGKKGVPTAEGRRLEVLGNV
FT                   MLIERPVSGEALVSAARSARRARRRQYQARAMIAERAAANLRLVNAARQKDEFLAMLAH
FT                   ELRNPLAPIRNAAEAIRTTDAVLPARVQWAREIIERQSRHLASLLEDLLDVSRITTGKI
FT                   TLKRNIIELGGVLAAAIDVAKLALDAHGHTLVVRAPDDSIYLDADATRLAQVFGNLLDN
FT                   AVKYTLDGGRIEIDVTAEEGLVTVAVSDNGTGIAPEELPEIFELFSQSNRALDRAQGGL
FT                   GIGLSVVRSLIGMHGGTVRAESAGLGLGTRIVVTLPTVDAPVQGSDRADDVEHGNTQIL
FT                   DVLVVDDNVDAASSLALLLELNGHRVRIAHDGLHALDACADAQPDAVLLDIGLPGMDGY
FT                   EVAQRLRQMVTMSHATLIAITGYGQPEDIARARAAGFDHHLVKPVEPDTLALLFDDVRQ
FT                   SRATQLR"
FT   gene            complement(507744..509531)
FT                   /locus_tag="Bphy_5976"
FT   CDS_pept        complement(507744..509531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5976"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5976"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR2"
FT                   /protein_id="ACC75039.1"
FT                   /translation="MGANGPLIVVNASEWIRRTALTFRSRSASTSRVDAAYAAWCTARF
FT                   DPLKAATLRDALDDYLAEKGGDWSKVSRNTESGGLMQYIYEEAKAIAPVRASAAAARNR
FT                   IRSFDIPHSRYGVLYLLGNIEIDMNCFNIAMEGVAAVGGAVGSRFAANMDHLNSVSQAS
FT                   RHVDLGGHRVSAQAIVSTSSTAVKVLPKAGKKIDETFGISQPLGRERRWSPTGTVRPVM
FT                   DNADSGPLKSKVTWNYPVSKAGFEMIKDDPALFLNPWMIPATAAGAAIVTITETLNNLR
FT                   REIESAVSWAFEKIKNGLLGASASTFTLSGGIVRSLIKIVVTQCLASAAPFVGAAMDLG
FT                   AGIVKTLRAAAEKVGAWLERRRIQLNAGHPELIAAALEGEMQKGMFQGLWSTLKGAVSM
FT                   ALSSFLPGAGSLVSAIVTGVEWLVKFAFRLWEQSKIHAFLVKARQFYLEERELATRDPG
FT                   PRGLEFQPNMDPDRGGIIHDVDRFSAFFQEGCDASPLIPMLTLNTGICGSLMTMVNLFR
FT                   DENEDGRDVVDRATYNSGVAYFSRLKAYGSQYLQSSGFKFRASPTQTRGSIQGLLDHAV
FT                   HHHRQDTIAGNAVAFLAAN"
FT   gene            complement(509595..509987)
FT                   /locus_tag="Bphy_5977"
FT   CDS_pept        complement(509595..509987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5977"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75040"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR3"
FT                   /protein_id="ACC75040.1"
FT                   /translation="MTISQPGSHGCDRNTRVAVEDCHRRPGENDDAQVIAVAPRPVYCS
FT                   RRQRQHRRKDGKEVQKNTLVERDIAHLSQVLRAFVFRQSDAVTTYWRARLNVLYESRHL
FT                   SDYQRHWVRELMRELHDRDPRKSLDG"
FT   gene            510771..511343
FT                   /locus_tag="Bphy_5978"
FT   CDS_pept        510771..511343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5978"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG: reu:Reut_A1733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5978"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75041"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR4"
FT                   /protein_id="ACC75041.1"
FT                   /translation="MSNSLQKWVGRNRPPRVQITYDVEVGDAVEKRELPLVVGLLADLS
FT                   GQPATPLPKLKERRLVEIDRDNFDEIMGKIAPRLDLSVPDTLKGEGNIKVELKFEKFQD
FT                   FHPESIVNQVPRLARLLEARQQLRDLLAKLDGNDELDSMLERIVQNSEELKKVQSQAHA
FT                   SDAPVAASAASDAVAEPAAAPDDAPAA"
FT   gene            511410..512918
FT                   /locus_tag="Bphy_5979"
FT   CDS_pept        511410..512918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5979"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   reu:Reut_A1732 protein of unknown function DUF877"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5979"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75042"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR5"
FT                   /protein_id="ACC75042.1"
FT                   /translation="MASNTAAGGAARETQTLDASAGAELSLLERIVHEGNMAVEPSQSG
FT                   YAKKLIGQLASQILDEGMRTSPDKSVVAMINERVAEIDKLLSDQLNAIMHDEAFQALEA
FT                   SWTGLHDMVYGTETGPQLKLRLLNVTKKELLKDLETAVDHDMSTLFKKIYEEEYGTFGG
FT                   APYSLLIGDYSFGRHPQDIALLERISKVAAAAHAPFIASAAPGLFDLKSFTDLGVTRDL
FT                   SKTFESAELAAWRSFRDSEDSRYVSLVLPSYAARLPYGAKTKPVENFNFEEDVDGTDHG
FT                   KYLWANSAYQLGLRITDAFAKYSWATAIRGVEGGGKVDNMVAHTYKTGEGDIVLKCPTE
FT                   VTITDRREKELNDLGFIALVNSKGSNFATFFGGQTTNRPKVYNKDAANANAQLSARLPY
FT                   VLAASRFAHYMKVIMRDKVGSFQSRSDIESYLNNWVADYVLINPSASHAQKARFPLGEA
FT                   RVDVTEVPGKPGAYRATCFLKPHFQMEELTASIRLVAELPAAAA"
FT   gene            512987..513475
FT                   /locus_tag="Bphy_5980"
FT   CDS_pept        512987..513475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5980"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   reu:Reut_A1731 protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5980"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75043"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR6"
FT                   /protein_id="ACC75043.1"
FT                   /translation="MDTVLLKIKDIKGNSTLDGAADQIVLYSYSIGVAMTMNRDVGNTE
FT                   RTMGRPSFQEFGLTKATDQATPALYSACAAGTKLGDATISIGRNENGKFMSLLQYTLSD
FT                   AMISTIATSGSGESVDSFSINFSKITTVYTQQNVDSTKKGTASFGWDLSKNVSAPPAG"
FT   gene            513551..514006
FT                   /locus_tag="Bphy_5981"
FT   CDS_pept        513551..514006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5981"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG:
FT                   reu:Reut_A1730 protein of unknown function DUF1316"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5981"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75044"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR7"
FT                   /protein_id="ACC75044.1"
FT                   /translation="MPAIVSSSSMPLFDRLAASGDAQLSGAHALRESVARELSRLLNTR
FT                   SRLTIEAFLESEGTVLEYGVPDFSERSLHSGPDRDAIASVVKRAITLFEPRLVNIVVGF
FT                   VFPSEYSAHAVLTIGADIRSGADVAHVAFDMATDGHVVASTRGADEG"
FT   gene            513996..515765
FT                   /locus_tag="Bphy_5982"
FT   CDS_pept        513996..515765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5982"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   reu:Reut_A1729 protein of unknown function DUF879,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5982"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75045"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR8"
FT                   /protein_id="ACC75045.1"
FT                   /translation="MKADMAPDDILQYYKRELSYLRLQGADFARRYPKIASRLALHGTE
FT                   SLDPHTERLIEATAFLAARVHRDLDQEFPQVASALLDNVCPSLVQPVPSMTVAQFDLDP
FT                   TQGKVTAGFLVPRHTGLQARTETGDTCRFRSAWDAVLWPLKISHAAFGDDATLRLTLEC
FT                   APGVDFSELELKQLRIHLHGDWMVTMPLYELLVSGVADVSVRPEGRPSASLLPARAWRE
FT                   VGYAQADDVLPRPPNAQPAYSLMQEYFAFPRKFHFFDLHHLEGRLGSGRRCEVVFHLDR
FT                   SPRGLGMLRAEHFQLGCTPIVNLFSQTSEPIVIDHRHYEYRLVADHRRESMTEIHSVAS
FT                   VVASDPSTDRVEHVPCFSAIDHVHTDGNTVFWSARREHSLRENVHGTDTFLSFVNAANT
FT                   QSDPGTPVIYANVLCTNRRLAEQVPVGARMLLEKVSQNTRVRCLYEPTAQRSPSLGSET
FT                   LWRLISLLTLNYHSLVSGATGRAQLQEMLRLFASESTREQDQIRGIRSVEARSVTAHVG
FT                   SDAWRGYCRGTEVAVEFDPETFVGGSPLLLGAVLARFFAMYTSVNSFVRLVVRRGDETW
FT                   KQWEPMTGCQQLL"
FT   gene            515720..516853
FT                   /locus_tag="Bphy_5983"
FT   CDS_pept        515720..516853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5983"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   reu:Reut_A1728 protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5983"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75046"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVR9"
FT                   /protein_id="ACC75046.1"
FT                   /translation="MEAMGADDGLPAVALIARLKANPQSFDLFQAISLLERAAPWARPL
FT                   GRGNGLGEAVRFAGHVSLAFEASDIRSVREHAVPPDEAHARPAHEDEHASRERRGPYAS
FT                   YTVTTPVLTLAGANGPLPMAYTELVLARRAQRDTATADLLDIFNHRFLSFLYRSRKKHA
FT                   PGLNWRSPHGSALAAALDALSNLGLRAGVNAAVRGPQGARLWMRHAGLLGAAPRSMTGL
FT                   LAMLSDRLGLEVQGAQFVGGWREIDAADSLRLAGARSRAPRLGGAAVLGRRTWDEASGI
FT                   CIEFPGLTKEQFEALLPGGRDHAMAAWLIRSYLQQDFDVQFVLHLAPQPVACAAGGARA
FT                   ARLGWTSWLGGARHDTHTPEPVRLAMREATASTPTNL"
FT   gene            516865..519594
FT                   /locus_tag="Bphy_5984"
FT   CDS_pept        516865..519594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5984"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: reh:H16_B2428 ATP-dependent protease Clp,
FT                   ATPase subunit; TIGRFAM: type VI secretion ATPase, ClpV1
FT                   family; PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5984"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75047"
FT                   /db_xref="GOA:B2JVS0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS0"
FT                   /protein_id="ACC75047.1"
FT                   /translation="MDIDIRTLLSRLNPECKLAMEQAAQLCVRQTHYNVDVEHLLLTLL
FT                   ESDAPDLRAILAHFDIKPETLTAQLQKAVDLFKRGNGRTPALSPNFSPLFQEAWLLSSM
FT                   LLGEQQVRSGTLILALLEVGSLRGMLLESAPALLKIPRASLREQIGMIVAGSAEDAGGA
FT                   QARASAAPGAGQPGPASSAAAPQLDGGMPTMPSGATASQGRQTALDQYTVDLTGFAREG
FT                   KIDPIRGRDAEIRQLIDVLLRRRQNNPILTGEAGVGKTAVVEGFAQRIVQGDVPPALAN
FT                   VSVRSLDLALLQAGAGVKGEFENRLKSVIAEVKASPAPVILFIDEAHQLIGAGGSEGQG
FT                   DAANLLKPALARGELRTIAATTWAEYKKYVERDPALARRFQVVKVEEPSEAVAIEMLRG
FT                   MVQKLEEHHGVEILDEAVRDAVKLSHRYISGRQLPDKAISVLDTACARVAIGQNGLPED
FT                   IEALGRSIETAENQLRIARHEAATGAERADVMAGLVKQLEDERAQHVRLTEKLTTEKRA
FT                   VEEILAWRKKIRGYLTNQNDVLEAEDGESLTANLSRLEKGLEAVQNDEPMVPVCVDSET
FT                   VAKVISGWTGIPVGRMLADELHTVLYLQDKLAERVVGQDEALDAIARRVRTFRADLDDP
FT                   GKPVGVFLLVGPSGVGKTETAFALADMLYGGERNMITVNMSEFQEAHSVSGLKGAPPGY
FT                   VGYGRGGVLTEAVRRRPYSVLLLDEMEKAHPDVLELFFQVFDKGVMEDGEGVPIDFKNT
FT                   LILLTSNAAQDVITDACRGGRRPPPEELIEKLRPALLKQFSPAFLGRLVLVPYYHLGDA
FT                   QINAIVNLKLERLAQRFSRNHHAPLTWDEGLATLIAQRCKEVDSGARNVDHILTQSVLP
FT                   ELARQVLERISISEPFGGVHLALSAAGDIAFRFLPKEA"
FT   gene            519599..521524
FT                   /locus_tag="Bphy_5985"
FT   CDS_pept        519599..521524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5985"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; Gp5 domain protein;
FT                   KEGG: reu:Reut_A1726 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5985"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75048"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS1"
FT                   /protein_id="ACC75048.1"
FT                   /translation="MSTTPSQANCFASVSTPFGTDVLLLDGFGGREAIAELFHFDLRMR
FT                   STNKALDPQQIVGKSATVTLKDHTGVARYFNGIVTRFAHAGADVQYGFYSAELAPRLWL
FT                   LSLGQDRVIWQNLSALEIIKKVLGTFGVTFEDRTKHSSNYLAREYCVQYDESAFRFISR
FT                   LMEEEGIFYFFTFADGAHTMVLADDPSAHEATVAGTLYFAPDPSVGQQIQRLSAFEMSR
FT                   GVVAGEHIVSDYDYTQAATLLSSSKGASSIPTGTRFTFPGKYVAASHGDQIAGTRLQAH
FT                   HVAQQTGRGEGAYYGLAAGTTFTLSGHPDSALNVSYVVRAVQHAASNMTYGNEFDVIPV
FT                   TVPFRAPLVTPRPIVSGTHTAKVVGPSDEEIWTDSQGRIKLKFYWDRTPDADQNSSCWV
FT                   RVAQASAGPGWGHLFLPRIGEEVVVSYVDGDPDRPLVTGCVYNGTNAVPVTLPSMQTQS
FT                   VIRSRSSKGGTAGNEIRMEDKLNSEELYVHAQKDMSVEIENALSTTVKAGAETHVVLKG
FT                   DRSVEVSEGKETHTVKGTRTLDVTGDETHTNHAAFAHNVSGNHTHKIDGNYTLKVGGNL
FT                   VIEVSGSISIKAGTSLSSEAGTSHASKAGTTLSSEGMTVSHKASATQTVDGGGQLALKG
FT                   GIVQLN"
FT   gene            521533..522255
FT                   /locus_tag="Bphy_5986"
FT   CDS_pept        521533..522255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5986"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1725 putative uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5986"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75049"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS2"
FT                   /protein_id="ACC75049.1"
FT                   /translation="MSTPMLAASLPPGTGEVETTVVETCDAAGCPVSRASLVNGVPHGE
FT                   TVCYAPDGTAMLRANYVHGVLEGTLRSFDAEGRLVQEAQYRKGKLDGSMCLYQDGRLAS
FT                   RNHYVSGLLHGESASYAPSGHVTSRMTYEAGKLEREAVFMHEGVVVRRACYIKGKLEGE
FT                   TREYAANGALVQSSPYQADLLHGTVRRFAPDGTVMQERLYRQGKPQGDWRAPDAGAAKA
FT                   DVARAPRLVKHLEKWVRG"
FT   gene            522278..522664
FT                   /locus_tag="Bphy_5987"
FT   CDS_pept        522278..522664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5987"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5987"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75050"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS3"
FT                   /protein_id="ACC75050.1"
FT                   /translation="MGIQVTSGATLQCSFGVAPSALQVLPANRVMCGAPAANIMDCAPM
FT                   VNIMPFGQCSSMANPMVAAATAAALGALTPMPCIPVTPAPWAPGSPTVLIGAMPALQNS
FT                   SKLTCAWGGVIQVVAPAQFTTMTA"
FT   gene            522708..522953
FT                   /locus_tag="Bphy_5988"
FT   CDS_pept        522708..522953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5988"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5988"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75051"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS4"
FT                   /protein_id="ACC75051.1"
FT                   /translation="MVTIAATCAVLLCILLFLLGVEIGTRMSHSSADTRATSSAGVAAS
FT                   AATVPVASGNASPAADAQSSSPAPADIAALPASSTL"
FT   sig_peptide     522708..522770
FT                   /locus_tag="Bphy_5988"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.531 at
FT                   residue 21"
FT   gene            522967..523941
FT                   /locus_tag="Bphy_5989"
FT   CDS_pept        522967..523941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5989"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: reu:Reut_A1722 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5989"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75052"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS5"
FT                   /protein_id="ACC75052.1"
FT                   /translation="MSSFFAPVLNQTRMRARCLKPSLRRGMGSCLLSAAFLIAGAGAQP
FT                   AIAATPQPANVPAAAAPVSAPVTTPTGLVQMPDGRLLAPEFARIIGRGELVVAVLSVDQ
FT                   PPFFEEHDGKLTGLDIDLAREMAAKLHVKVRFNRDAHTFDDTVSLLARGQADIAVSKLS
FT                   RTLSRATVIAFSTPYLRLKRALLLNRVKFAQLAHGRSVPEVVRSYDSTIGVVANSSYAG
FT                   YVINNFPHAQVRSYATWEDVLKALNAGDVTAAYRDEFEVKRVLKVDPTASLRLRVVTLQ
FT                   DLEDTLAIGVNVNEPALLSFVNQFLADRSTKLDVSTVLQAADH"
FT   sig_peptide     522967..523113
FT                   /locus_tag="Bphy_5989"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 49"
FT   gene            523973..525247
FT                   /locus_tag="Bphy_5990"
FT   CDS_pept        523973..525247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5990"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   reu:Reut_A1721 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5990"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75053"
FT                   /db_xref="GOA:B2JVS6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS6"
FT                   /protein_id="ACC75053.1"
FT                   /translation="MNSSRIYALVLNPWVVIGSLALGGAFGLFAPEASQKLGFLGDIYV
FT                   DLLKMTTLPFMISAVIFSLQRLFRDGGTSRLLMRVVTVFLGASATVAVVGAIVLLIMHP
FT                   GANISTATMQTFGLMVGSDSASSDTVMNLYGADLPQKTLNFSDVLTSLVPTNIFAALAN
FT                   GDALKALVFALLFGLAVGRVPERISVGLSQSLETIYHACQKLMHWLSYALPVILFCMSA
FT                   AQLGKSGVGPLHAMLQFVLAFFITSAVLLVLAAVIIWKRSTHSLGKTLDALRAPFALAL
FT                   ATRNSAACMPSMIESLVDNLGFARSRVELLVPLTISLLRVGPMVYYVCATLFIAQLYGH
FT                   SLGVVEVVTVLVASVLAGFASAGMTGLVTVSLVGMTCSYLRLPFEAAFILFLAVDPICD
FT                   MLRTLILVIGNAAAVSVICPRPLKI"
FT   gene            525256..525957
FT                   /locus_tag="Bphy_5991"
FT   CDS_pept        525256..525957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5991"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: reu:Reut_A1720 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5991"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75054"
FT                   /db_xref="GOA:B2JVS7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS7"
FT                   /protein_id="ACC75054.1"
FT                   /translation="MAMIGILGGMGPLATVDFMDKVVRLTEASRDQEHLPLLVANLPHI
FT                   EDRSSAILENGVDPLPALLAGIDMLNRNSVGLIAIPCNSAHHWYAQICAHSAAPVLNIA
FT                   EICVAAVPPTAKRVAVLATGGALVSGFYQRALAERDIEPVTPDETVQPLVAVCIDAVKS
FT                   GDLDAAAMHLETALAMLVKQGVTMALLACTEIPLAAQRIAAPALPLIDSSLELARATVK
FT                   YACERGWNRPQ"
FT   gene            525954..527378
FT                   /locus_tag="Bphy_5992"
FT   CDS_pept        525954..527378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5992"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   reu:Reut_A1719 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5992"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75055"
FT                   /db_xref="GOA:B2JVS8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS8"
FT                   /protein_id="ACC75055.1"
FT                   /translation="MRTLRTLSQSTLGLIACLALGGLCGMFAGPVGEFAYFIGQLYLSV
FT                   VNMAAIPLLVVATFFGLRQVIALPMPRTRVGTIVALAFASVVISAIVGTLTGLLVMPGE
FT                   HLPASAHAQLGELVLKSGSDADEVRVTMFDRAVGTSDTANRVLSIVDIFPDNFYRALAE
FT                   GRSLGILTGTLLFGMAFAALSREQTKMLSNVFEGVYRSLETIIAHANLLIPVLVLGVAA
FT                   NLTSHTQSATLDAMSSLLLCFAASTSLLAAVAIGTIATRAGQPFFRVLGSLKAPLLIGL
FT                   TSGSATAPIPHTIEAMSERLGFSRGVVELVVPFGSVFVRAGSALYYTLATVFVANLYER
FT                   PLGVGEMTAICAASVIAAFISAGQNGVATVGYTGLVLSLLNLPVEAAGVLLVTVDLICE
FT                   GPRNVLSLLSVCTVIALVSAGLPSERVATVEPRGLAELNSVLRFTFTRGQLLLAVSCVV
FT                   VAASLIVLMGIGVGAR"
FT   sig_peptide     525954..526055
FT                   /locus_tag="Bphy_5992"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.535 at
FT                   residue 34"
FT   gene            527375..527887
FT                   /locus_tag="Bphy_5993"
FT   CDS_pept        527375..527887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5993"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B2419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5993"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75056"
FT                   /db_xref="GOA:B2JVS9"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVS9"
FT                   /protein_id="ACC75056.1"
FT                   /translation="MIIGSIRDRMRLCGLPARRAAALFTAVCTVGALGGCSVLGMSGEK
FT                   AKWSQVTLSASDEVNNNSAVAVDVVLVSDDAMLARVAEMPASKWFTGRSDLVRTYPKNL
FT                   RYRSWEIVPGQHVEVSGDEFAGPRVAGAFVFANYEGPGAHRVRIEHFSGHIVVQLDSNN
FT                   FSVLDSK"
FT   gene            527884..529218
FT                   /locus_tag="Bphy_5994"
FT   CDS_pept        527884..529218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5994"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG:
FT                   reu:Reut_A1717 protein of unknown function DUF876,
FT                   bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5994"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75057"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT0"
FT                   /protein_id="ACC75057.1"
FT                   /translation="MMHDANMAVTDRIEWFEGMLLSPQHFQQMASRVDSLVAWQTLAAA
FT                   PFSWGVRRLVLDHGLLPAGLLRVLELDAIMPDGTAVTYSAEAQGAVRLELSLEPFAASL
FT                   TSGPIDFYLVLPVAGTMRRSAQVKRFRSSAGMPVEDQVSDAPPADIPRLMPNLALAAGE
FT                   LPSAMHVYLRLGSLYRDNEVVRLGEHLPPLLEVARDNPLWTSVASLLGQLRGKAAFVAR
FT                   QTANPSSKVDDRLTQLELKDRLRSLLSALPLAEAVLRTPHLHPLSLYLSLASLNGSLAM
FT                   LKPGGLPPVPPDYDHADPLSVFTPLLRSLRESMSEVNEAYREHKFEFRHGAFEIALHPD
FT                   WIGERLVVGLRGQSDRDLLAWMDGAVIGSQSVYASLRSRRVLGAARRGIDYAEDLGLRS
FT                   GSGYLLFEVEAEHALVLASELLVIGNPNEGASAQRPQEMLLFVKG"
FT   gene            529280..530032
FT                   /locus_tag="Bphy_5995"
FT   CDS_pept        529280..530032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5995"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5995"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75058"
FT                   /db_xref="GOA:B2JVT1"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT1"
FT                   /protein_id="ACC75058.1"
FT                   /translation="MARNRPEPEEDDLVTEQFRTFLDELVRAQTRFSGLPDADPDLAAQ
FT                   SMSRHLLDLLEIQTLQSRRDSTRFEMETIADARYLKAVLADEILLNSPWAGREHWTGYL
FT                   LESTLFRTNVAGDQIFRRIEQLLSDREPSYRNIARLYLFALAMGFQGRFRDTDATARLR
FT                   SYREELYEFVYQRRPDLGGRERVLSEPAYGNTLSHVAPRKLPTVSRWAVILMLAAVSLL
FT                   AISEMLWLWQSWPVRDALHADPVTGRSS"
FT   gene            530121..534299
FT                   /locus_tag="Bphy_5996"
FT   CDS_pept        530121..534299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5996"
FT                   /product="conserved hypothetical IcmF-like protein"
FT                   /note="KEGG: reh:H16_B2416 hypothetical IcmF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5996"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75059"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT2"
FT                   /protein_id="ACC75059.1"
FT                   /translation="MLTSNLFLLSIALLTLVVCAVLGAVLYFAIHGSHAKPQTERKIVR
FT                   LRSDSLRSAFRQAVELIEGNIASRAERYNIPWIMILNEGDDPRPLPIAQAGVASVLGAE
FT                   AASSAATQGISWHFFDRGIVVDIKAAYLGSPDDDGDGKPWDEFLGLCRNYRQQRPFDSV
FT                   VITVPAATLLADNTDARLELVRHAKLAHRRLWLAQNRFAMRFAVYVVITGCEALPGFPT
FT                   FARALPEPMRASMLGWSSPYDLSTTYQPDWVDTAMNSVMRSVSDVSAELFALDSAHLDA
FT                   RQFLQLPSRIDAMRAQLQLYVDELLRASAYHEPFFFRGIYLTGDASEFAQWSAAQGGEA
FT                   AQPGALPSPADARRDSVMPYAGASGTEEHTDLALGDGGREPGGAINDLMLQPAFLRDLF
FT                   EKKIFLEYGLTRPSRSQHLTRPVMSRALRWGSIALLGGWGMGLVVATVQLSHRNGELVT
FT                   ALGSLRRDTGERAAALQQGQDLPADWYRRKALALIVLNQHLRTDSTWTVFMPGSWSIVD
FT                   DLNARVKERFEREFGEIAVAALEREMYARVSQLTGVGRDPSTGQLIAGDDCAAPGGMRA
FT                   DAGAAPSLAVDDLPEMRSLQLYVNNVDRFDAALQALQRLQHPAADNADALRLVVRYALG
FT                   AELQGSVSGSLPYFYREQSGVAARTSGIDLVPVQQALRCTLNKGAQQLDNGLFTNNPLL
FT                   VAERTVTDNLNTLSVSDSGTGDFSKLTAGYRAIVAGIDAQRDLLASGKGSWLHQPQFMP
FT                   GPAYDHTLSRVAQNRLLGADLAAQIRQRDDTEFQAFRSELALRFGGATSGIVWADKDAR
FT                   YSVSPERTALRDGLSNLLNQPFMVAPRNRELPTLADGSTIAWDRAQLDQALALGDVRKH
FT                   FLTDGMTNMPAAIRPMIEDALDLQFARLILDQTAAAATVTAAQGDPDSAAFDAARVRLT
FT                   RIEALLMELGATAQLEELGMLVSADAIAHLQRVDNALTQSELYATRQDGGNEGQHGGRS
FT                   PVLAAFGVADGAGLAAYLDQQAARAVSLGKQASVYLSALDAASATAPLVQRWQAINRDL
FT                   ERYQLKNPNSSLLRLEQFALSVAADPGPAGCMSKFTARPATNGDGDYFAMLHARLYDRL
FT                   LARCSQSYVSDLRQRWASFASEFNETVAGRQPFDNSNMVRVGTRADVGSADFGELGQVL
FT                   KRYAPVSEAFHAARGSAIAQAGAAGVAGGKLRQFIDNFDQVRTLLAPLYPSDDGAPNGY
FT                   ELSVEFRANRVGEIAANQVIDWTLTIGSQSLSMNEAPRTLHWDYGTPVSLALRFAKDSP
FT                   LTAMSDPQQRALSTDGRTLTWQFTDPWALISFINRQRVTDASPRADNAAQLLKFDFPLS
FT                   TVDPANLSLLPKQAHGRVFVRLALMPAGKKTPLPWPGSFPVRAPDWTAL"
FT   sig_peptide     530121..530228
FT                   /locus_tag="Bphy_5996"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 36"
FT   gene            534296..535444
FT                   /locus_tag="Bphy_5997"
FT   CDS_pept        534296..535444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5997"
FT                   /product="type VI secretion-associated protein, ImpA
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein, ImpA
FT                   family; PFAM: ImpA domain protein; KEGG: reu:Reut_A1714
FT                   ImpA, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5997"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75060"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT3"
FT                   /protein_id="ACC75060.1"
FT                   /translation="MKQSYPMDIAQGLDIDLEALLAPVPMGEGAGVSLRYEPLYQHIRD
FT                   ARTHDDSSVPMGEWERPLIKADWKRVAASCTEALSTRSKDFQLAAWLCEAWTHMHRIEG
FT                   FIAGTRLLTMLAESYWEHAWPALEEGDTDARVAPFVWLNDTIALVLTLHVPLLVIEGRE
FT                   PANVNLDEWQRVLVEGGDDDAADLTRDLLDKHVTQGGNLASLAALHQQLEVAQQMWLSF
FT                   GRLLDVLLQGDSPHLGRVSDVLMRLSRAVTSLLGNHALAAATGQVPHDDPAAGLMAVGG
FT                   APSVNENYALLETQMSDALREPPVVGTSIRALPARVESRAQAYQLIEVIAQYLAEQEPH
FT                   SPTPYLLRRAASWGQMPLPELMREVLRTEGDMSRYLAMLEIK"
FT   gene            535602..536714
FT                   /locus_tag="Bphy_5998"
FT   CDS_pept        535602..536714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5998"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pau:PA14_33970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5998"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75061"
FT                   /db_xref="InterPro:IPR028208"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT4"
FT                   /protein_id="ACC75061.1"
FT                   /translation="MLTRAQFVTHLTAANRSIYLGGPTFARTQSAMIPVVNAVDQFNVA
FT                   ATGANLLVLIQAIGNLPAAKKVKYANALSQLYNTFPNPIYVTVNPFTLHTGMAPGIGVV
FT                   RSGNVPSHQVDAVLALQTLDNFAAGHTLLDDLCTEVAAGHRVAIADAVGTASGGNECAI
FT                   VNGMPDDYQTDLAAALNGSYNAVGNCISGAMTAMGHAPALAASFNWLETQIDNTPVYQL
FT                   QGAPSVIPSSVTCGANWISAATLQSWVSGHTAFPAGVALADVDSAKLVIGTVLAAGATR
FT                   GIGGHTRVRWNASNLTSAGTARPPYIGLGHELIHALHNMRGNQPGVENGTTTALYEYLC
FT                   VGLGPYAAFPNTENALRAGAGVALRPYYAP"
FT   gene            536930..537469
FT                   /locus_tag="Bphy_5999"
FT   CDS_pept        536930..537469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_5999"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bvi:Bcep1808_6393 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_5999"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75062"
FT                   /db_xref="GOA:B2JVT5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT5"
FT                   /protein_id="ACC75062.1"
FT                   /translation="MPVLGRLLTPHQVCFDFRRLCNGFPVRQDAKLIRLWILSDMEHIS
FT                   SLVTAQDANCSSLSDARDSRSSRALDAVEAARELMLATLLIGTSIETVAASVQMSKGHF
FT                   LRVFKRTTGTTPHSWRLGEKVRSSQRDLQRGNLSLTAIAHRYGFADYAHYSRVFKQVIG
FT                   TSPSLWRAKATNDARG"
FT   gene            537616..537810
FT                   /pseudo
FT                   /locus_tag="Bphy_6000"
FT   gene            complement(538103..538375)
FT                   /locus_tag="Bphy_6001"
FT   CDS_pept        complement(538103..538375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6001"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT6"
FT                   /protein_id="ACC75063.1"
FT                   /translation="MHFYHQGVAIQPSVARSGHTFVARVSILEEDGEATSLGDLGYFAN
FT                   RLSALAFAARCGTAFVDDEPMPRPPCHVQPAKALQQAAVPVQLAT"
FT   gene            complement(538530..538664)
FT                   /locus_tag="Bphy_6002"
FT   CDS_pept        complement(538530..538664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6002"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75064"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT7"
FT                   /protein_id="ACC75064.1"
FT                   /translation="MLTRQQIAEIRKADLVLVSDMTNKAVEDFGELAALNRTGNPLDT"
FT   gene            complement(538809..539006)
FT                   /locus_tag="Bphy_6003"
FT   CDS_pept        complement(538809..539006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6003"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75065"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT8"
FT                   /protein_id="ACC75065.1"
FT                   /translation="MLSPHEFATLMLVASAPEQIDLNRGELDTLLERQLIALEQVSSGA
FT                   QRTRLTDDGDSILRAVTRKH"
FT   gene            complement(539708..540550)
FT                   /locus_tag="Bphy_6004"
FT   CDS_pept        complement(539708..540550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6004"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   bvi:Bcep1808_7286 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6004"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75066"
FT                   /db_xref="GOA:B2JVT9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVT9"
FT                   /protein_id="ACC75066.1"
FT                   /translation="MSKRKAENIGSGMRDSFANAGSANEPKVLSRDEYEAELRRLQIEL
FT                   VKLQRHFLRCRDKILVILEGRDAAGKDGAIKRIVEHLSPRETRVVALGRPSDRDLGAWY
FT                   FQRFVPYLPVAEELAIFNRSWYNRAGVEHVMGFCTPSQYEEFLQSVPRFEAMLVDSGIR
FT                   LLKYYLDISRDEQARRLDARKRDPLKQWKTSPIDEVAVKHWKDYSFARDTMLVRTHTTF
FT                   APWRIVHADDKRLTRLNLIRDILWRLDYCDKDEKLAKPDNTIVFEFEPACIGDGLLAQ"
FT   gene            541204..541500
FT                   /locus_tag="Bphy_6005"
FT   CDS_pept        541204..541500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6005"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75067"
FT                   /db_xref="GOA:B2JVU0"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU0"
FT                   /protein_id="ACC75067.1"
FT                   /translation="MQRVKPLPGESEEDRMQHDERSRFPGGNIVLLAFIAIGGFYLVTE
FT                   HRAHLLGWLPFLLLLACPLMHLFMHHGGHGGDAPHPEDEDRTDRNQSSHFHHH"
FT   gene            541525..542193
FT                   /locus_tag="Bphy_6006"
FT   CDS_pept        541525..542193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6006"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75068"
FT                   /db_xref="GOA:B2JVU1"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU1"
FT                   /protein_id="ACC75068.1"
FT                   /translation="MHDTSAAYGLWLLAAVNSAFFIFFAFTFYKPKTKRDWRSLGAFSA
FT                   FIVALFSEMYGFPLTIYLLSGWLQSHYPQVNWFSHDAGHLLEMMFGWKVNPHFGPFHLL
FT                   SFVFIGGGFWIIASGWQVLYRAQRRHTLATTGVYAYVRHPQYVGFMLIMFGFLLQWPTL
FT                   LTLAMFPVLVYMYTRLAHSEERDSLAEFGLAYRRYMDEVPAFIPKLGAHHGGSTHDSAS
FT                   "
FT   gene            542212..544149
FT                   /locus_tag="Bphy_6007"
FT   CDS_pept        542212..544149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6007"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bvi:Bcep1808_7277 ATP-dependent
FT                   metalloprotease FtsH; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6007"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75069"
FT                   /db_xref="GOA:B2JVU2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JVU2"
FT                   /protein_id="ACC75069.1"
FT                   /translation="MDFNREHKINFLYVLAAMVGVLLIQSLVSQPDHIRTIPYSEFQQL
FT                   ASQGKVTDLVVGPTRITGTLKDAPKDSPRHFSTLRVDQALAQSLTNENVTFSGEPEPGP
FT                   WPTILGWLMPIVGFALVWMFLIRPMSMGPGMDGMMSIGKSKARVYVEKDIKVTFADVAG
FT                   VDEAKDELKEVVSFLRDPRSYGRLGARVPKGVLLVGPPGTGKTLLARAVAGEAGVAFFS
FT                   ISGSEFVEMFVGVGAARVRDLFEQARKHAPAIVFIDELDSLGRARGSAFPGGGGHDEKE
FT                   QTLNQLLAELDGFDTSIGVVLLAATNRPEILDPALLRAGRFDRQVLVDRPDKKGRAQIL
FT                   EVHLKKIALAPGVPVDDIAALTPGFSGADLANLVNEAAILATRRHAENVSLDDFTQAIE
FT                   RIVAGLEKRNRLLNAHEREVVAHHEMGHALVAMTLPGVDMVQKISIIPHGIAALGYTIQ
FT                   RPTEERFLMDRAELMNRMAVLLGGRAAERLIFADVSTGAADDLAKASAIARSMVVRFGM
FT                   DPTLGQVAYEPETTSALGLPNGSEWRPRQYGEQTAAAIDAAVRELIETASACAFSILQA
FT                   NRGLLESAARDLLAKETMSGEELQALLSQLGGGAASASVLRDGGDGAADAGQDRSGEHR
FT                   ALTVEGGEAQ"
FT   gene            complement(544593..547007)
FT                   /locus_tag="Bphy_6008"
FT   CDS_pept        complement(544593..547007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6008"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: reu:Reut_C6196 ATPase, E1-E2
FT                   type:copper-translocating P-type ATPase:heavy metal
FT                   translocating P-type ATPase; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC;
FT                   copper-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; YHS domain protein; E1-E2
FT                   ATPase-associated domain protein; SMART: TRASH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6008"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75070"
FT                   /db_xref="GOA:B2JVU3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU3"
FT                   /protein_id="ACC75070.1"
FT                   /translation="MARAHDDVLPTASPAVVGSPEFVRDPVCGMEIRPTTSAGSDDFDN
FT                   KRYWFCSQRCHDSFLADPARYAGSGAPDQPARRDEAGTSMAPATASGAQLAKDPICGMM
FT                   VNKATALSTVRGNRKYYFCSETCLHTFESPETEMKAMKRRVAIALTGVLALAILRAGAF
FT                   LALAAGATLLTWAPIPALPWFTWGIWLFLLVTPVQFIGGWSFYKGAWNAIRTRNINMDF
FT                   LVALGTSVAYFYSVVVLFFPSWLPVKVAERDVYFEVSAVIIAFVLLGRYMEEIIKKKSS
FT                   AAVRRLLDLKPAVAIVIRDGKEVEIPAESIMVSEQVVVRPGEKIPTDGTVTEGQSSVDE
FT                   SMLTGESMPVEKAPGAAVIGGTLNRSGAFTFRATRIGADTALAQIIRMVEDAQASSAQI
FT                   QRLADQVTGYFVPAVVAVALLALIGWTIAGQFALGLLAFIAVLIISCPCALGVATPAAL
FT                   MVGVGKGADAGILIRGAEVLERAQKLTTVVFDKTGTITRGEPTVTDIVPIGQHRDQDEL
FT                   LSLAAAVESGSEHPLGQAIVRAAEHRARLVPKASAIEALSGLGIRGEVDGRRVWLGNRR
FT                   LFAQQSIPIGAADATLAQLEADGKTAMLVGSDDELLGVIAVADTVKPEAAQAISALKAR
FT                   GIKIVLLSGDNRRTAEAIARLVGIDRVIADVLPDDKVENIRILQREGEVVAMVGDGVND
FT                   APALATADIGVAIGSGSDVAKETGGIILIRNDVRDVATAIELSTATMRKIKQNLFWAFV
FT                   YNTIGIPVAAFGLLNPIIAAAAMSLSSLSVVANSALLKRQRFGEVGEEVST"
FT   gene            547717..548685
FT                   /locus_tag="Bphy_6009"
FT   CDS_pept        547717..548685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6009"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bam:Bamb_5626 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6009"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75071"
FT                   /db_xref="GOA:B2JVU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU4"
FT                   /protein_id="ACC75071.1"
FT                   /translation="MGINFDLNDLQAFRAVVELGSFRKAAEAVNISQPALSRRIDKLEE
FT                   ALGVRLFERTTRSVTLTTVGRVFAPSAEQLLDDLDVALLGIRDVSSSRLGHVTIACVPS
FT                   VAYYFLPGAVASYHRRFPRIRVKILDSSANDVLAAVISGEADFGVSFMGSQEPDVEFKM
FT                   LLQERFVAACRRDHPLARKKRVTWNELYEHEYVSVDKTSGNRLLLDQALGAVSPRMPSV
FT                   CETRHVTTMLGLVEAGLGVAAVPSMAMPGRNHHILTSVPLVEPVVKRRVGIVRRRGRPL
FT                   TPAAQEFHKTIVEMRHGAAASGDTSDDDASLKKRPGRKTSS"
FT   gene            548682..549992
FT                   /locus_tag="Bphy_6010"
FT   CDS_pept        548682..549992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6010"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bam:Bamb_5625 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6010"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75072"
FT                   /db_xref="GOA:B2JVU5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU5"
FT                   /protein_id="ACC75072.1"
FT                   /translation="MRLVRLLRMLYVQVVLAMVLGMAVGHFLPQAGTLLKPLSDGFVGL
FT                   VRMMITPIVFCTIVSGITSLASGKAIGRTIVQALALFYLLTAAALALGLISAFVLRPGE
FT                   GMHIDAGHLDVSVLAQYAKDPHPRGVVAFALSLIPETVLGAFDKGEVLPVLLLSLLFGF
FT                   SLNCHPKVGKPVLALIDGIAQTLFRILAMIMRLAPLGAFGAMAFTVGRFGIRSVGSLGM
FT                   LMVSFYVACALFIALILAPLARLHGFALWRLLRYMREELLIVLATSSTEPVLPRLIAKL
FT                   EALGCDKGVVGLVLPAGYSFNLDGTAIYLTLASMFIAQACDVPLSAPQIATMLAVMLLT
FT                   SKGAAGVSGSGLVALVATLTVIPDLPVAGVALLVGIDRFMSEARALTSVISNACAVIFV
FT                   SMWEGSCDRTRLAWMLGAGAPGGAEGAEEPVQNAPRR"
FT   sig_peptide     548682..548777
FT                   /locus_tag="Bphy_6010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.800 at
FT                   residue 32"
FT   gene            complement(550033..550815)
FT                   /locus_tag="Bphy_6011"
FT   CDS_pept        complement(550033..550815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6011"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bch:Bcen2424_6664 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6011"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75073"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU6"
FT                   /protein_id="ACC75073.1"
FT                   /translation="MKNLLLKLCATALVATSAAAANVQAADLHVMSSGGFTAAYKVLGP
FT                   RFASETGNTLDTALGPSMGKSPEAIPNRLARGEPADAVIMVGYALDELIKEGKVIPGSR
FT                   VDLADSRIGMVVREGAAKPDISSADGLRQTLLHAKSIAYSDSASGVYIERELFRKLGIE
FT                   EQVKSKAKMIPRIPVASVVANGDYEIGFQQVSELLPVKGAAFVGKIPESLQSVTRFAAG
FT                   IPVSAQHPKEAKALLDYLASPGVQAEVKSTGLDSISAH"
FT   sig_peptide     complement(550738..550815)
FT                   /locus_tag="Bphy_6011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            complement(550870..552168)
FT                   /locus_tag="Bphy_6012"
FT   CDS_pept        complement(550870..552168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6012"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG: bam:Bamb_5623
FT                   metabolite/H+ symporter, major facilitator superfamily
FT                   (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6012"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75074"
FT                   /db_xref="GOA:B2JVU7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU7"
FT                   /protein_id="ACC75074.1"
FT                   /translation="MHPSHSTLSTGRSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANV
FT                   FFPAGSEFASLMMTFAVFGAGFLMRPLGAIVLGAYIDDVGRRKGLIVTLSIMASGTILI
FT                   AFVPGYTSIGLLAPVLVLIGRLLQGFSAGAELGGVSVYLAEMATPGRKGFFTSWQSASQ
FT                   QVAIVVAAALGFALNQWLNATAIAAWGWRVPFFVGCMIVPFIFMLRRNLEETQEFKARQ
FT                   HRPSMNEVFRTLVQNWPVVIAGMMLVAMTTASFYLITVYAPTFGKTVLHLSTADSLLVT
FT                   LCVALSNFVWLPVGGALSDKIGRRPLLVGMTLLAIATAYPALSLLAHAPSFLNMLLALL
FT                   WLSFMYGIYNGAMVVALTEVMPVQVRVAGFSLAYSLATAVFGGFTPAISTALIHMTGDK
FT                   AAPGYWMSFAAACALCATFALYRRRAATLTPAH"
FT   gene            complement(552375..555062)
FT                   /locus_tag="Bphy_6013"
FT   CDS_pept        complement(552375..555062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6013"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   mgm:Mmc1_3638 CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6013"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75075"
FT                   /db_xref="GOA:B2JVU8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU8"
FT                   /protein_id="ACC75075.1"
FT                   /translation="MHKQGNSHFKYFVGIQSLADIATREDRVCVLNILGGESSDVTPVS
FT                   HAFSGANVVFGTAPGKGGQVLATPAGDIPVFNNVREGLEAGHRFNCGVVYLPPSAARDG
FT                   VAELIRVNPDLRKIFIITEKIAVHDAREIRAMGQQAGIDIFGANGLGVADSWQRVRIGG
FT                   DDPGATLRQGSVAIFSNSGGFSTTIAQYLRMSGWGTSTVISSGKDVYIHYAAPEFAFAL
FT                   ANDARSKAAVLYCEPGGYYEADAHFNKPVVACVVGRWKSRLTRAVGHAGAMSGGADDAL
FT                   AKERWFKEKFGVERLFTPDDPCCSAKGAVVTNIAHIPAALTAVMRANATMPDFEPEGSL
FT                   ALKPWFGSDQGLDLPDDLALAVVKAVAPYDEQVARVNDQIGAIPPRQPLKDASGASQMD
FT                   AKSQVSSLHGVSMLEAATHSFEANVCLALLHEFGGANDEKLIDVAVGAAVNLYGTPELA
FT                   AAQAAREAGNAPNAVLAAAAAIVGPNRQLAAREAARLMIDRFSAAKLANAFDRDFDVDA
FT                   IDTKGSAALFSDAPDPKAKAMLDGLAARGVSSAFVRWIANGPGHPRADAVLAAITTTLA
FT                   WGPLMRKRISRLTAENLPWWTTLFGTLIGASADASRHHPDSFCGLSTEALLGERSLTET
FT                   AFAALLGLKPSDDDLFALSTLTGLLLTNGPGAISAQGAKGAVSADGPESPERVQLNKAL
FT                   TGFLTHTGYTHGGNGYEGIAFLNDAFRDSGLDDPANAQHGVDLDALARRSVERYAQYKA
FT                   RQKHAGSLDIAKLPGVNHPVFKDKPINHDPREVFIAGLYERRGEYNAFHAYYRALVQAL
FT                   FDAGVSRTVYCVNVDAVIAALLLKMLWQPLRRGDITEADLETAAFTIFLYPRMLGCAAE
FT                   IDDHLNRGRNMDTRTPASQCRFVA"
FT   gene            complement(555073..556371)
FT                   /locus_tag="Bphy_6014"
FT   CDS_pept        complement(555073..556371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6014"
FT                   /product="ATP-grasp domain protein"
FT                   /note="PFAM: ATP-grasp domain protein; KEGG: mgm:Mmc1_3639
FT                   ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6014"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75076"
FT                   /db_xref="GOA:B2JVU9"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032263"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVU9"
FT                   /protein_id="ACC75076.1"
FT                   /translation="MQITGMLHGARLLQFVGFPSSEVLGPGASEEEIKSLIDGHGQIFI
FT                   KPVFKGGVGKKGKAGLLGRATDLKTALAEKERLYFAEHVVGHVRAKANGVTFEAGVPAK
FT                   HEVYFSITDSTRFRAPTMTLSHMGGMDIEEVDPQHVAMVPFDALTGLKAFVVANALSEI
FT                   GAPREIISPLVQQLPKLWELFHDFGMTTLELNPIRMREDKKGRLTPVACDFKCGFDRDD
FT                   PRFSRLGLPPHLFAADYSDFEQEINQLRTHQGQSDVYVINERGTILAPTFGGGANSLVT
FT                   EMLGDAAIISSDFGGNPPYEKMKEVARICFRHWLKQSNVLFIIGGKSNNTDIYETLRAM
FT                   ADALREHFSEHGPTPLYVVLGRGGPNLVRGMSALRDTCDSLGLPYRLFGFDSDISEVIQ
FT                   YARRADAWMQSGGRSQVAARIGARDAQSQMASA"
FT   gene            complement(556769..558085)
FT                   /locus_tag="Bphy_6015"
FT   CDS_pept        complement(556769..558085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6015"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_5605 metabolite/H+ symporter, major
FT                   facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6015"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75077"
FT                   /db_xref="GOA:B2JVV0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV0"
FT                   /protein_id="ACC75077.1"
FT                   /translation="MHSSSLSAEAKPHGRTSKFGAVLRVTSGNFLEQFDFFLFGFYATS
FT                   IARVFFPSTSEFASLMLTFAVFGAGFLMRPLGAIVLGAYIDEVGRRKGLIVTLSIMASG
FT                   TILIACVPGYATIGLLAPALVLLGRLLQGFSAGAELGGVSVYLAEMATPGHKGFYTSWQ
FT                   SASQQVAIVVAAALGYLLNHLMTASEIGAWGWRIPFFVGCAIVPVIFLLRSTLQETDEF
FT                   KARTHHPRARQVFAAMLQNWRTVLAGMLLVAMTTTSFYLITVYTPTFGKTVLKLTTADS
FT                   LIVTLCVGLSNFFWLPVGGALSDRIGRKPILVAITVLAICTSYPALFWLSSAPSFGRML
FT                   IVLLWLSFFFGMYNGAMVAALTEVMPAEVRVAGFSLAFSLATAVFGGFTPAVSTYLIEM
FT                   TGDKAAPGYWLSFAAACGLVATLALYRRGGTAGQSASLA"
FT   gene            complement(558152..559366)
FT                   /locus_tag="Bphy_6016"
FT   CDS_pept        complement(558152..559366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6016"
FT                   /product="CitB domain protein"
FT                   /note="TIGRFAM: CitB domain protein; KEGG:
FT                   bvi:Bcep1808_5606 CitB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6016"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75078"
FT                   /db_xref="GOA:B2JVV1"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV1"
FT                   /protein_id="ACC75078.1"
FT                   /translation="MQKLEALVREARELASPSVIARHTASGESAASIIRVLPLTQNETE
FT                   VARQMQICNACRYCEGFCAVFPAMTRRLEFAKADVNYLANLCHNCGACYHACQYAPPHE
FT                   FAVNVPRAMAKVRLETYAEYAWPAPMGALYKRNGLTVALALAFGLALFLMLGIGLKGSL
FT                   VAGKWGSNFYAVFPHNLLAAMFGAVFGFAMLALGVGVSRFWRHVSAGTASAPAITEAAK
FT                   HALALTYLDGGHGDGCNESDDAFTLARRRFHHLTFYGFMLCFAATVVATFYHYALGLHA
FT                   PYRLLSLPVLLGTTGGIGLLAGPAGLLWLNLRRDPNRGDPKQRPMDRGFIALLLLTSAS
FT                   GLALLAWRDTAAMALLLALHLGVVMALFATLPYGKFAHGIYRCAALLKSSIEQRQVGRP
FT                   QPGSD"
FT   gene            complement(559353..560762)
FT                   /locus_tag="Bphy_6017"
FT   CDS_pept        complement(559353..560762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6017"
FT                   /product="precorrin 3B synthase CobZ"
FT                   /note="TIGRFAM: precorrin 3B synthase CobZ; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; KEGG:
FT                   bvi:Bcep1808_5607 precorrin 3B synthase CobZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6017"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75079"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV2"
FT                   /protein_id="ACC75079.1"
FT                   /translation="MVDVLVIGGGNAALCAALMAREAGASVLLLESAPREWRGGNSQHT
FT                   RNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTGGITNEALARLVIRASSTCRPWMRKHGV
FT                   RFQPPLSGALHVARTNAFFMGGGKALVNAYYRSAEALGVQIRYDTPVDAVELDADRFIA
FT                   ARSGGLRFEARACVLAAGGFESNREWLREAWGQNERGEWPADNFLIRGTRFNQGVLLKH
FT                   IIDSGADAIGDPSQSHCVAIDARAPLYDGGICTRIDCVSLGVVVNRDARRFYDEGEDFW
FT                   PKRYAIWGRLVAQQPGQIGYSIIDAKAIGRFMPPVFPGTKANSLHELARQLQLPEATFV
FT                   ETIRAYNAACRAGTFDHTALDDCRTEGLTPAKTHWARPIDTPPFFGYALRPGITFTYLG
FT                   LKVNDHAQVHFDGRPSENLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIAGTRAAMAA
FT                   THHTGVQRAEA"
FT   gene            complement(560856..561776)
FT                   /locus_tag="Bphy_6018"
FT   CDS_pept        complement(560856..561776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6018"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_5608 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6018"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75080"
FT                   /db_xref="GOA:B2JVV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV3"
FT                   /protein_id="ACC75080.1"
FT                   /translation="MELRQLRYFVSVVEHGSMGKAALELGVVTSALSQQISRLESELST
FT                   RLLQRTSSGVVPTDAGLAFWRQAQLALRHIDDAALAARQARLSGHVSVGLAPSTTGVLG
FT                   LAFMQAMRERYPDVRLRMVESLSGYLGAMLGARQIDLAILFHEVPAQRWSVMPLLDERL
FT                   FVIGDSTLPGMPGRSRTSIAKLGALPLILPSGPHGLRALLDAAFKRAGYVPCIAAEVDG
FT                   LAMLMDAVRGGLGATIQPGAALARAENGSLASVPLVEAYATRPNLIASVSDDELSPAGL
FT                   AARVVLADVARDTVNAGRWPGAALR"
FT   gene            complement(561902..562813)
FT                   /locus_tag="Bphy_6019"
FT   CDS_pept        complement(561902..562813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6019"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_4757 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6019"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75081"
FT                   /db_xref="GOA:B2JVV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV4"
FT                   /protein_id="ACC75081.1"
FT                   /translation="MAMIPTELPDLKLLQLFDLLYDVRSVTRVAEQLGQSQPTVSIWLG
FT                   RLREFLQDPLFIRTPGGMAPTPQADALIGPCREILESLRRFAAWEIAFDPTTAKRRFRI
FT                   CMTDASHITLLPRMLAHIRAQAPGIRLEAATIDGNTERALESGEADLAIGHVPWLGGGI
FT                   YQQQLYTQDWVCLANPHHPRVRARFGVKQYRAEGHVAITAGTGAQLLEQALLREQIQRD
FT                   VVLELPGFLGLGAIIRTTDLIATLPRHIGQTLAQVNELSVHPCPFPVDGFAVRQHWHAR
FT                   YHHEAGNRWLRETVVQLFGGAR"
FT   gene            562954..563904
FT                   /locus_tag="Bphy_6020"
FT   CDS_pept        562954..563904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6020"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bch:Bcen2424_5892 2-dehydropantoate
FT                   2-reductase; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   6-phosphogluconate dehydrogenase NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6020"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75082"
FT                   /db_xref="GOA:B2JVV5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV5"
FT                   /protein_id="ACC75082.1"
FT                   /translation="MKIAILGAGALGCAIGSTLTQGGHETWLIDRSAAHVEAMRRDGLL
FT                   VDDADGSHRVAVRAATHAAEVGAVDLVIVLVKSFHTDSAMRGALDLLGPGTLVLSLQNG
FT                   LGHEDVLSDIVGRERVLAGKTYVGGVLRAPGHIQRGVAGKFTYIGELDGQLTDRVQAIA
FT                   GAFNAAGLATTVSDNIVGTMWDKLLINVATGALTGITRLTYGQLYEEPVLKATALAAVA
FT                   EAMAAAEAAGVSLSMTDAEQAWTLASEGLSPAFKTSMLQSLEKGSVTEIDFINGAVVRW
FT                   GERLGVPTPVNATLVACIKGIERAMADRQREGATA"
FT   sig_peptide     562954..563022
FT                   /locus_tag="Bphy_6020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.417 at
FT                   residue 23"
FT   gene            563901..564293
FT                   /locus_tag="Bphy_6021"
FT   CDS_pept        563901..564293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6021"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bam:Bamb_6529
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6021"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75083"
FT                   /db_xref="GOA:B2JVV6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV6"
FT                   /protein_id="ACC75083.1"
FT                   /translation="MSGTRAYLEHVAIRVKDIHWHVRFFEEVLGMTMREVDGTREAPRQ
FT                   YWTLGGLQFIHDPRYDGPEGRLAHLGVMCEDLEAAIADAQPFGVTEMPQGRNWLRLPDG
FT                   LAVELIQAKPAACVAQALAINPRAEA"
FT   gene            564296..564754
FT                   /locus_tag="Bphy_6022"
FT   CDS_pept        564296..564754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6022"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bvi:Bcep1808_4754 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6022"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75084"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV7"
FT                   /protein_id="ACC75084.1"
FT                   /translation="MTIIEKYWDDAREGDECVSPTYTVTKQRILAYADLTGDHTPVHVD
FT                   EEYANASHFGSIVAHGLFGLSIADGLKTQSEYRFLPGMSLGWTWDFLLPIKVNDVLHVK
FT                   FRVGAMRASKSRPDWGIVVLPSELINQDGQVVQRGEHRLMVPRRPGAY"
FT   gene            564754..565965
FT                   /locus_tag="Bphy_6023"
FT   CDS_pept        564754..565965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6023"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bvi:Bcep1808_4753 formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6023"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75085"
FT                   /db_xref="GOA:B2JVV8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV8"
FT                   /protein_id="ACC75085.1"
FT                   /translation="MQARPLEGIRVVDYSHFLAGPYVGRCLAALGAEVIKVERPGSGDA
FT                   GRQHATVLDDQQSAYFLQLNMGKRGVSVNMKDPRGKDFMQRLCDSADVFIENYRPGALD
FT                   KLGLGYEALSARNPRLVYCSISAYGHTGPDAHRAGFGLIAEAKSGIMQMIGEPGSPPPL
FT                   MRISLGDMYTGIHAVAAVNAALLGREKSGRGQHIDMALYDTLVSMHEYAVQCYTMQGIL
FT                   PEQTGHDMPTSTLYGVFRAADGDLVIAAQVDDAWKRFAALVEAQGGPQGFGADTRFHNL
FT                   NGRNANRVEILSVVKPWVAARPVAQVLELLDSVDVPCAKVQRIDEVLADPQIIARGMVV
FT                   EQQHPRFGTLRLPNLPFRFSDCDTTIRQVGPDLGQHNAEVAQSLGFGAAEIDTMQTDGV
FT                   LFSK"
FT   gene            565973..566806
FT                   /locus_tag="Bphy_6024"
FT   CDS_pept        565973..566806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6024"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: bam:Bamb_6532
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6024"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75086"
FT                   /db_xref="GOA:B2JVV9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVV9"
FT                   /protein_id="ACC75086.1"
FT                   /translation="MTDQYAVIGNPIGHTKSPLIHGLFAEETQQDMAYTAIEGPLEPEQ
FT                   AFAERVRAFALAGGKGMNVTAPFKLKAFAMADERSERAELAGAVNAMKFEGGRIIAENF
FT                   DGIGLVRDIEVNLGLPMAGKRVLLLGAGGAARGALLPFLAARPESLVIANRNVAKARDL
FT                   AAQVGAHGALHACGYGDLQALGRFDLVVNATSASLSGDLPPVPPSVFSPEGAAYELAYG
FT                   KRLTPFLRLARNAGVFTIADGVGMLVEQAAEAFDWWRGVRPATRAVIERLTVPLE"
FT   gene            566826..567269
FT                   /locus_tag="Bphy_6025"
FT   CDS_pept        566826..567269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6025"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: ppu:PP_3003 3-dehydroquinate dehydratase, type
FT                   II; TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6025"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75087"
FT                   /db_xref="GOA:B2JVW0"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="PDB:6CV6"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW0"
FT                   /protein_id="ACC75087.1"
FT                   /translation="MKKVLMLHGINHNMFGKRDPVQYGTITLSEIDNRLQALAAELGVQ
FT                   VESFQTNSEGAMCERIHQAFEERCDAVLINAGAWTHYSYGIRDALAILTCPVVELHMSN
FT                   VHAREPFRHHSVFSEVVVGQICGFGMESYLLALRAAVAQSGCS"
FT   gene            complement(567378..568088)
FT                   /locus_tag="Bphy_6026"
FT   CDS_pept        complement(567378..568088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6026"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Helix-turn-helix type
FT                   11 domain protein; Transcriptional regulator IclR; KEGG:
FT                   bch:Bcen2424_5399 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6026"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75088"
FT                   /db_xref="GOA:B2JVW1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW1"
FT                   /protein_id="ACC75088.1"
FT                   /translation="MGNDGVVAVEKALSLLDCFKPGAESQSLATLAQASGMHKTTVYRL
FT                   MNSLERMGYVVRSQSGAYSLGHRVLYLGKLYEQSFHLSSVVEPALHALAALTKESASYY
FT                   VHDNGQRLCLFRAEPSEGLRETRLAGTTLPLDDTAIGQVIRFWGLGEQIYDEPPALPLF
FT                   TAGARDVHTAAFAIPIFGAGDKFMAALTLSGPASRLCPAHTTGELDRVQLDAAADLSRK
FT                   LGASAAFCERLYGA"
FT   gene            568257..568955
FT                   /locus_tag="Bphy_6027"
FT   CDS_pept        568257..568955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6027"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   bch:Bcen2424_5398 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6027"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75089"
FT                   /db_xref="GOA:B2JVW2"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW2"
FT                   /protein_id="ACC75089.1"
FT                   /translation="MSTTSAGTSSINRNIERVSPELVEAAARYQAAILADVAGRRGTVH
FT                   GRVQPLSPKMKVAGPAVTVEVRPGDNLAIHAALAIAKPGDVIVVDGKGDLSCALLGEIM
FT                   ATQAKASGIAGIIIDGAVRDAHELANGDYPIFSAGLNPCGPTKSVAGLVNAPISIGGTA
FT                   VNPGDLVVGDADGVVVIPRKDVARIVDLAQKKLDMESARIAAIHKGDVRPGWVEKELRA
FT                   AGMLGEGEAL"
FT   gene            568955..569902
FT                   /locus_tag="Bphy_6028"
FT   CDS_pept        568955..569902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6028"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bch:Bcen2424_5397 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6028"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75090"
FT                   /db_xref="GOA:B2JVW3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW3"
FT                   /protein_id="ACC75090.1"
FT                   /translation="MQTVSRKPVVIVTAADLAPQALDMLTPFEVVFAGKQPTEDDIVAL
FT                   CAAHKPVAIIVRYGKVNARIMDAAENLQVISKHGSGIDVIDQEAAAARGIAVRAAVGAN
FT                   AAAVAEHAWALILACAKSVPQLDMRMRDAHWDKSTHKSVELDGRTLGLVGLGAIGRRVA
FT                   AIGIAFGMRVIAFDPYAKEAPAGTQLVSLDELYATSDVVSLHCPLTAENRQMLNRDTLA
FT                   RFRRGAILVNTARGGLIDEAALAEALASGQLRSAGLDSFDVEPMTTPHPFRQIPNVILS
FT                   PHIGGVTDAAYVNMGKGAAANVLAVIEQHAHNAA"
FT   gene            569925..570854
FT                   /locus_tag="Bphy_6029"
FT   CDS_pept        569925..570854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6029"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bch:Bcen2424_5396 SMP-30/gluconolaconase/LRE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6029"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75091"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW4"
FT                   /protein_id="ACC75091.1"
FT                   /translation="MFYLISPEVRTAEVFTRMPDKFRKPDVQTDWARANRGGLATDSFL
FT                   EGPVWDPDGYLFVTDIPHGRVFRISASGEWELVVQYDGEPNGMKRFDDTHLLITDYRNG
FT                   LMLLDIARGEVRPFLERRNSERFRGVNDLTFDSRGNLYFTDQGQSGLHDATGRVYRLSP
FT                   DGKLDMLLGNCPSPNGLVLSLDEKVLFVGMTRGNCVWRVPLQADGSVSKVGQFFTSYGP
FT                   SGPDGLTIDSEGRLFVANPGLGRAWVLNHRAEPVEILTSPEGASLTNLCFGGRDMKTLF
FT                   MTESVSGTVLKAQMTIAGPLPKRAQQGV"
FT   gene            570925..572304
FT                   /locus_tag="Bphy_6030"
FT   CDS_pept        570925..572304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6030"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5395 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6030"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75092"
FT                   /db_xref="GOA:B2JVW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW5"
FT                   /protein_id="ACC75092.1"
FT                   /translation="MSISQTLRAEGAARHADAQPVQGIASDDYAASERTLAKAFRRILP
FT                   FIFICYVISYLDRTNVGFAALTMNKDLGLTSEQFGFGAGLFFVGYFLFEIPSNLIMQKV
FT                   GARVWIARIMITWGVFSMATAFVVGPKSFAAARFLLGLAEAGFTPGIYLYFTHWFPGKW
FT                   RAKVTAAFLVGIPVANMVGSPISGALLELGGLHGLRSWQWLLLIEGVPAVILGVACLFL
FT                   LADRPEKAKWLSDEEKSSLARRLALEQDDIGAKHGSKLRDAMTNWRVFVLAFINFCGIV
FT                   GSLGVGLWMPQIIKQFGVEHSVVGWLTAIPYAIGAVVMLWWARVANRSQNRIPYVAGAL
FT                   VVASVALCASTFVDTPVLKLIALCFTVSGILAFQATYWAIPSGFLTGRAAAGGLALIVS
FT                   VGNLGGFVGPSMIGALKQISGGFTLPLLAVSGVLLLGALTIAWLGDPGADAGEAPSAHK
FT                   A"
FT   gene            572350..573501
FT                   /locus_tag="Bphy_6031"
FT   CDS_pept        572350..573501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6031"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bch:Bcen2424_5394 porin, gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6031"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75093"
FT                   /db_xref="GOA:B2JVW6"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW6"
FT                   /protein_id="ACC75093.1"
FT                   /translation="MSFNKASQNANSKSRFMLGAVAAAGVSLSCGAAHAQSSVTLYGIA
FT                   DVGIEHINNTSAGGAQTREVSGNLSGSRWGLKGVEDLGGGMKAIFQLENGFNINDGTTA
FT                   QSTRGLGANAATTSRLFGRQAWVGLSYKGQQLTFGRQNSLLYEQAVAFDPMGASSRYSV
FT                   LSLDYAMAARIDNSAKYTGVFGPVTAQAMYSTRYDTGYGAEVPGAEITGRFFSGALTFA
FT                   QGPLAASVSYEQRNSNTVATNTGSERRATAAASYVIGSVKGFAGYRYLRASNAFLPANP
FT                   IRVANGSDASAANLYWAGAQYSVTPAFVLTATAYYQDVHSTGADPWLAVLSADYLLSKR
FT                   TDVYATAGFAHNKDGSALGVNGYGTVAPGYNQTGVVIGMRQKF"
FT   sig_peptide     572350..572457
FT                   /locus_tag="Bphy_6031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            573512..574558
FT                   /locus_tag="Bphy_6032"
FT   CDS_pept        573512..574558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6032"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bch:Bcen2424_5393
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6032"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75094"
FT                   /db_xref="GOA:B2JVW7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW7"
FT                   /protein_id="ACC75094.1"
FT                   /translation="MQIVHAPHLPVRPEWLSLRDEPVLEPALVIVDAHHHLWDRQTGRY
FT                   LADEFGSDVKSGHRIVSTVYVQCRSMLREHGPDAMKPVGEVEFANGIAAMFASGAYGPA
FT                   RCCDAIVGGADLTLGAELDSVLETMQQVSGGRLRGIRNPLAWHASPEVSSSPVTPPREL
FT                   MTNPAFRQGVRTLGRFGLALDAWVYHTQLDELYALARAAGDVTVVIDHFGGPLGVGPHA
FT                   GQRAEVHAEWARKLARLATLPNTRMKLGGAGMSVFGFDFATRALPPSSTQLADAWRPYF
FT                   ETCVELFGAERCMFESNFPVDKGMFNYRVLWNAFKRLASPMSADEKAALFSGTAASTYR
FT                   LAIPGDNT"
FT   gene            574555..575835
FT                   /locus_tag="Bphy_6033"
FT   CDS_pept        574555..575835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6033"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bch:Bcen2424_5392
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6033"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75095"
FT                   /db_xref="GOA:B2JVW8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW8"
FT                   /protein_id="ACC75095.1"
FT                   /translation="MKTGVTVATSEFEDASRAKGFRSITGVEWRSLSLAGLGWMFESYD
FT                   SFLLSLLLPTLALQFGLSKAQLGLFTSITAAGQIVGGILFGYVSDRLGRVRTALLCVGI
FT                   YSLFSGLIAFAPNEHWFATLRFFGALGMGGTWTAGAALIAETWHASRRGKGGALMQMGL
FT                   PIGAILAITICGIVSGANDGLAGHGWRLLFLIGASPFFILFWIARKTPESPIWLERKHA
FT                   KATLQKHDPASADKLNVRGLLTAFGFIFFLQYLYWGVFTWTPTFLVTVKHLDFVHSLKF
FT                   VLSLQFGAITGFLLFSAFVDRLGRRPMFLAYLLVGAAAVGVYILSSNPLLLMAAIFLTG
FT                   FSVNGIFAGAGPFLAEIIGNTASRGFYMGLAYNGGRLGGFIAPLIIGALASTSGGFVLG
FT                   LATTIVAFVAAAVVVFFAPETRGKALS"
FT   gene            575832..577070
FT                   /locus_tag="Bphy_6034"
FT   CDS_pept        575832..577070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6034"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5391 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6034"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75096"
FT                   /db_xref="GOA:B2JVW9"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVW9"
FT                   /protein_id="ACC75096.1"
FT                   /translation="MSVATQAGLVGRLFPALSEASLRRYLSGQVASVLGSWTQNVTLNL
FT                   LVYHLSESAAILALLNFLLYGPQLIVAPVAGSRISSANAKRATLCVLMTSLLLTGSLFT
FT                   LSILGVLGVKLILAHALAIGVSSAVETPARQVLLLTSLQDSTHTSNAVAMNTMVYNVGR
FT                   MIGPTIAGFVYPTLGPRTSFAIYALALCFMATCVRSIKIASTARPARAESGLRDAVGYV
FT                   LSDAFSARYLPILACIGLFAGSYQTLVPLLADKGFHDAARFTGVFFACAGAGSLSAAVL
FT                   LSSAFGPQASRRFIAWAPWTAVAALAVLAATTDAAGSIPAFYALGFSLTFAATSTNATI
FT                   QRQCPEHVRGGLVGMYGMAYNGTMPFGYLLVGTASEALGVRHTFAVMAVVLACGVVAVI
FT                   AWQRFTDSRSGAQ"
FT   gene            577082..578404
FT                   /locus_tag="Bphy_6035"
FT   CDS_pept        577082..578404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6035"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_5390 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6035"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75097"
FT                   /db_xref="GOA:B2JVX0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX0"
FT                   /protein_id="ACC75097.1"
FT                   /translation="MQTGIMEKSAIERRTLRKVVWRLIPFLMVCYLLAFIDRGNVGMAS
FT                   LQMNHDLGMSAKVFGFGSSLFFISYFFCEVPSNLALQKYGARIWIARIMITWGIVSAAT
FT                   ALVQNATMFYVLRFLLGAAEAGFFPGVLLYLSYWIPASYRARIVATFMVAIPAASFIGS
FT                   PISALLLQMDGFWGLRGWHWLFILEGIPTVLLGIACLFMLTNKPENAKWLDDEERTWLV
FT                   DELATAHKAPKKIPSLPLTQLFRNRYVLCLALVDTCASAAGSTLSVWQPQLLKSFGLSV
FT                   MQTGLLNSVPYAVASVLMVYWGRRSDRLGERRWHTVVPMLLIGVGLFATSLSGSLLPTI
FT                   CMLCAVLVGAYSFKGPFWALATDMLSNSAVAAGLATVNAIANLLGGGLMVNVYGWVKEA
FT                   TGSYALALMPLAILTLASVATLLMLTRKGRASNLTGKTETI"
FT   gene            complement(578567..579409)
FT                   /locus_tag="Bphy_6036"
FT   CDS_pept        complement(578567..579409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6036"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A3472 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6036"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75098"
FT                   /db_xref="GOA:B2JVX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX1"
FT                   /protein_id="ACC75098.1"
FT                   /translation="MQEQRKTVLTERVASRWVRAHTALVLFFLIAPILAIIPLSFNSGS
FT                   YFSYPLQGISLRWYEQALTSADWQRALLNSIGIGAASTLIATCLGTLAALGLSRSQFPL
FT                   RSLIMPIIISPMIVPIVVVAAGFYLIFAPLGLVNSYPGVVLAHAALGTPFVVITVTASL
FT                   LSFDQSLLRAASGLGAKPWIAFRRVTLPLIAPAVATGSVFAFATSFDEVIVILFIGGPD
FT                   QTTVPRQMWRGIRDSIDPSILAVATILIVFAVLLFASINWLRSRAADASEMRISGSQC"
FT   gene            complement(579440..580705)
FT                   /locus_tag="Bphy_6037"
FT   CDS_pept        complement(579440..580705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A3471 ABC
FT                   spermidine/putrescine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6037"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75099"
FT                   /db_xref="GOA:B2JVX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX2"
FT                   /protein_id="ACC75099.1"
FT                   /translation="MTTSLPVSAQTAAPGSPSRAGGHASFQKARRRASTQALLLALPLI
FT                   LFLLSTFIAPIALLLARSVQNREMPDSMPALTRALDAWDGRGTPDEHMFALLASGLKEA
FT                   QETGQLGTVARRLNFAQPEFRSLLMRSARHLPARPQPAWKPALVELDERWNSPETWRVM
FT                   KRAAASPTPDYLLAAVDAQITPQGSVGFVPDNASVYRQAFLRTMSISATVTFLCLLLGY
FT                   PVAWMLANLPAKSSNRLMLLVIVPFWTSLLVRTTAWYVLLQPGGVINSLLTGLGLTTHP
FT                   VPLIFNRAGVLIGMTHVLLPYMILAIYSVMKSVSPVYVRAAQSLGAHPFTAFVRVYVPQ
FT                   TLPGVGAGCFLVFVLALGYYITPALLGGAGDEMISQLIAMQTNTQLNWGLAGALSAYLV
FT                   IFTAIFYFIFNRIVGIDRLRFG"
FT   gene            complement(580731..581786)
FT                   /locus_tag="Bphy_6038"
FT   CDS_pept        complement(580731..581786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6038"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_A3470 ABC spermidine/putrescine transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6038"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75100"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX3"
FT                   /protein_id="ACC75100.1"
FT                   /translation="MRTPINAQRAALAALSVFAFAAAHASAAETLSVVTFGGAYEAAAK
FT                   KAYFEPFTQATGVGFSTESYDGGLAKLSAMEQAKNTTWDLIDLETNDAITACDEGLLKK
FT                   FDKTTLGKTSDFIPGSISDCAVASMVWSTVFAYDASKLKTAPTSVNDFFDLQKFPGKRG
FT                   LRKSPKVSMEWALIADGVDPNDVYKVLATPAGVDRAFRKLDTIKKNIVWWESGAQAPQL
FT                   LADGAVVMTQAYNGRIDDAAKKDNKPFKAVWDAQVYDFDWWGIPTGARHSDTAAKFIVS
FT                   ASQPKAYADLSKYIAYAPPRKDAIALVDKQRLTDLPTAPQNFKRALQINASFWADNADQ
FT                   INKRFQTWLTQ"
FT   sig_peptide     complement(581703..581786)
FT                   /locus_tag="Bphy_6038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.716 at
FT                   residue 28"
FT   gene            complement(581788..582975)
FT                   /locus_tag="Bphy_6039"
FT   CDS_pept        complement(581788..582975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6039"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: bxe:Bxe_A3469 ABC spermidine/putrescine
FT                   transporter, ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; TOBE domain protein; Transport-associated OB
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6039"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75101"
FT                   /db_xref="GOA:B2JVX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX4"
FT                   /protein_id="ACC75101.1"
FT                   /translation="MSNPPYISFSGVSKSYDGAHFVVDDLNLDVRKGEFLSLLGPSGSG
FT                   KTTTLMMLAGFEGPTQGEIRLDGRRLDDKPPHLRDIGMVFQNYALFPHMTIAENVAFPL
FT                   SVRHVSRAEQKSRVQRALDMIELPHLANRRPAQLSGGQQQRVALARALVFEPSVVLMDE
FT                   PLGALDKRLRETMQYEIMRLHRELSLTIVYVTHDQAEALTMSDRVAVFSDGRIQQAATP
FT                   SELYENAQNAFVANFVGENNGLTGRVVDVSDDRATLALADGSIIRGRCESGLREGDEAM
FT                   LALRPERAHIPSAEGTHADGHSNVVRARVEELVYCGDHHRVHLKLGSRDAIVVKVPNTQ
FT                   RHALPSPGDTVEVAWRHDDCKILAMTASALRSAPANYSSTYPIPSIMTTAPAGAN"
FT   gene            complement(583008..584156)
FT                   /locus_tag="Bphy_6040"
FT   CDS_pept        complement(583008..584156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6040"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bxe:Bxe_A3468 putative iron-sulphur rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6040"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75102"
FT                   /db_xref="GOA:B2JVX5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX5"
FT                   /protein_id="ACC75102.1"
FT                   /translation="MANPARTISLQALMDDLQTGCERSFSEARSMPPGVYTSAEFLAME
FT                   ERNIFAHEWLCVGRASALSEPGDYLTARIATQPIVVLRDEQRQLKAMSNVCLHRMSVLL
FT                   EGRGNVRRIVCPYHAWNYSLDGALKGAPLMDRQADFCKESYRLPAVRCEEWQGWIYVTL
FT                   DDSAPPVHAQLAELNELIGAYGMSGYIETFYEEHVWDTNWKILAENFMESYHLPMLHRA
FT                   TVGPHSRLEEMECPPGLPAFNYHWITKEASLPIGNAHPDNTRLTGHWRKTTALLAIYPT
FT                   HLVTLTPGYFWYLVLQPEGVGRVHIRFGGGLAPEFIADPQAQAHMDTLKKLLDDVNAED
FT                   RRGVEAVFRGVHAPLAKPGHLSHLERPNYDFARYLAAKLRTH"
FT   gene            complement(584357..585283)
FT                   /locus_tag="Bphy_6041"
FT   CDS_pept        complement(584357..585283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6041"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_A3467 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6041"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75103"
FT                   /db_xref="GOA:B2JVX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX6"
FT                   /protein_id="ACC75103.1"
FT                   /translation="MENHPLRYSLRQLRYFVVTAEALSFTAAAKRLHISQPSISTALAD
FT                   LESSFGVQLFIRHHASGLSLTQAGRDLLGQARNLLKIAEELQMTAKEMDGGMTGSIALG
FT                   CLVSLAPPLMPRLISRFASEYAGISFRTVEAHQDGLLRGLHDGSLDIALTYSLDLTEDI
FT                   AFTPLLSLPPYVILPTSHRLARARKVSLADLLHEPYVMLDLPHSREYFAALFDAVGSRP
FT                   VPAFRSSQPEVVRGMVANGLGYSILNFPLKSNRTVDGEDFVVKRFKDTVNATTLGIAQS
FT                   RTMRPRQVVHRFASFCETYIRRLHLDT"
FT   gene            585484..586863
FT                   /locus_tag="Bphy_6042"
FT   CDS_pept        585484..586863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6042"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bxe:Bxe_A3466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6042"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75104"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX7"
FT                   /protein_id="ACC75104.1"
FT                   /translation="MTDGIKPPLRRTLHMAVKTTSIDTLVVGAGQAGIAMSEHLSNIGV
FT                   PHLVLERARIAERWRTGRWDSLVANGPAWHDRFPNREFPEVDPDGFASKEQVADYFVEY
FT                   AKQFNAPIRTGVEVKKVVRNVGHQGFTVETSDGTFEASRVVVATGPFQRPVIPAIAPKS
FT                   ERLTQIHSADYRNPQQLPEGNVVVVGAGSSGVQIADELQRAGRRVYLSVGPHDRPPRAY
FT                   RGRDFCWWLGVLGEWDAEVMRPGKEHVTIAVSGARGGHTVDFRRLAHQGVTLVGLTKSF
FT                   DGTVVTFNADLADNIARGDENYLSLLDAADAYAVRNGLALPEEPEARIIPPDPACLIDP
FT                   IFELDLVEAGVTSIIWATGYAVDFGWLQVDAFDEKGKPKHQRGVSKEPGIYFLGLPWLS
FT                   RRGSAFIWGVWHDAKHIADHIATQRKYLAYYDAAHSHAQPQRETGATEPKVRKVSEMNL
FT                   S"
FT   gene            586917..587354
FT                   /locus_tag="Bphy_6043"
FT   CDS_pept        586917..587354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6043"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bxe:Bxe_A3465
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6043"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75105"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX8"
FT                   /protein_id="ACC75105.1"
FT                   /translation="MSQPTHTRIRMFNTKDTYPNQSLDNDLCQAVRAGNTVYVRGQVGT
FT                   DFDGRLVGLGDPRAQAEQAMKNVKQLLEEAGSDLSHVVKTTTFLTDIRYREPVYQEVGK
FT                   WLKGVFPISTGLVVTALGQAQWLMEIDVIAVIPDGWTPAQA"
FT   gene            587365..588042
FT                   /locus_tag="Bphy_6044"
FT   CDS_pept        587365..588042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6044"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   bxe:Bxe_A3464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6044"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75106"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVX9"
FT                   /protein_id="ACC75106.1"
FT                   /translation="MTFSIVGRCAQTGQLGIAISSSSIAVGARCPWLRAGVGAVATQNV
FT                   TLPALGPQILDLLEHAKLEPAAALDRALGASEWSEYRQVTVIDSRGRTAFFSGKQALGT
FT                   YHAVAGSQCVAAGNMLAGTDVIEAMIPAFGNAPGMLADRLLAAMHAAIAAGGEAGPVHS
FT                   AALKIVGDLIWPIVDLRVDWADDDPVGRLDGLWQAYKPQMLDYVTRALDPTAAPSYGVP
FT                   GDE"
FT   gene            588035..589204
FT                   /locus_tag="Bphy_6045"
FT   CDS_pept        588035..589204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6045"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   bxe:Bxe_A3463 acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6045"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75107"
FT                   /db_xref="GOA:B2JVY0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY0"
FT                   /protein_id="ACC75107.1"
FT                   /translation="MSDTSSRALLERLIGFPTVSRDSNLAMIDFIRHYLGDLGVRSDLF
FT                   YNAGRTKANLFATIGPDEGGGIVLSGHTDVVPVDGQPWTVEPFRLSETEGRLYGRGTAD
FT                   MKGFIASALAAVPTFVARDLRVPVHLAFSYDEEVGCLGVRPMLAELAQRAHKPALCLIG
FT                   EPTELKPVLGHKGKLAMRCQVKGAPCHSAYAPNGVNAIQYAARLVNRLEEIGDQLAAPE
FT                   RHDERFDPPYSTVQTGVIKGGRALNIVPAECEFDFEVRALPGYDATEVADELQTFAQTC
FT                   LLPKMRAVNAATDIRFASLSAYPGLATPPDSDAARLLALLCGSNGFGTVAFGTEGGLFN
FT                   EAGIPTVVCGPGSMDQGHKPDEFVTVGQIAGCDALLARLADYLSTPFGS"
FT   gene            complement(589373..590389)
FT                   /locus_tag="Bphy_6046"
FT   CDS_pept        complement(589373..590389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6046"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bch:Bcen2424_4271 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6046"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75108"
FT                   /db_xref="GOA:B2JVY1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY1"
FT                   /protein_id="ACC75108.1"
FT                   /translation="MAKTNLKALASALGLSRTTVSRALNGYDDVSEATRQRVIEAARAL
FT                   GYQADPTARRLATGRADAIGIVYPFGAGDLGDPRFCEVVAGITEALGERDMDLIIASAR
FT                   PNAELETYRRLVEGRSVDGLIVARTLVNDRRIALLQEWDFPFVAYGRTHSARPYWWFDF
FT                   DNEAGARAATQRLIEFGHRRIGLISAPLAMTFAAQRRAGFISALQSAGIDPSPKLMIEC
FT                   SFDSAGGHDAATTLLNLAKPPSAVLVDNNLAGVGAFRAIVNSGRKPGGDVSLIVYDGVP
FT                   AEVSHPYAVTAVTQPTGHASGKAIAELVLDAIRDRDRCAHRLALPRIEPGNTDGPAD"
FT   sig_peptide     complement(590318..590389)
FT                   /locus_tag="Bphy_6046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.592 at
FT                   residue 24"
FT   gene            590554..592149
FT                   /locus_tag="Bphy_6047"
FT   CDS_pept        590554..592149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6047"
FT                   /product="Levansucrase"
FT                   /EC_number="2.4.1.10"
FT                   /note="PFAM: glycoside hydrolase family 68; KEGG:
FT                   bam:Bamb_3698 levansucrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6047"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75109"
FT                   /db_xref="GOA:B2JVY2"
FT                   /db_xref="InterPro:IPR003469"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY2"
FT                   /protein_id="ACC75109.1"
FT                   /translation="MNVGHHPRVPRITPRLRAHFLSAAVLSAVALPALAQTATPGFPAP
FT                   TPHSQQAYDPESSFTMRWTRADIRQIKAQSHAATAADKNSLPLSLTMPDIPQDFPLINP
FT                   NVWVWDTWPLADMRANQLAYKGWEVIFSLTADPHAGYTFDDRHVHARIGFFYRRAGIPA
FT                   SQRPANGGWTWGGHLFPDGASVKVFGTSPMTDNAEWSGSARLTHGDNVSLYYTATSFNR
FT                   SAPGGADITPPQAIITRADGHIHADDSHVWFSGFDDHQALLKPDGTYYQTGEQNTYFSY
FT                   RDPFVFIDPAHPGKTYMVFEGNTGGPRGARTCTEADLGYAPNDPQREDLNAVMNSGAAY
FT                   QKANVGLAVATNPQLTEWKFLPPILSANCVDDQTERPQIYLKDGKYYLFTISHRTTMAA
FT                   GVDGPDGVYGFVGNGIRSDFLPLNGGSGLVLGNPTDFSAPAGAPYAQDPNQNPREFQSY
FT                   SHYVMPGGLVESFIDAIGSRRGGTLAPTVKININGDTTVVDRTYGKGGLGGYGDIPANQ
FT                   SAPGNGNGQGGNSQ"
FT   sig_peptide     590554..590661
FT                   /locus_tag="Bphy_6047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 36"
FT   gene            592254..592520
FT                   /locus_tag="Bphy_6048"
FT   CDS_pept        592254..592520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6048"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   psa:PST_3743 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6048"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75110"
FT                   /db_xref="GOA:B2JVY3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY3"
FT                   /protein_id="ACC75110.1"
FT                   /translation="MKFWIPELTTRKRPVYLEVVHEIEAAIDAGTLRPGDALPPQRLLA
FT                   DFLGLHVNTVNRALRETARRGLTAGNRRHGTVVSGSSGRERHS"
FT   gene            592517..594151
FT                   /locus_tag="Bphy_6049"
FT   CDS_pept        592517..594151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6049"
FT                   /product="Levanase"
FT                   /EC_number="3.2.1.65"
FT                   /note="KEGG: bpd:BURPS668_A0821 levanase; PFAM: Glycosyl
FT                   hydrolase family 32 domain protein; SMART: glycoside
FT                   hydrolase family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6049"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75111"
FT                   /db_xref="GOA:B2JVY4"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY4"
FT                   /protein_id="ACC75111.1"
FT                   /translation="MIRRHSMHDSQHRFFFSSRVLSSWLFAALAAVTACVPTSSSLAQS
FT                   AADTPQWRSALHYTPQRNWMNDPNGLVYYKGLYHLFYQYNPHGNFWGDMSWGHATSRDL
FT                   IHWDEHAVALRANQTEEIFSGSVVVDARNTSGLGTAKRPPLVALYTSVYKAGSRHEAGV
FT                   QAQSIAYSTDDGMTWQPYVHNPVLTLSPESKQFRDPKVSWFAPGGYWLMATVVADAQVV
FT                   KFYRSDNLIDWTFLSDFTLPDVPHRGALWEMPDLFALPLDGDPSRPKWVMIVNVNPWSI
FT                   AGGSGAMYFVGQFDGTRFVADDVVPASSDPARYQWLDHGADYYAAGTFSNAPSGTAVTI
FT                   GWMSNWDYASHAPTAPWKGAMALPRELALKTIDGRPQLTSVPPSSYVSMVKQRPATRID
FT                   AFDVSSAARDLAPSARGAVQNIDLTIRPGTAHRAGLIVRASANGDVGTRIFYDTSTQTL
FT                   NLDRSRSGNTWFSGAFSKAHIVNLPLHDGRLDLQVVIDRNSVEVFADHGRTVITDLIFP
FT                   APGDDHVRVFAEGGDARFSDVAITDMD"
FT   sig_peptide     592517..592648
FT                   /locus_tag="Bphy_6049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.637 at
FT                   residue 44"
FT   gene            594624..596141
FT                   /locus_tag="Bphy_6050"
FT   CDS_pept        594624..596141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6050"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   reh:H16_A0703 putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6050"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75112"
FT                   /db_xref="GOA:B2JVY5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY5"
FT                   /protein_id="ACC75112.1"
FT                   /translation="MRIARAWLVSTLFGVALCVWCALCTAVQPVSARSAAAPASAASAP
FT                   AAANAARRIDLTNKPWRGDFDAMLQRRMIRVLAPFSRTLYFNDRGHERGVAADTVRDFE
FT                   RFVNKTYADRLGKRPVTVVMIPTTRDRLLPGLAEGIGDIAVGNLTVTDDRLKQADFVTA
FT                   HALKPTRELVLTGPKSPALSTLDDLSGKTVDVRRHSSYYESLVALNTRFRQAGKQPVRI
FT                   VLLPDALEDEDAMEMLNIGLLQILIVDDWKARMWAQMLPQIKVHENIAVREGGVIGWAI
FT                   RKNSPQLQAVISNFYEKFIRKHSVAEIRLKQYVQGVKQIHNNMESAELKRFKQTVAFFE
FT                   KYGQQYDFDPLMLAAQGFQESQLNQDAKSRVGAVGIMQLMPTTGKELNVGDIKVAESNI
FT                   HAGAKYLDQLMTRYFKDAHFSEVDRPLFAFASYNAGPGNIAKMRKEAATRGLDPDVWFN
FT                   NVEVVVAEKIGIETTTYVRNIYKYYASYHLLKEAQAQRTRTVQQLRR"
FT   sig_peptide     594624..594722
FT                   /locus_tag="Bphy_6050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.301 at
FT                   residue 33"
FT   gene            complement(596392..599337)
FT                   /locus_tag="Bphy_6051"
FT   CDS_pept        complement(596392..599337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6051"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_2485 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6051"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75113"
FT                   /db_xref="GOA:B2JVY6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY6"
FT                   /protein_id="ACC75113.1"
FT                   /translation="MTGVKWALLDRLTGLAFHRFSVFIAPFVIALGSIAVMLWEPHQFD
FT                   MGGTVRLTFPVIADSSASLSPANAIVRLRDAAPTARFSTHLAETPFWFMLTTPDATREE
FT                   PAYIDLPSRHAQTLSCWRAGASLTLLGAGDRHGTSGKVRSNKAGFALRVDDAVPHAPIL
FT                   CRATFSGPAYITASVSNEDTLETTALDFHQSAALITGGLLTLAIFVFVTAIINREWTYV
FT                   IFAAWLVGNLRLSANAMGFDTEWLGRIVPPDHIAFLREFTFAAYYLLTTTLFVELFRRE
FT                   LKAIGLRWSLHAVRYGGCVLMAAAFVLDYRHFIPVLWISASFCILVLTYFLFQLVVKAR
FT                   SRTVLWYVASMGIVLIATLSEVLAAALGLKALEGKLSPVVTALSSSMLCAFAIAERMRE
FT                   ERERRREMQIELRNTYDVTPIGLFTLNADNCFVRANPALHTMLGLPLEHYVTHRWADYF
FT                   APGAEGDLYDLLERDESASIEIDGAAGTRADGRRYSLRAIRANGFIEGSLEDVTDRSKA
FT                   IARLHFLAEHDPLTGLLNRLGIEHAIDRQSSQNGPWALAYLDLDRFKVFNDLFGHGTGD
FT                   EILRHVGARLVERLGPHVPIGRIGGDEFVCVLSNMTIDEAIARCREIVDALNSAPVPVN
FT                   TRAFQVRGSIGVVECTEGERVLDALAYADRACRAAKRGGSARLVALRRGAPAFEERTAE
FT                   INLIEALGQRRLPEGLFLVMQPIMSMREPTQALDFEVLLRMRSPDGAVATAGKLIAAAE
FT                   DSGTIVEIDRWVLSTTLAWLSDNRASLINTRFVCVNLSGGSLNDEHFLGELFDLLSRYE
FT                   DVVHLLCIEITESVALHDLEHTERFIARVHDMGAKIAIDDFGAGHTSLRYLKKLSADAL
FT                   KIDGEFVRTMCNHPADIAIVEAMISLAHNLGMRSIAEWVEDLETLRALDELGVDYVQGF
FT                   AIAKPQQTDAILAASCAASFVTNTEITHYLQTERTEQRGAGELRVEREGTV"
FT   gene            complement(599469..600263)
FT                   /locus_tag="Bphy_6052"
FT   CDS_pept        complement(599469..600263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6052"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75114"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY7"
FT                   /protein_id="ACC75114.1"
FT                   /translation="MDRIDSVLLTQNAGYTSLEEVFSQGAVKKTERLPFTIKVVSSLAE
FT                   LDKAVEMRRTAYGRHLPAFADTMEVEELDSSPGTVVLLAQSRLDGGPLGTMRVQTNAFS
FT                   PLAVEQSVDLPDWLRQARLAEATRLGVARGGIGRMVKVALCKAYYMFCVQNSVDWMLIT
FT                   ARSPLDREYEAMLFEDVYGQNEFLPMTHVGGLPHRVMAKPVALVRQRWAKVNHPFLGFF
FT                   FETDHIDIDVRVPSAEHEAGDRTQSGTPAGSAADLLRPLTEA"
FT   gene            complement(600785..601633)
FT                   /locus_tag="Bphy_6053"
FT   CDS_pept        complement(600785..601633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6053"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75115"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY8"
FT                   /protein_id="ACC75115.1"
FT                   /translation="MNVLVEDRTHTAIGLFARRILRTSAVVVAAAIQSTGCGGGGDSVS
FT                   ASGSALVPGRTSPEAAVNPNVVSLDVEFRGKTYTQWTISFWQWALEMPLGPLPHPFDDC
FT                   SRRPISAAQTGNVWFWATPNSSHLTCNQLATTIPAGTSIFLLVLDGASMFLPMFDGPTS
FT                   LNKPPVKTFTAEELKISSAFAGDIRDLFCTIDGAPVANIKAFRTRTGTFSFSAPSPWIF
FT                   GNVGGPGTSIADGYYLLLKPLSAGLHTIHYGGKFVVPAGIFESDESVVGKDVTLLVRVG
FT                   P"
FT   gene            complement(602382..602963)
FT                   /locus_tag="Bphy_6054"
FT   CDS_pept        complement(602382..602963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6054"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   afw:Anae109_2950 putative signal transduction protein with
FT                   CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6054"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75116"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVY9"
FT                   /protein_id="ACC75116.1"
FT                   /translation="MLVKEIMHAAICVGPQDSLIAAARKLRDKRIGCLPVCDGGRALGV
FT                   LTGRDIAVRATAQGRNLTDMTAREVMSVGALCCSLDDTVERAVQLMEQFHVRRLVVLSG
FT                   ETRVVGVISASDICGSLSHSRPLEVVFYKELLDDSGHPHRSELMRVPIASGSREEAAVT
FT                   AIREFEQIRHVRHWRMVADGYELVSVDVDS"
FT   gene            complement(603078..603614)
FT                   /locus_tag="Bphy_6055"
FT   CDS_pept        complement(603078..603614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6055"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75117"
FT                   /db_xref="GOA:B2JVZ0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ0"
FT                   /protein_id="ACC75117.1"
FT                   /translation="MSGNKILVVFFSRTGTTRKIASLLANLLGAQVDEIVASTDRSGPF
FT                   GYVRSLVEALEQRPAQIINSTRDVSSYELVVIGTPVWANSIASPVRAYLIANRSHFKNV
FT                   AFFCSFARRGNRRALDQMRALAGMPALAECSLTAREALRGESSEILREFVERLERNLDA
FT                   FRMSQRPRSTLAAKH"
FT   gene            complement(604391..605071)
FT                   /locus_tag="Bphy_6056"
FT   CDS_pept        complement(604391..605071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6056"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   reu:Reut_A1220 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6056"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75118"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ1"
FT                   /protein_id="ACC75118.1"
FT                   /translation="MDMTTATFNISPLDWHLANCVVERIRHDPSLCDESICVDVRDSRA
FT                   VLRGTVSSYAARIAACEAAEETQGIASVTADLTVEVPQHLRRSDAEIRDSALDALKWRA
FT                   CLPSGAVTVSVCDGRVTLSGQVDWSYQRKLAEKVLVSLPGITSVSNKLRVSDRQIQLEV
FT                   SARIRAALRVAAEKRADAIKVEVRDGVVTLRGQLPVGREHALARSAALCHSDVREVQDA
FT                   LLTS"
FT   gene            complement(605379..605696)
FT                   /locus_tag="Bphy_6057"
FT   CDS_pept        complement(605379..605696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6057"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75119"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ2"
FT                   /protein_id="ACC75119.1"
FT                   /translation="MESLPYPIRYQVFGVSRPSDSSLFIDYVAGSIEQRRANIISLISD
FT                   GADAALKRWCTFGHLSDCDVFEIECLPDQASAEEAVRFWRAYFASLGEEIVSAKHICND
FT                   A"
FT   gene            606020..606439
FT                   /locus_tag="Bphy_6058"
FT   CDS_pept        606020..606439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6058"
FT                   /product="outer membrane autotransporter barrel protein"
FT                   /note="KEGG: bxe:Bxe_C1276 outer membrane autotransporter
FT                   barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6058"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75120"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ3"
FT                   /protein_id="ACC75120.1"
FT                   /translation="MIWPRRSFVAKSNRLWQADLGGGSLGVIAVGTGLRGQWTIETGGC
FT                   RDWQPYGRVNQSRHDWSGGVDMQFGQRPVSSARRRDLDMSCRRRHGAALAAFQHLRTGW
FT                   LPAELGTTDGGNSRGVRGDHGFVKRSGQTLSSSCT"
FT   gene            complement(606422..606610)
FT                   /locus_tag="Bphy_6059"
FT   CDS_pept        complement(606422..606610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6059"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: bxe:Bxe_C0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6059"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75121"
FT                   /db_xref="GOA:B2JVZ4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ4"
FT                   /protein_id="ACC75121.1"
FT                   /translation="MESKSARLTVLIDPVKKEAFEKLCAAQDLTPSQVVRQLIRDYLEQ
FT                   HGVTWKTRSTIGSRTRR"
FT   gene            complement(606760..606987)
FT                   /locus_tag="Bphy_6060"
FT   CDS_pept        complement(606760..606987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_5876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6060"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75122"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ5"
FT                   /protein_id="ACC75122.1"
FT                   /translation="MTEPVDLQPVTLSHAAIWALERLSQPRYGRDTPALSWSITHELIR
FT                   AGFVAVSENGRRATTLTQAGRNFLLGRTRV"
FT   gene            complement(607060..607308)
FT                   /locus_tag="Bphy_6061"
FT   CDS_pept        complement(607060..607308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6061"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ6"
FT                   /protein_id="ACC75123.1"
FT                   /translation="MEYTNQGHLDDAVVLAPAEDSPENVIVFAWKTPSACLLSPDESLA
FT                   RTRLLETMHALNLCKTAIKIEDSNSIDWDERATCAGT"
FT   gene            complement(607333..607650)
FT                   /locus_tag="Bphy_6062"
FT   CDS_pept        complement(607333..607650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6062"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="PFAM: phosphocarrier HPr protein; KEGG:
FT                   bxe:Bxe_B0333 phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6062"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75124"
FT                   /db_xref="GOA:B2JVZ7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ7"
FT                   /protein_id="ACC75124.1"
FT                   /translation="MVDALIRVTARWGVDQAVAAEFAATPATFASDVICAANGRRVNGK
FT                   DAMSVMSLRARRDTPVHILVAGPDERDALENLSAILCASRHRAVLHMQSRPQCSNAVIR
FT                   R"
FT   gene            complement(607707..608204)
FT                   /locus_tag="Bphy_6063"
FT   CDS_pept        complement(607707..608204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6063"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75125"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ8"
FT                   /protein_id="ACC75125.1"
FT                   /translation="MLHRYSERVRKTGKEKIVIDPGAALLSYDHACRLVRDMKGEHGLV
FT                   VVGVGTAGERGFQMLHRFAEISDSLEAHGINIVFVYPKASARHVFDAISIRGIRYRGKL
FT                   CLFLDGDGRLFRKPLPPRAVRAVYLDANMRPVDTTCVMLDNETWNETLSTFLANIVGRR
FT                   LH"
FT   gene            complement(608380..609159)
FT                   /locus_tag="Bphy_6064"
FT   CDS_pept        complement(608380..609159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6064"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bxe:Bxe_C0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6064"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75126"
FT                   /db_xref="GOA:B2JVZ9"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:B2JVZ9"
FT                   /protein_id="ACC75126.1"
FT                   /translation="MPAHFFRTLTGKDRSTEANRRLGFSLAFVAGAANAGGYLAVKQYT
FT                   SHMSGIVSAIADEAVLGDVALVLAGIGSLISFLLGAACSAMLVNWGRRQRLHSQYASPL
FT                   MLEAALLLCFGLVGSHLALRDTLFVPATVVLLCFIMGLQNAMITKLSGAEIRTTHMTGI
FT                   VTDIGIELGKLFYWNVSNDDPASEPVLANRERLKVHSGMLASFFAGGMTGALGFKHVGY
FT                   ASTIPLAAVLTALAIIPLLDDLRERPWRPARKPQSPR"
FT   sig_peptide     complement(609052..609159)
FT                   /locus_tag="Bphy_6064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.873 at
FT                   residue 36"
FT   gene            609609..611618
FT                   /locus_tag="Bphy_6065"
FT   CDS_pept        609609..611618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6065"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bxe:Bxe_C0179 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6065"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75127"
FT                   /db_xref="GOA:B2JW00"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW00"
FT                   /protein_id="ACC75127.1"
FT                   /translation="MASFTILPFVLAVIAGWLVVGGLGLMSLHRTRVVAHALFPAGALF
FT                   GLLLCALGIAGIFSASQEAILPLGLPGLPFHVRLDALSAYFLAMLGMVGAGVSAFSAGY
FT                   FRKGEGTPPGLLCFEYHVCLASLALVLVANDAYLFMVAWETMTLAATFLVMSNHRIPEI
FT                   RRAGYLYFLISHVGALALLLCFGLLQAGTGDYTFASMRQQHLGVFWASIAFVLALLGFG
FT                   AKAGIFPLHVWLPEAHPAAPSPVSALMSGFVLKTGLYGMLRMVFDLLHVQIAWWGVVML
FT                   ALGLFTALFGVVFSAIQTDMKRLLAYSSVDNIGLMFVSMGLAVVFRVFDMPALAALSLT
FT                   ALLYQIASHAAFKSLLFISTGSVLHATGERNLGRLGGLIRFMPWAAWVALLGALSSAGL
FT                   PPLSGFVSEWLLLQSFLFTPDLPNAFLNMIVPLVAALIALVAALAGYTMVKFFGIIFLG
FT                   QPREPKLSHARDASPWERVGFVWLAATCVLLGLLPVQFVAVLDRVTQALVGAGIGPAVA
FT                   RNGWLLLAPTNIGRASYMPLVFLLFFVGCCALAWVLVRRFYHGRLRRAIPWACGHPFVN
FT                   ARMQDTAEGFGQPIREIFAPLFRIERQLPSPSDARPAYRVEVTDRTWAMLYEPIARIVR
FT                   RIAALAGLLQAGRIAVYLMYSFLVLIVLLILVTR"
FT   gene            611615..612565
FT                   /locus_tag="Bphy_6066"
FT   CDS_pept        611615..612565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6066"
FT                   /product="formate hydrogenlyase subunit 4"
FT                   /note="KEGG: bxe:Bxe_B0328 formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6066"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75128"
FT                   /db_xref="GOA:B2JW01"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW01"
FT                   /protein_id="ACC75128.1"
FT                   /translation="MITLSGLASQLIEILLALAAAPLLTGWINMCRAWLQNRRAPSIWQ
FT                   PYRMLHKLFNKESVVAHHASPVFRGAPYVIWGCMTLACAIVPTLSTDLPLSPAADAVAL
FT                   VGLFALARVAISLAAMDIGTAFGTLGARREMLVGFLAEPALLMVLFSASLISHSTLLTH
FT                   IVGTLSHRELAIYPSLAFAGIAFTMVSLAENARLPVDNPTTHLELTMIHEALILEYSGR
FT                   HLALMEWAASLKLFAYSCIGLSLFVPWGIAEAGNPVALLLAIPTLFAKLLVGGVALAVV
FT                   ETTNAKMRIFRVPEFLATAFLLAVIGMLVHFLLGA"
FT   gene            612566..613225
FT                   /locus_tag="Bphy_6067"
FT   CDS_pept        612566..613225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6067"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75129"
FT                   /db_xref="GOA:B2JW02"
FT                   /db_xref="InterPro:IPR038730"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW02"
FT                   /protein_id="ACC75129.1"
FT                   /translation="MHSLATQIINLLAAVLLMVSFAMLSQRRILSLIHLYTLQGIALVS
FT                   ANFVLGFVSQDVHLYVSALLTLVLKVGLIPWILYRLVQRLNVKTDVETLLNIPTTLLIG
FT                   IVLVIVAFNVATPISQLASSVARGTLGIALACVLLSFMMMITRSKAIPQVIGFLSMENG
FT                   LFFAAAAATNGMPMIVELGIGLDVLVGILILGVFMFQIREQFDSLDIHHLEKLKDD"
FT   sig_peptide     612566..612634
FT                   /locus_tag="Bphy_6067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.449 at
FT                   residue 23"
FT   gene            613218..614678
FT                   /locus_tag="Bphy_6068"
FT   CDS_pept        613218..614678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6068"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bxe:Bxe_B0326 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6068"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75130"
FT                   /db_xref="GOA:B2JW03"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW03"
FT                   /protein_id="ACC75130.1"
FT                   /translation="MTEAWIVLLVFGIPLVAGGCLALVGQHRLAPEVNVAFSFLTFIAA
FT                   ILLAAQTVAHGPAFALGKLFFVDPLNVFLVALTAFVGWTTSIFSRPYMRIEQSRGKMTA
FT                   ARMRLYHSMYQLFVFAMLLALLTNNVGILWVAMEAATLATVLLVSVYRTAASLEAAWKY
FT                   FILCGVGIAQALFGTILLYLAASRQLTGGDALLWTSLSGVKGALDPTIMSLAFVFLLIG
FT                   YGTKVGLVPMHNWLPDAHAEGPTPISAVLSGLLLNVALYAVLRCKVLADGALQNGLPGR
FT                   LLVGFGLVSVLVATFSLLRQKDVKRLFSYSSIEHMGLMTFAFGLGGPTATFAGLLHMTA
FT                   HSLVKSAIFFTVGHAAQKARTQMIDDIRGLLRVSPTVGWGMMLGALAILGMPPFGVFAS
FT                   EFLIVTTAIGELPWATPVLLIALAVAFATIFARVQHMVFGETTATPLEHAPALLPVFVH
FT                   LGLGLMLGLYIPPYLAAWYRQAAAMIGG"
FT   sig_peptide     613218..613286
FT                   /locus_tag="Bphy_6068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.618) with cleavage site probability 0.593 at
FT                   residue 23"
FT   gene            614682..616256
FT                   /locus_tag="Bphy_6069"
FT   CDS_pept        614682..616256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6069"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: bxe:Bxe_B0325 putative formate hydrogenlyase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6069"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75131"
FT                   /db_xref="GOA:B2JW04"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW04"
FT                   /protein_id="ACC75131.1"
FT                   /translation="MRIDSLELSDLTRLSASAGRASAWLAHTDAATWVRIAGTAREQGG
FT                   RLISLWGAQAGVEAVAGAFTMSAAYAMHDGLLWVQLPVAMGNEEAAGYPDLSTIFPCAS
FT                   RMQRAVYDLLGLRATGAADSRPWLNHGNWPADYYPLQKLSSGTERFQSEEADYPFVQVS
FT                   GDGVHEIAVGPIHAGIIEPGHFRFSVVGEKVLRLEERLGYTHRGIERLFERTPLLTGHR
FT                   LAGRIAGDTTVAFSWAYCMAVERALNIFVPPRAQWLRAVLLERERVANHLGDLGALGND
FT                   AGFAFGLAQFSRMKEDWLRVNDGMFGHRYLMDQIVPGGMARDIAGQFVGAAIEQCERTE
FT                   DAVRAMQRIYDEQSGLQDRFTGAGKLTANVAAHFSVCGLAARASGLGIDVRVDHPYDPY
FT                   HEVQPHMMSDSRGDVAARVAVRFNEVYESLRLIGVLLDGLPDGAVVAPVETGRPASHGV
FT                   GWVEGWRGDVFVAIETGENGTISRCHCHDPSWQNWPALEHAIIGNIVPDFPLINKSFNL
FT                   NYAGHDL"
FT   gene            616256..616786
FT                   /locus_tag="Bphy_6070"
FT   CDS_pept        616256..616786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6070"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: bxe:Bxe_B0324 putative hydrogenase/oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6070"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75132"
FT                   /db_xref="GOA:B2JW05"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW05"
FT                   /protein_id="ACC75132.1"
FT                   /translation="MWQLLKRIARTDIPAGSVPDTNDAWTTSHQQQIQREILDVLGRAL
FT                   CIRQVDAGSCNGCELEIHALNNPYYNIEGLGIRFVASPRHADMLLVTGPLTLNMKEAVR
FT                   RVWQATPHPKLVVAAGDCACTGGIFRDSYAVCGPPSNLLPVDVAIPGCPPSPFDLLTGI
FT                   LTALRSKPDALAP"
FT   gene            616798..616920
FT                   /pseudo
FT                   /locus_tag="Bphy_6071"
FT   gene            616933..617073
FT                   /pseudo
FT                   /locus_tag="Bphy_6072"
FT   gene            617258..617443
FT                   /pseudo
FT                   /locus_tag="Bphy_6073"
FT   gene            618086..618340
FT                   /locus_tag="Bphy_6074"
FT   CDS_pept        618086..618340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6074"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75133"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW06"
FT                   /protein_id="ACC75133.1"
FT                   /translation="MTRVVATRSTLASLDHITVVQIGALVWKTIQRFPWRRNPAAMLAA
FT                   LALAGTRRWRDIGAEKRARKAGYRWRIAQAHKQQNAYDV"
FT   gene            618359..619456
FT                   /locus_tag="Bphy_6075"
FT   CDS_pept        618359..619456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6075"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: bte:BTH_II0237 PdhA; TIGRFAM: pyruvate
FT                   dehydrogenase (acetyl-transferring) E1 component, alpha
FT                   subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6075"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75134"
FT                   /db_xref="GOA:B2JW07"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW07"
FT                   /protein_id="ACC75134.1"
FT                   /translation="MTTAASFHIGYTQYLGPDGEPVHPLPAFARDPAALLPLYRAMVLT
FT                   RAFDTKAVALQRTGQLGTFASSVGQEAIGVGVASAMHPEDVLFPSYRDHAAQLLRGVTM
FT                   TESLLYWGGDERGSNFSVARFDFPNCVPIGTQVCHAAGAAYAFRLRKEPRVAVALLGDG
FT                   ATSKGDFYEAMNFAGVWGAPLVLVINNNHWAISVPRSRQSAAQTLAQKAIAAGIDGLQV
FT                   DGNDLIAVHHVVAAALAKARRGDGPTLIEALSYRLGDHTTADDATRYRDAEVVSRQWEA
FT                   EPLRRLRAYLIRMNVWDKAREEELGKTCHAQVTQAVDAYLAIAPPDVSAMFDHLYEALP
FT                   LAMREQLAMARRFAPAAPVAENGHG"
FT   gene            619449..620429
FT                   /locus_tag="Bphy_6076"
FT   CDS_pept        619449..620429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6076"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bte:BTH_II0238 pyruvate dehydrogenase
FT                   E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6076"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75135"
FT                   /db_xref="GOA:B2JW08"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW08"
FT                   /protein_id="ACC75135.1"
FT                   /translation="MADLNMVEAVNAALAWELAHDPAVVLLGEDIGVNGGVFRATAGLQ
FT                   ARFGAQRVVDTPLAETAIVGTAVGMAAMGLKPVAEIQFSGFIYPAIDHLLNHASRLRHR
FT                   TRGRLACPLVVRSPAGAGIHAPEHHSESPEALFAHIPGLRVVTPSSPARAYGLLLAAIR
FT                   DADPVIFFEPTRLYRLFRQPVEDSGEALPLDCCYVLRDGADVTLVSWGGALQEVLGAAD
FT                   QLAQEGVMAEVIDVATLKPLDMDTILASVAKTGRCVIVHEGARTGGVGAEIAAGIAERG
FT                   LYSLLAPVQRVTGYDVVVPLYRLESQYMPGIERIVGAIRQALEAQ"
FT   gene            620434..621558
FT                   /locus_tag="Bphy_6077"
FT   CDS_pept        620434..621558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6077"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein; KEGG:
FT                   rso:RSc1799 dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6077"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75136"
FT                   /db_xref="GOA:B2JW09"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW09"
FT                   /protein_id="ACC75136.1"
FT                   /translation="MKIFKLPDLGEGLQEAEIVEWHVKSGEEIRADQPLVSVETAKAIV
FT                   EIPSPQSGRIAKLFGKPGDIVHLGAPLAAFEGDSEGGGDADAGTVVGHMEVGAQRMEEA
FT                   PAAPGSGTGAGPGAIRAIPAVRALARKLDIDLAMVTPSGPEGVITAADVQRAAKLFADL
FT                   GPAEVLRGVRRAMAQNMARAQCEVAAATVIDDADIHAWPPHADVTMRLIRALVAGCRAE
FT                   PGLNAWFDGRMAQRHVLEKIDLGIAVDLPDGLFVPVLRDVAHRDAAGLRAGLDRMRADI
FT                   RARKIPPEEMRGNTITLSNFGMIAGKYAAPVVVPPTVAILGAGRMHDQVVAYQGAPAVH
FT                   RILPLSLTFDHRVVTGGEAARFLAAVIKDLEMAQ"
FT   gene            621888..622460
FT                   /locus_tag="Bphy_6078"
FT   CDS_pept        621888..622460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6078"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: psb:Psyr_0741
FT                   regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6078"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75137"
FT                   /db_xref="GOA:B2JW10"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW10"
FT                   /protein_id="ACC75137.1"
FT                   /translation="MRKSKAETADTRRRIVEVAAREFRANGIQTTGLADLMSAAGLSHG
FT                   GFYRHFESKDQLVAEACEAGLAAIIAKLEAAAGESAGKEGFDAIVDAYVSASHRDAPAD
FT                   GCPLAGMGSELARADDATREAAAKGFDDLVGVLAKRSSRRRKEAAHAEAVFALSAMIGA
FT                   VTMARVVQDPDASANILRDVRHHLNAM"
FT   gene            622574..623452
FT                   /locus_tag="Bphy_6079"
FT   CDS_pept        622574..623452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6079"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: mlo:mlr1895
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6079"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75138"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW11"
FT                   /protein_id="ACC75138.1"
FT                   /translation="MQQRKFLITGATGKTGVHTIRHLLRDGHAVRAFVHSEDARSEALR
FT                   AQGAEVVVGDLLEHDDIIRAMDGVTGAYLCYPVRPGFIQATAYFADAARRAGVDVVVEM
FT                   SQISAREDSKSHAARDHWIAERVLDWSGVPTVHIRPTFFSEWMIFPWVRDQIVEEGRIT
FT                   LPYGDGRHAPIAGEDQARLIAAVLATPSAHIGKTYGLFGPVELSQQEIADEMSEVLGRK
FT                   IVYRPSTMEQYRTHLEKYQLPEFMIQHFLAIAVDYQNGIFSGADGVIGEITGQAPQTVS
FT                   DFVSMHRQEFA"
FT   gene            623974..625005
FT                   /locus_tag="Bphy_6080"
FT   CDS_pept        623974..625005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6080"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_C0087 ABC taurine transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6080"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75139"
FT                   /db_xref="GOA:B2JW12"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW12"
FT                   /protein_id="ACC75139.1"
FT                   /translation="MNHTFSSLRRALNAATLVVASAATVSPVHAETREVVIGYQDMVVP
FT                   WRYAQVTGAVEKATGYKVTYRKLDSGADVIRALASGSIQLGEAGSSPIAAGLSQGVDLS
FT                   LFWILDNINDAEALVARDGSGVKKLTDLKGKTIGLPYVSTSHFHALVALQQAGVDPSTV
FT                   KILNLRPPEVAAAWQRGNIDATYIWDPVLAKVKQNGKVLITSGEVAKESGKATFDGFVA
FT                   ARQFERDNAAFMTGLVKVLAGTDAQYREHKAAWTPASKEVQAVARESGATPADVPASLA
FT                   LYAFPTAAEQASPTWLGGGKQSGAAASLAATAAFLKTQGTIQNVLPDYSGAVNPRFAQQ
FT                   AAR"
FT   sig_peptide     623974..624066
FT                   /locus_tag="Bphy_6080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            625002..625781
FT                   /locus_tag="Bphy_6081"
FT   CDS_pept        625002..625781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6081"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_C0086 ABC taurine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6081"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75140"
FT                   /db_xref="GOA:B2JW13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW13"
FT                   /protein_id="ACC75140.1"
FT                   /translation="MSALEIRGVGVTYDGADEPALAGVDLRIDSGEFVVALGASGCGKT
FT                   TLLNCIAGFVDPTEGEVRLNDAPIEGPGAERGVVFQKHALMPWLNVLDNVALGLRFRGV
FT                   ARDERHEIARRTLALVGLERHANAKVYALSGGMQQRVGIARALASDPQVLLMDEPMGAL
FT                   DALTRETVQELVLDVWSRTEKTVFFITHSVEEALFLATRLVLMTPGPGRVAQVHELPFA
FT                   REYLASRDARAVKSSAAFIEWRERLTRRLHETVREAA"
FT   gene            625781..626671
FT                   /locus_tag="Bphy_6082"
FT   CDS_pept        625781..626671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6082"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0085 ABC taurine
FT                   family transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6082"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75141"
FT                   /db_xref="GOA:B2JW14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW14"
FT                   /protein_id="ACC75141.1"
FT                   /translation="MNSIGSSRPSVEGRLSGAHRGNAYAGAARPRKRKANRGMPGEGPT
FT                   AALSTLCVAALLLMWWALSHFGWVPPLFLPSPDAVRRAFADAWNGRIQGGLPLSEHLMW
FT                   SAIRVFGAFALACVTAVPIGVLMGVSRVARGLLDPPIEFYRPLPPLAYLPLVVIWFGID
FT                   ETAKLVVIWLACFAPIAMAARAGVRSAAVEQINAAWSLGANFRQVVLHVVLPAASPEIL
FT                   TGLRIAIGFGWTTLVAAEMVAATAGLGQMVLNASSFLRTDVVVMGIVLIGAIAWLFDLG
FT                   MRVLERKLVPWKGKQ"
FT   gene            complement(626687..627637)
FT                   /locus_tag="Bphy_6083"
FT   CDS_pept        complement(626687..627637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6083"
FT                   /product="agmatinase"
FT                   /note="TIGRFAM: agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: pfl:PFL_0325
FT                   agmatinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6083"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75142"
FT                   /db_xref="GOA:B2JW15"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW15"
FT                   /protein_id="ACC75142.1"
FT                   /translation="MTGTDLAQMQQPRFAGIPTFMRVPFSTDPNTFDIALAGVPFDGGV
FT                   TARPGARFGPREIRNMSTMMRGIHHVTRFNPFDACRVADIGDVPFTDLYHLERAHDDIR
FT                   RFFEPVFRAGKLALTAGGDHSITYPIFQALAPREPVALVHIDAHTDTWDSFKGSKFTHG
FT                   APFRRAVEAGLLDPKRTIQIGIRGAQNSDEGWRYSLDHGMRVVFIEEFDVLGPAAVAAE
FT                   ARRIVGDAPVYLSLDVDGLDPVFAPGTGTPEVGGLTTRETQALLRGLDGLNWVGGDVVE
FT                   VSPPYDPSGNTALVAATLMYEILCLLAKRASEANR"
FT   gene            complement(627692..628396)
FT                   /locus_tag="Bphy_6084"
FT   CDS_pept        complement(627692..628396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6084"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: har:HEAR3251
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6084"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75143"
FT                   /db_xref="GOA:B2JW16"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW16"
FT                   /protein_id="ACC75143.1"
FT                   /translation="MATRKTSTSSNGAARRPSSLAPRRAAQAPRAAASHSAPGAAAEGL
FT                   GTRLRHARMVQQLTLKALAEQAGCSESLLSKVEGGHATPSLATLHRIALALDTNIAALV
FT                   SGPVATVTPIQRASERPSVRFPGAQQTAGRHARARSSIMLERLVVAGPGQLLQGDIHVL
FT                   EPLARSDEQISHAGEELGYVLEGELELTLGSECYRLQAGDSFYFPSTEPHSYRNPGDVI
FT                   TRVLWINTPPTF"
FT   gene            complement(628442..629158)
FT                   /locus_tag="Bphy_6085"
FT   CDS_pept        complement(628442..629158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6085"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75144"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW17"
FT                   /protein_id="ACC75144.1"
FT                   /translation="MSTTATDSHTHTHAHPGDDNGTELGQNATLHEPISADGTPEPGKT
FT                   YTVPARCGRAVRVKAGQTIRISNPHGTQVCDTWIFNATHLNEFLSFEHTRAYIDKIIPQ
FT                   PGDPLVTNHRRPIAELVADTSPGVHDTLIAACDLYRYQNLGVERYHDNCADNLRLALKA
FT                   IGMRTREVPQPFNLWMNIPVKPDYTIEWLAPVSKAGDHVDIKAAMDCIVVMSACPQDII
FT                   PINALNPVEVEFTVLA"
FT   gene            complement(629171..630436)
FT                   /locus_tag="Bphy_6086"
FT   CDS_pept        complement(629171..630436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6086"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: yen:YE0805 putative amino acid hydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6086"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75145"
FT                   /db_xref="GOA:B2JW18"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW18"
FT                   /protein_id="ACC75145.1"
FT                   /translation="MMRTDQPAHDDVARRAAESIDETRLLASIETLAAFGARPDGGVNR
FT                   PALSATDLDARRYLVERAHALGCAVSTDACANLFIRRPGIDDAPPVMTGSHIDTQPSGG
FT                   KLDGCYGVLAGLECIAALNDAGLSTRRPLDVAIWTNEEGTRFAPGAMGSSAFVEPARMP
FT                   TYLDAADAGGVTLRAALESHRRTLPELPSRGDAPPAHAFVELHIEQGPQLENADVPLGV
FT                   VTGIQGVRWYAFHCEGVAAHAGTTPMPMRRDAMTLAVALRASLEEIAVSLGGEHTRVTF
FT                   GRWSVTPNSINTIPSDVTFSVDFRHPDAHVLDTFDTLVAACARRHGARIAPLFAHTPVR
FT                   FDCEVLARLDAACRALDAPALRLTSGAFHDAMYLAQHCPTAMLFVPSRDGISHNPAEAT
FT                   DARHLVLGARALAHTLTTLCND"
FT   gene            complement(630433..631275)
FT                   /locus_tag="Bphy_6087"
FT   CDS_pept        complement(630433..631275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6087"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE0804 ABC transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6087"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75146"
FT                   /db_xref="GOA:B2JW19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW19"
FT                   /protein_id="ACC75146.1"
FT                   /translation="MSAQPILKLRAVGKSYGATRVLKGIDLDVMRGEIVTLIGPSGSGK
FT                   TTALRCMNFLEPYDEGEVWIKGQLLGYRCTGRTLRDRDSEASVAEVRRPVSMVFQQFNL
FT                   WPHMSVLDNVAAPLVLAKKMRRADARDKARAALARVGLQHKADVYPARLSGGQQQRVGI
FT                   ARALAIEPEVMLLDEPTSALDPELVEEVLNVIRSLAQDGMTMVMVTHEMSFAATISDKV
FT                   VFMEAGQIVESGPPAQLFGNSRTPRLQQFLKPWFDRSLSVTAPAGRADSVEQTSGASS"
FT   gene            complement(631272..631937)
FT                   /locus_tag="Bphy_6088"
FT   CDS_pept        complement(631272..631937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6088"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: yen:YE0803 ABC
FT                   transporter, inner-membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6088"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75147"
FT                   /db_xref="GOA:B2JW20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW20"
FT                   /protein_id="ACC75147.1"
FT                   /translation="MDNLLALVPRFADAMLVTLEVSLIAAVLGMGGGFALNGLRLRYAR
FT                   VLAAPYRVFVWLIRGMPYLSQLMIVYFGLPAFGITMTAVQATVVSLAIYASAYFAEIFR
FT                   AAWASVPRGQIEAAQAFGVSRWAAFRAIELPQALAFAVPLLANQIILVIKESAVASVIT
FT                   VPELTMTASDIVASTYTYVGPYTLLIVSYWLLTQAVSLLVQRATAMIPFLQNATNQAT"
FT   gene            complement(631953..632615)
FT                   /locus_tag="Bphy_6089"
FT   CDS_pept        complement(631953..632615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6089"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: yen:YE0802 ABC
FT                   transporter, inner-membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6089"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75148"
FT                   /db_xref="GOA:B2JW21"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW21"
FT                   /protein_id="ACC75148.1"
FT                   /translation="MNAPDLLARCTAYLPQLLDGALTTLWLSAAAVFCGFFAGLFIYTM
FT                   SASDSPLPAGAARVYVSVFRGTPVLAQLLVMYYLPSALGLALPGIVAAAIGLSMNTAAY
FT                   QSQILGAGFRSIARGQIEAAVTFNLTRRQVLWHIEVPQVVRVTLPALVSEMIDIVKASA
FT                   VVSVISVTDLMRVGQQLSSSTYRPLEVYTCAALFYLAITTLLSFAAHCYERRAASRA"
FT   gene            complement(632634..633491)
FT                   /locus_tag="Bphy_6090"
FT   CDS_pept        complement(632634..633491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6090"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: yen:YE0801 ABC transporter, solute-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6090"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75149"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW22"
FT                   /protein_id="ACC75149.1"
FT                   /translation="MNKPLRSLVFSLLGGLALVTATPGWSQTDDLLARIRTNKEITIAT
FT                   EARYAPFEYVDNGKIVGYDADLMAYVLKSIPDVKVKQLDLPFQGLLPGLDAKRFDIVVT
FT                   AVTVNKDRVNHFAFTVPVADATTGVLLRNGDTSIKSPEDLNGRIVGSQTGSAQLQALQA
FT                   LDKKLKDAGGPGIKQIKQYVAFDEAYADLAVGRLDAVAQSVANLGPLMKSRPGVFALLP
FT                   QTIGPKSYFAWVARKDSDSAALVKLFSDGIARANRDGTMKKLQEKWFGSTMDVPVDAVP
FT                   APSI"
FT   sig_peptide     complement(633411..633491)
FT                   /locus_tag="Bphy_6090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 27"
FT   gene            633800..635452
FT                   /locus_tag="Bphy_6091"
FT   CDS_pept        633800..635452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6091"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bxe:Bxe_C0847
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6091"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75150"
FT                   /db_xref="GOA:B2JW23"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW23"
FT                   /protein_id="ACC75150.1"
FT                   /translation="MAGPFVLTTGETLPAPSSRRARCFALMFRNTTIRGGLAATISGFT
FT                   LLLMLVIAAAVFALFKSNAALDAMYRDDTASVVHLKTSSERLLVFRAGLADVEQLISAG
FT                   KPAAAEIKQLHALLGESNRELDAYRALHAPDAQETTLLEAMTGKRDRLLAQAFSKALKQ
FT                   LDEENLVDFLTTQREMPVALFDEYQKALISLEDFQVQRQRMRFDHANVRFHMALCGFGV
FT                   AGLIALIVGVLAHRALTRAIVTPVNAAVDYFAKIAAGDLTAVVKTERRNEMGYLLDSLN
FT                   DMQQGLVAVVRKVRAGTDAIMHDAQAIASGNRDLSMRAGDQAASLQQAAASMEELTATV
FT                   RQNADNAHDASALATRASEIATRGGEVVRQVVDTMDAISDSSARIVGIVGVIESIAFQT
FT                   NILALNAAVEAARAGDQGRGFAVVASEVRHLAQRSATAAKEIKELIGNSTVSVRAGSEL
FT                   VLRAGSTMDDILKAVQSVNAIMADISLASREQTAGIELVNATVVQMEAMTQSNASLVES
FT                   ASTTAASLEAQSEHLHGAVAIFRVSGDGNNIFQ"
FT   gene            635863..636795
FT                   /locus_tag="Bphy_6092"
FT   CDS_pept        635863..636795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6092"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; Cupin 2 conserved barrel domain protein; KEGG:
FT                   pna:Pnap_2708 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6092"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75151"
FT                   /db_xref="GOA:B2JW24"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW24"
FT                   /protein_id="ACC75151.1"
FT                   /translation="MANDQQRRRTVLHFALYGAEADLPWVDMVHYERIPLRAGRFDFDI
FT                   KPHVHDALIQVLYVIAGGGETFIDGKTWAVEAPCLIVVPARSVHGFHFRSDIDGHVITA
FT                   AQSALESLAMTAAPELLEFIRTPTVLSIDPDVERGTPLDTLFQSIGHEAESHERWQFTA
FT                   GAALTIALFVKIGRLSESARLSASSERPSMVARIERFRALLDRHCRERRPVASYADEMG
FT                   VSTGQLSRICRATFGVSAIEAIDARSIHEAKRLLGYSTLSVKQIASELGFQDEAYFGRF
FT                   FRKQTGLRPTEYRAAAHDRSLPPAKGRAG"
FT   gene            complement(636820..639609)
FT                   /locus_tag="Bphy_6093"
FT   CDS_pept        complement(636820..639609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6093"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; cytochrome P450; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; Oxidoreductase
FT                   FAD-binding domain protein; GntR domain protein; KEGG:
FT                   rha:RHA1_ro02386 benzoate 1,2-dioxygenase reductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6093"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75152"
FT                   /db_xref="GOA:B2JW25"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW25"
FT                   /protein_id="ACC75152.1"
FT                   /translation="MPHQITLRFEDGVTRFIECEEEERVTDAAIRARTNIPLDCRDGVC
FT                   GTCKAVCESGEYVLGDCVEDALSPEEANTRKVLTCQMSPRSDCVIEIASGSDVSGTGPS
FT                   SHRGRIVSCQRASDSTIAFSVELDNRADLSFLPGQYVNIRVPGTDQTRSYSFSSGPSDP
FT                   HLSFLVRNVRQGVMSTWLCESAKAGDPIEFRGPMGSFYLRAIERPVLFLAGGTGLAPFL
FT                   SMLDKIVEDGGSPYPIHMILGVNSDEDLVGIDRLDTYAQRLPNFTYACTVVSPASAHLN
FT                   KGYVTHHINAAQLNDGDVDVYLCGPPPMVDAVRTFLLSEGLTPRNFYYEKFAGTGLVVQ
FT                   TGDERIAPVDVDEAFDLRMALELGAAQLTMGRLSSAQLIDFRQLAEATAPFVSGRHFTD
FT                   VRRYIEANHAFHMFTVEASGNAQLIARYRELAVQDYIARTLTDRIKIVGDIVQQHRDIV
FT                   AAFELGDLNAARDVIALHARHSKATMSRALAHMTLDNTAPSVAAPPAPTPAVPQSAPQI
FT                   CPFAGTTLPPYSHELDWPEGLEPFKVVDDGSQGDPYEHYRWMREHAPVLRCQSATSDVW
FT                   FLSRYDDVYQAIRNPKLFSSEVVSPPPLTFLTLFDAPDHSRLRKVVQPSFLPLSLDPFV
FT                   EQIAQRAEDLLDAMIARGGGDVVNDFAIPLSISTISTMIDVPNEDEEKMKFWSDETFSY
FT                   FGRLARNAPGTGTDEQSAQAFFAYLKEAMERLALTGSQSIGGHIARMWKDGLLSEKEAK
FT                   ELCAFVFIAGHDTTTILVANAFRMFTEQPHLLGRIRENPADADRFVEEVARYRGTVQRV
FT                   SRITTEATTVAGVDLPKGAVVRLLLSAANRDSRKFPEGETFDIDRDTNGHLGFGNGMHK
FT                   CLGAPLAKLETLIATKALARKVGDIALDPARPIQYVRGNNLTNSGPEHLFVKLGGLSV"
FT   gene            complement(639900..641669)
FT                   /locus_tag="Bphy_6094"
FT   CDS_pept        complement(639900..641669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6094"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: vei:Veis_2182 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6094"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75153"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW26"
FT                   /protein_id="ACC75153.1"
FT                   /translation="MNSGSSIHWDEEVDVLVFGAGAGGMTTALIAHHEGLDVLLCEKTD
FT                   AVGGITSTSGGTTWVPGTQLSVDAGVPDSVDDARRFLQSVVGERGGDEAREAFLQSGPR
FT                   AIDELQRISDVKFVAAAAHPDYVTGPGAAFGGRALAPVPFDARVLDKDFSRVRPPRKEF
FT                   MGLGGMMVNRSDLGALLNPFASVSNFRRTVEVVGRYVIDRMRFPRGTQLVMGNALAARL
FT                   FYSLRKRGVAVRFEAPLIELVSEQGCVTGAVVGSRDGKQRRIRARRGVVLATGGVTRHP
FT                   ALRKQLFPLAAQPLSLSPDTHTGDGVSSALAIDARLENGGDSPGLWMPCSIRRSPNGDD
FT                   SVWPHIILDRAKPGLIAVNTRGERFVNESNSYHDFVMGMLRDDGNGTSVPAHLIVDAGF
FT                   IREYGLGLLMPGRSRARIAAFEHAGYLVKGDTLAALATKLNVNAAGLAGTVERYNRDAA
FT                   LGNDPAFGRGSSPMSRFNGDPAQKPNPCIRPLDKGPYYAVTVWPADLACSAGLGGTANG
FT                   EVLDVNGNVIPGLFACGNDLASIFRGTYPGPGTTLGPAIVFGWRVAKFIAGKLSGDTPT
FT                   SHTRADVCTSESR"
FT   gene            complement(641844..643061)
FT                   /locus_tag="Bphy_6095"
FT   CDS_pept        complement(641844..643061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6095"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_C7566 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6095"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75154"
FT                   /db_xref="GOA:B2JW27"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW27"
FT                   /protein_id="ACC75154.1"
FT                   /translation="MKRSSEFKQLALGAAMFTAMPAFAQSSVTLYGVVDTGIAYQNSQT
FT                   TLGSTANGHSAIKMVTGVWAGSRFGLKGAEDLGSGTKAIFTLESGINSTTGAQQYTNAM
FT                   FGRQSWVGFTNPAYGSLTFGRQYASYYQLLSPYSPTNWLTGFFGAHPGDIDGLDTIYRA
FT                   NNTIEYTSPKLYGFTFSGSYSLGGVAGSLNSGSTWAGAIQYANGPIGLAVGFSRINNST
FT                   TGGGAFGADSTTSNNGAQAGVSALTNGYQTAQAQQRFAVGGSYTFSSAWDVSATYSNVQ
FT                   YIPGIGSKFTDTAIFNTGGIVLHWKPAVAWDFGAGYSFTRATKANGITSAAQYQQFNLS
FT                   QYYALSKRTGFYALEAYQRANGKTLGTAGASQIIDATATLGDGFNSAPSSTRNQFAAGV
FT                   GVVHRF"
FT   sig_peptide     complement(642987..643061)
FT                   /locus_tag="Bphy_6095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            complement(643114..643863)
FT                   /locus_tag="Bphy_6096"
FT   CDS_pept        complement(643114..643863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6096"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bja:bll3655 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6096"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75155"
FT                   /db_xref="GOA:B2JW28"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW28"
FT                   /protein_id="ACC75155.1"
FT                   /translation="MSVAQRVAVVTGGAGGIGRAIAARLQRDGLRAALWDLDARAAREA
FT                   ADALSNGRNDVVIGVHADVTDEASVAAALNTTLDRFGALHVLINSAGTTGPIATGADSA
FT                   LGAWQRCIDVNLRSVFLCSRAAVKPMLDAGFGRIVNLASIAGKEGNPSMSAYSAAKAGV
FT                   IAFTKSMGKELALTPVRVNCIAPAVIETPLLQQMTDDALAASLAKIPMQRAGTADEVAN
FT                   LAAWLASDTCSFSTGATFDLSGGRATY"
FT   gene            complement(643860..644702)
FT                   /locus_tag="Bphy_6097"
FT   CDS_pept        complement(643860..644702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6097"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: pna:Pnap_2706
FT                   shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6097"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75156"
FT                   /db_xref="GOA:B2JW29"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW29"
FT                   /protein_id="ACC75156.1"
FT                   /translation="MTQATATHVAVSLDEGLSGATRVYFIVGDPIAQVRSPKGVTAALR
FT                   EAGRDALVVPAHVAPDDLPAFFAGVAPMRNVDGVIITVPHKFSAAGFCSSLSEEAAFLG
FT                   AVNTLRRAADGGWHGGMFDGTGFVAALEDAGCDLQGKRALLIGAGGAGSAIGQALVKAG
FT                   VASLDVRDNDAERTGSLVKRLAAMQRGAVQVATADVDAASYDVVVNASPMGMRADDPLP
FT                   IDVSRLPSSTFVGDVVTKPPLTPFIEAARARGCKTVTGTQMFGRVCDRMVDFLLDAKA"
FT   gene            complement(644699..645094)
FT                   /pseudo
FT                   /locus_tag="Bphy_6098"
FT   gene            complement(645103..645606)
FT                   /pseudo
FT                   /locus_tag="Bphy_6099"
FT   gene            645772..646809
FT                   /locus_tag="Bphy_6100"
FT   CDS_pept        645772..646809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6100"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bja:blr3664 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6100"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75157"
FT                   /db_xref="GOA:B2JW30"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW30"
FT                   /protein_id="ACC75157.1"
FT                   /translation="MARRRLAVIGAGAIGRMHVERARLHPQAEVVAIADPSPAACEFAQ
FT                   QEGLRWFADYASMLDEARPEGAIVATPNATHVDVGLACIARGIPALIEKPIADDVNAAQ
FT                   QLSRAADEAKVPLLVGHHRRHNPILRRAREIIASGRLGKPVTANALATFYKPDAYFHVE
FT                   WRRRAGGGPVLINLIHDIDIMRFLLGEIVEVQALTSNAVRGFEVEDTAAVLLRFESGAL
FT                   GTLAVSDCASAPWNWDLAAGEAAHYPRQQVNTHFLIGTDASLTLPQLDVWEYRSRKGWH
FT                   EPLTVERSTPHSADPYHEQLRHFAGVIAGEEAPLCSADDAARTLAATLAVHRAVASRAP
FT                   VALAR"
FT   gene            complement(646823..647731)
FT                   /locus_tag="Bphy_6101"
FT   CDS_pept        complement(646823..647731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6101"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   pna:Pnap_2719 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6101"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75158"
FT                   /db_xref="GOA:B2JW31"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW31"
FT                   /protein_id="ACC75158.1"
FT                   /translation="MRVLVTGGSGFLGAWIMRRLLAHGIECVAFDLQAKPQLLHALAPE
FT                   QADTVQWRTGDIAQAADVARALDGCNAVIHLAGILTPDCAANPVRGAQINLIGTLNVFD
FT                   AARTARLPRVLYASSAGVFGPDDGAMPHPQTHYGAFKLACEGSARAYWNDHGIASVGFR
FT                   PLVVYGAGRETGSSAGPSLACRAAALGEQYTMPFTGSTGFVFADDVAAAYEAALLRDVE
FT                   GAHAFTLAGEIASVQTVIDRIGTIVPDARIDAAGAALPIATAFPRDPALERLLPNLPQT
FT                   SLEAGLRQTVAFYRHALTTHP"
FT   gene            647837..649582
FT                   /locus_tag="Bphy_6102"
FT   CDS_pept        647837..649582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6102"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bja:bll3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6102"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75159"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW32"
FT                   /protein_id="ACC75159.1"
FT                   /translation="MKREPILECDVLVLGSGAGGLSAAVTAAAQGLRVIVAEKEDVFGG
FT                   TTAWSGGWMWIPRNPLATRAGIREDIDAPRTYLKSELGGQFDADKATALLERGPEMIEF
FT                   FERHTAMRFIDGNRVPDFHTTPGAATGGRSVCAMPFDGKELGPLLHKLREPLSVMTIKG
FT                   MALASGQDLAHFYRATRSVKSALYVTRRLTAFAWQKLRHGRSMHLVNGNALVARLLKSA
FT                   ADRNVDLRTRAKAIGLLRDDARVTGARVEIDGVVHEVRASRGVVLACGGFPHDVARRAS
FT                   TFAYTPSGKEHWSPAPRSNTGDGIRLGESIGGHFNDSLDAPAAWAPVSLVPQRGGDVAF
FT                   AHLIERAKPGVIAVTRAGQRFVNEASSYHDFISALLGTTPRGEEVCAWLICDHRFQRRY
FT                   GLGFSKPVPFPVSSYVNSGYLKRGATLAELAKVCGIDAQGLENTISAYNTYAKDGFDPQ
FT                   FHKGSTPYNRVQGDATHGPNPCLAPIESGPFYAVKLLPGSLGTFAGLATDANARVLDRN
FT                   DHAIAGLYAVGNDSASMMGGCYPSGGITLGPAMTFGYLAGLSLAGAAHLPTRTGSSSSH
FT                   QGSMQ"
FT   sig_peptide     647837..647920
FT                   /locus_tag="Bphy_6102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.457 at
FT                   residue 28"
FT   gene            649579..650190
FT                   /locus_tag="Bphy_6103"
FT   CDS_pept        649579..650190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6103"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   pna:Pnap_2703 NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6103"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75160"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW33"
FT                   /protein_id="ACC75160.1"
FT                   /translation="MTLYDTVTLTVKIGTNAQVFESLKASGNPPGSTLLGCWYSDIGAL
FT                   GKVMVLRGFESEAALVNERKRLLLEGNPFGCGEFVVDVKVESYALFPFLPPIEPAVHGG
FT                   IYEMRVYGTKLASLQHTIDAWEQAVPQRTQRSPLIGAMYSLDGTVPRFLNIWPYASVDE
FT                   RSRIRAEAVKDGIWPPKGGPAHLTTMESTIYVPAPFSPLR"
FT   gene            650235..651071
FT                   /locus_tag="Bphy_6104"
FT   CDS_pept        650235..651071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6104"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: pau:PA14_02960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6104"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75161"
FT                   /db_xref="GOA:B2JW34"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW34"
FT                   /protein_id="ACC75161.1"
FT                   /translation="MTQAHARALSLSALTVLELTPPQMVQCAADAGYDFVGLRLLPATD
FT                   HEVRHEIVGDTALKRETLAVLKGTGMRVLDVEIMRLKPDTDVTSYKPMLETAAELGARF
FT                   ALVAGNDPEEARTADRLAQLCDIAAPLGITPSLEPMPWTEVKNIAQGARIVAASGKRNT
FT                   GLIIDPIHFDRAADSLDALRALPRDYFGYVQFCDAPAERPTDLDTLLFQARCERMIPGE
FT                   GGLDLAGILRALPEHLPVSVEVPTQRWAEVTRAVDRARRLLNATRAVVEQAYTAAT"
FT   gene            651189..652586
FT                   /locus_tag="Bphy_6105"
FT   CDS_pept        651189..652586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6105"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pen:PSEEN1162
FT                   4-hydroxybenzoate transporter (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6105"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75162"
FT                   /db_xref="GOA:B2JW35"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW35"
FT                   /protein_id="ACC75162.1"
FT                   /translation="MTFSQAAKRSAQRTAARAARALDVQQFLDDQPIGRFQLLVLLMCM
FT                   LIVMLDGLDTVMIGFIAPSLSTAWAIPRDALGPVMSGGLLGLAFGALGAGPMSDRFGRK
FT                   AVMTTAVLFFGVWSLASAFATDVASLTVLRFLTGIGLGASMPNAATLMAEYAPPHRRSL
FT                   MVTIVFCGFTFGAAGGGFVSAWLISAYGWHSVLLLGGVLPILYVPVLIKWLPESARYLA
FT                   LKQSRRMRLVDVLNRLKPASADATTRFISHEPERAERSPVRAILSRDHAFGTVMLWICY
FT                   FAGLLTVYLLGNWLPTLIRGIGFTLAEAAVVGALFQAGGTIGSVLIGWQMDRFNPHRAL
FT                   GLTVFAGGVLAWYMGSSAHTFSTICVLAFGMGYCMNGSNTGFCALAAGSYPTSMRATGT
FT                   SWMLGVGRFGGIAGAMLGASMLHANWGFGEVFMALAVPAAVGALGVLLKGARHKGPIAQ
FT                   VSVSAGH"
FT   gene            652685..653527
FT                   /locus_tag="Bphy_6106"
FT   CDS_pept        652685..653527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6106"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: pna:Pnap_2705 regulatory proteins,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6106"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75163"
FT                   /db_xref="GOA:B2JW36"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW36"
FT                   /protein_id="ACC75163.1"
FT                   /translation="MAGNLERALAVLELLAKNGGRMTLATIADTLNIPRSGTHRLLSML
FT                   IDEGFVRQDQDHGEYTLALKLVSLGLIYLSTSGVADISQPVLDRLAESSGELARLGVVE
FT                   DDHITFVGKAQGAKSGLRYDPDMGSQPPLHCTASGQAWLSTLSDERAVELVSKQGGLGQ
FT                   KSVNTPRAPKTIQQFLKDLNGARQRGYGVAIETYEAGMTSIAAPVRNPVTDEVVGIVSL
FT                   AGPTSRLPESRLKELAPSLLSAAADMGAATLSSPLFKPAGTGGGAPEAKKPRRPKANA"
FT   gene            complement(654398..655630)
FT                   /locus_tag="Bphy_6107"
FT   CDS_pept        complement(654398..655630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6107"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="TIGRFAM: type IV / VI secretion system protein, DotU
FT                   family; PFAM: OmpA/MotB domain protein; KEGG:
FT                   bur:Bcep18194_B0993 outer membrane protein, OmpA/MotB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75164"
FT                   /db_xref="GOA:B2JW37"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW37"
FT                   /protein_id="ACC75164.1"
FT                   /translation="MSATAASPQPRYEAEPAAPYRERVRAAEGAANPLLEAARPLLDAL
FT                   ANTPAELDAAGVAQHRLSLVQHLRMFGKVCGELRLPAEHIEKAQYCLCSALDEAAGLTD
FT                   WGNGSRLGMDWRATGLATTSGYDRQGGDRVYAIATDAMHNQRENRCLIEVIQHILDRGF
FT                   RGRYRFANDSDHQIAVVRKQVDQAVVTSGHSPPVSGEHMLTTGGAPPVYHLRVEAQPLS
FT                   QAPRKSRRWMAIGALCLVLLAGAAVAGYWRYTKVRQAEPPVSPIDALAGRLAGHLADEV
FT                   NAGTVTLAENAQHTTLSLRLEGIFEAGQSSVNPWVKPLITTIGQEVAKTPGRVLVTGHT
FT                   DSQPFSHMQRSSNLALSDARAQEVAQILVSAGVATDRIDSTGKGNAEPAADNATPQGRL
FT                   RNRRVEITVFE"
FT   gene            complement(655657..659703)
FT                   /locus_tag="Bphy_6108"
FT   CDS_pept        complement(655657..659703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6108"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   bxe:Bxe_A2085 putative membrane protein, SciS/IcmF-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75165"
FT                   /db_xref="GOA:B2JW38"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW38"
FT                   /protein_id="ACC75165.1"
FT                   /translation="MKKFLSFLVSRQFLAFLALIVVALVIWYVGPFVAFGGLKPLAGAG
FT                   MRVLVIALLLAGVLLWLVRWSTSPVIVALLCLLIWYATPLLTFGKAQPFAPESARIIAI
FT                   AVALFIFAVYWLFRLWQEMKSNRSLVDRMLTFGGKKEPSPAAVQLKEVGVIVSSALARL
FT                   KAMRTGARGIGRLFQGKRYLYELPWYIALGSKSSGKTSALLNAGLAFPVAEQMQRAAGA
FT                   AQKPTANVDWWLTNDAVLIDTAGYYTRHGTSGHALPPPPESNNPTERKATDTRTENEKS
FT                   GHGKALDAPKASTASTTWADPAQARQRMDSEEWLGFLGMLRTHRPRAPINGALLAVNLG
FT                   ELTSQDDSSRMAEAAALRARLAELRGELGIRFPVYLVVTGMDQLTGFAEYFSSLTAEGR
FT                   AQPWGFTLPYGKETIAKEGVTARCRSELGQLAQRLERGIDTRLQDEYDPLHRRKLAALS
FT                   QEFAALSAPLIELIERVFLDSRYDDTQLYSTLRGVYFTSAEQAGNERVAERRTIVQRVI
FT                   AGMKAPATSLREATSEGFFLHDLFTKVVIPEAHLVRPNLRWEFRFRLLRLVGHALALLL
FT                   FVWLAIGLCVSFGNNSDYLGAIARKTQALAARVAQLYHDPKAEAVPDTLSAARYLPTYQ
FT                   GLDLSDPDSTFRYGLYTAPDIVTESRHIYDALEDNLLVPQIVHRMEDVISQSITNKDPK
FT                   ATYEALRVYLMLYDKAKFNADDVKAWVLDDWAKTDSASVFGGRASMIDHVQQLFSGTRV
FT                   VQSPLIRNDALIQQARAFLDGSNATDRLYERAKAAMMKEAPDEFTLIRAVGPQAGTVFT
FT                   RASGAPLSRGVPGLFTFDGYRNLFDKHLPEFVQVARDDDAWVMGRSYLGGLSDQAQKKT
FT                   AELVRMATGADDPLTEAIRREYLTEYAQQWDAFLGDIRTVRGTSLAFNLQVLRSFAAPD
FT                   SPLARLARAAVHETTLTQPVAATGGSLLQKATDQISQKADSALGIRASEQVERELVDSR
FT                   FAALREVVTGNAEGQATGDAAAQPGKTGLDGVTNLLNDYYTALTVADNAISNNSMPPAS
FT                   DTAAKLKMTANTMPPPFRAVLLQLAQQGSQEVNQGIGQLLSRQMGAVIGDTCRLTIEGN
FT                   YPFTPGSTRDVSIDDFTRVFAQGGVIDDFFNKTLAPFVDTSAKPWRYRTLPGATEPVQG
FT                   PDLEPFQHVKAIRDVFFSGPGQNQMTWKANLQVPELDPAITGLMIDIDGQTMLYQHGPV
FT                   TPFTVSWPGPRGGVHAEITANPRIRPETSTMSADGPWALMRLLAKGHVVETATPGKTLV
FT                   AFDFDGRRAVLDMDSTGSVANPLTSDVLRTFRCPSSMPVFGLVDSGPPPGLPAAGLPMT
FT                   PPSPY"
FT   sig_peptide     complement(659593..659703)
FT                   /locus_tag="Bphy_6108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.979 at
FT                   residue 37"
FT   gene            complement(659734..661077)
FT                   /locus_tag="Bphy_6109"
FT   CDS_pept        complement(659734..661077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6109"
FT                   /product="type VI secretion system OmpA/MotB family
FT                   protein"
FT                   /note="TIGRFAM: type IV / VI secretion system protein, DotU
FT                   family; type VI secretion system OmpA/MotB family protein;
FT                   PFAM: OmpA/MotB domain protein; KEGG: bxe:Bxe_A2088 outer
FT                   membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6109"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75166"
FT                   /db_xref="GOA:B2JW39"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW39"
FT                   /protein_id="ACC75166.1"
FT                   /translation="MPQATIDPVKQAPDVNEIQATPRRELPHGESLTTRLAAIKAADNP
FT                   LLEAARPLLRALADMPEYLDHERVEQLRDLLEQEVRAFQKLCEQTSIRRDHMLGTRYCL
FT                   CTAIDEAAMQTAWGKNSKVPVQPGQSPRGKDAGAAASDINNHDAGVEWVTRGMATIFHE
FT                   DRQGGDKVYLLIGRLMSDPQEHLDLLEVIYRILSLGFEGRYRFEAGGHRKHEAVRQRIY
FT                   NEIMARRGIVPVALSPHWQSDVKGRRASFYDFPVWITVTLLSVILLGCFGWFKYELLGR
FT                   SAEVQKQIADIGHMTPPPAPPVLHLKALLKDEIAAGTVSVDEDAHHSSVTFRGDSMFPP
FT                   GGASVKATMGPLIAKIAAEIARVPGKVSVLGYTDNVPIRSRQFASNDALSEERATQVMQ
FT                   ILQAAGVPASRLEAVGKGDADPVADNSTPQGRAQNRRVEITVAEYTRP"
FT   gene            complement(661145..662491)
FT                   /locus_tag="Bphy_6110"
FT   CDS_pept        complement(661145..662491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6110"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG:
FT                   bxe:Bxe_A2089 hypothetical temperature-dependent protein
FT                   secretion, ImpJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6110"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75167"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW40"
FT                   /protein_id="ACC75167.1"
FT                   /translation="MSWHNKVVWNEGLFMRPQLFQQQERYLEHFAHKRAAPLSPFFFGF
FT                   THYTLDTEALALGKVIVKSVAGVFPDGTPFDAPGSTPPPAPLTIRPEHLEQLIYLAVPI
FT                   RVPNGEETTFDNASDSLARYAVFNTDLRDTNSVGQGSQKIQLSNLRLRLVPEKEMTDAW
FT                   IGLALTRVKTIRADGSIVLDDTLVPPVSAYGASSLLESWLAKIHDLTRLRATALAQRLT
FT                   GADGKAGTAAEVSDYLLLQTLNRYEPLLQHLRRVPTTSPADLYALLISMAGELSTYVRT
FT                   TTRRPLDSHPAYQHTAPHVCLKPVVDDTHQLLNAVLVRSAQSIELTDTGYGMRNAVVDP
FT                   AEMHGFTSVVLGVSAAMPPDTLQQQFAAQAKVGPSERLPDLVRGHLPGITLQALPVPPR
FT                   QIPFNAGYIYYELSRAGQLWEDVERRGGLALHIAGDFPSLKLELWGIRG"
FT   gene            complement(662515..663021)
FT                   /locus_tag="Bphy_6111"
FT   CDS_pept        complement(662515..663021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0983 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75168"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW41"
FT                   /protein_id="ACC75168.1"
FT                   /translation="MRLIPLATACTLVLLLAACASSDPKLHDPLRLDLTVSAATTVNPD
FT                   GQGRAAPIVVRVYELKTDNAFKAADYFSVQDRDKTVLADDLVKRDEFQLRPGEHQTIRR
FT                   IADPGTTTLGVLAEYRDLPHAVWRTVYPLPATPEKAWYRFSSPKLNLTINLDAGAIRIT
FT                   DNTKK"
FT   sig_peptide     complement(662953..663021)
FT                   /locus_tag="Bphy_6111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.611 at
FT                   residue 23"
FT   gene            complement(663139..663624)
FT                   /locus_tag="Bphy_6112"
FT   CDS_pept        complement(663139..663624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6112"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   bur:Bcep18194_B0982 protein of unknown function DUF796"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75169"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW42"
FT                   /protein_id="ACC75169.1"
FT                   /translation="MAQDIFLKIDGIDGESQDDKHKNEIEVLNWNWEISQESSMHSGSG
FT                   GGAGKATVGDLWFQHGIDRASPNLMKYALTGKHIDQAVLVMRKAGGNPLEYLKITMSDV
FT                   LVTRVKPSGSKNGEEKSLEEVSLSFAKVKQEYVVQNAQGGSGGAVTASYDIKGNKEA"
FT   gene            complement(663703..665196)
FT                   /locus_tag="Bphy_6113"
FT   CDS_pept        complement(663703..665196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6113"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   bxe:Bxe_A2094 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75170"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW43"
FT                   /protein_id="ACC75170.1"
FT                   /translation="MAKQHAQTAVAGVATGSDFTQLLNQEFRPKTQQAREAVELAVQTL
FT                   AEQALRQSATISDDAYKSIAAIIAQIDHKLSEQINLILHHDDYQKLESAWRGLHHLVSN
FT                   TETDERLKIRFMDISKDELRRTMKRYKGLAWDQSPLFKQIYEEEYGQLGGEPYGCLVAD
FT                   YYFDHTPPDVDLLGSIAKISAAAHTPFISGASPAVLQMESWQELANPRDLTKIFTQNLE
FT                   YAPWNSLRNTEDARYIGLAMPRFLARLPYGAKTNPVDEFDFEEDTAGSDHRHYAWSNAA
FT                   YAMGVNINRSFKLYGWCSLIRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRRE
FT                   AELSKNGFIPLIHRKNTDHATFIGAQSMQKPAEYHDADATANANLSARLPYLFACSRFA
FT                   HYLKCIVRDKIGAFKEREDMQRWLNEWIMNYVDADPANSSQETKARRPLAAAEVLVEEV
FT                   EGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSIKEAA"
FT   gene            complement(665221..665754)
FT                   /locus_tag="Bphy_6114"
FT   CDS_pept        complement(665221..665754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6114"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG: bam:Bamb_3474
FT                   uncharacterised conserved protein UCP028301"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6114"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75171"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW44"
FT                   /protein_id="ACC75171.1"
FT                   /translation="MSSSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADL
FT                   SGKPVDPLPAVADRRFLDIDIDNFDERMKAIRPRVAFAVPSTLTGEGQMMVDMTFESIE
FT                   DFSPAAIARKVEPLRQLLEARTQLANLQTYMDGKSGAESLVNQLLQDPSLLKSLAAAPK
FT                   PQAAVDTPEASDTN"
FT   gene            complement(665804..668524)
FT                   /locus_tag="Bphy_6115"
FT   CDS_pept        complement(665804..668524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6115"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: bxe:Bxe_A2096 putative ClpA/B-type chaperone,
FT                   ATPase subunit ClpB, heat shock protein; TIGRFAM: type VI
FT                   secretion ATPase, ClpV1 family; PFAM: AAA ATPase central
FT                   domain protein; Clp domain protein; ATPase associated with
FT                   various cellular activities AAA_5; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6115"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75172"
FT                   /db_xref="GOA:B2JW45"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW45"
FT                   /protein_id="ACC75172.1"
FT                   /translation="MTISRQSLFSKLGVTLFRSAESATAYCKLRGNPYVELVHWLHQLM
FT                   QQPDSDLHRVLRHCEIDQDTLDRDMARALAGLPAGASSIIDFSHDVDHAIERGWLITSL
FT                   DRNERRIRGAWLLVALLTTPELRRALLSISPAFAKIPVDGLSDVLPAWIDGSPEMGEAP
FT                   HDSSDYSPALPGEASQAMPRTSKGSPLEQYCTDLTARARAGEIDPVVGRELEIRTMIDV
FT                   LLRRRQNNPLLTGEAGVGKTAVVEGFALAVANGEVPPKLASVRLLSLDVGALLAGASMK
FT                   GEFEARLKGVLEAAAKSQVSVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTI
FT                   GATTWAEYKRHIEKDPALTRRFQVLQVPEPEEVAAIDMVRGLAPTFARHHGVVILDEAI
FT                   RAAVRFSHRYIPSRQLPDKAISLFDTACARVALSQHTPPRELQNLSERLRAATVERDLL
FT                   QQEALIGLDADQAIASANARIEALTNDMAVVEGHWRAQLDAMQALASAREAALAGDQQA
FT                   AGSLRDLEQQLTFLRGETPYVFPEVDEAIVAEIVSDWTGVPVGRMVTDEITAVRTLPST
FT                   LEARVIGQPDALHQIGERVQTARAGLTNPKKPLGVFLLAGPSGVGKTETALALAEALYG
FT                   GEQNLITLNMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAH
FT                   RDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGSELTASLCADPALAPDTEALR
FT                   AALAPELLKVFPAAFLGRITVVPYRPLASMSLARIVRLHLERVVRRMAETHQIVLNYEE
FT                   AVVDYIVGRCLVQETGARVLIGFIEQHVLPRLSTLWLDAFSSKQPLSRIDIVLGDRDAP
FT                   PATALLFRFPAAQQQASQTDGVNADAEESIVGQAL"
FT   gene            668949..669632
FT                   /locus_tag="Bphy_6116"
FT   CDS_pept        668949..669632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6116"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75173"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW46"
FT                   /protein_id="ACC75173.1"
FT                   /translation="MHFFRLLRRHQSPATRAEPEAFTAAHAFTRKGTGTPEADSDPLAM
FT                   FDEKQPEDYLRGSTAIFGLIGSRPALEADAVSRTSAQTDTDDLISILHRQYCQALANPF
FT                   GLAPAADWETLAEPSGHHVHSESGLPVDPHFYNAGHDSIEALLSGAQLLDHAFGPLRES
FT                   DLGSLPESEPVPEILRLFAPPEYLASAFRSMALLPPTLARREHHSLGIDSPLPMPEVSQ
FT                   TGDAS"
FT   gene            669629..670495
FT                   /locus_tag="Bphy_6117"
FT   CDS_pept        669629..670495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6117"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG:
FT                   bpl:BURPS1106A_A0246 ImpE/SciE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75174"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW47"
FT                   /protein_id="ACC75174.1"
FT                   /translation="MTMSRVSLATRLDDVQGMIRREPTAAGHRWTLFQLLCVTQQWERA
FT                   VQQLQVFAQLNPQQVQAAQAYRDLIRAERWRTKVLDGLAQPGFVIGPPSWVENLAEALR
FT                   LTAAGQSDAADAIRESALDQAPLVRGGGANHSFEWIADSDSRLGPVCEIITAGRYRWLP
FT                   FSDIAAWEIGRPATMVDFVWAPCLLTLVDGATVRGFMPARFPSVADATYDSAVLDALRL
FT                   GNMTIWTDAGLTGVLAEGRKTWATSAGDVGLFELDVCTFGCDADRGSVDSVDGMAMQDE
FT                   GGVDGAA"
FT   gene            670482..671033
FT                   /locus_tag="Bphy_6118"
FT   CDS_pept        670482..671033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6118"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG:
FT                   bur:Bcep18194_B0976 protein of unknown function DUF1316"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6118"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75175"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW48"
FT                   /protein_id="ACC75175.1"
FT                   /translation="MERRRRKADGTQTASTPRRHDTFLMPTLLDRLRDDAPHRQHEAPG
FT                   EYAVTRAQMRDIVQRDLAYLLNTTNIEEQVDRARYPEAAASTVNFGVPPLAGKFTATRQ
FT                   WADIEIIIKQAITDFEPRLVPGSLSVAPLPDKDGEVQYNALAFEVRGLISMDPYPLEFL
FT                   VQSSLDLETSQLNVSGARAV"
FT   gene            671060..672949
FT                   /locus_tag="Bphy_6119"
FT   CDS_pept        671060..672949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6119"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   bam:Bamb_3469 protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75176"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW49"
FT                   /protein_id="ACC75176.1"
FT                   /translation="MDPRLLEYYNHELIYMRELASEFGRHHPKIGARLGMQAGEIGDPY
FT                   VERLLESFCFMAARMQIKIDAEFPKFTGRLLEVIYPNYVAPTPSISVARIYPSPKEGNL
FT                   NRGFQLPRGTMFKARKPAGEKTLCQFRSGLDVTLYPLGISEAKLTAIPPDVVGLDRYIP
FT                   PDRQVRGALRIRFRTTNGSRISDLQGLNHLPIYLAGDEQVASHLFELLHAANVALVIGE
FT                   PGQFGSGDKPLSVVTSNPVAHEGIGIGEGLLPLTWSKFHGHNLLHEYFACPSRFYFFAL
FT                   TGLAQGFSRINGPEVEVIVLLDQPTERLANLVDASRFALFCTPVVNLFEKRTDQIEIPQ
FT                   GESEVRLVPSKLEPLDYEVFAIQKLCGQKTSNSAELEFRPLFQTLNNDEGNYGRYFSSR
FT                   RERRLASDNSRRYGTRTPYIGTEMFVTLVDQTEAPYNGDIRYLSADAWVTNRDLPLLVP
FT                   RNGVDDLDGNDEDSIQSIGLIRPPSPPRPPYAEREMAWRLIRQLNFNYLPFSDMDHREG
FT                   GQGLRDLLRLFLASDDTERQRQVEALIGVKTEPVNDMLPGNGPLVFGRGIECVLTVDET
FT                   GFSGVSPYLLGLILEHYMARHVSINSFTQTELHSMQRGLVARWPVRMGTRGVA"
FT   gene            672949..674037
FT                   /locus_tag="Bphy_6120"
FT   CDS_pept        672949..674037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6120"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   bpd:BURPS668_A0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6120"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75177"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW50"
FT                   /protein_id="ACC75177.1"
FT                   /translation="MQRAPFKALIQDIALSQSLLDHLQAEPWRHGFFALMRRIGANPAI
FT                   DPIGTARLPQAEPFRLGQQASLIFAPREIASVSVDHERLRVLLFGLGMLGPNGPLPIHI
FT                   TEIARERKEHRRDPTLSNFLDIFHHRYLTMLYRVWASAQSAASLDRPGNERFTFYIASL
FT                   TGHEVKEIEQGPLPAHARLSAAPHLIRESRNPDGLAATLSHYFGVPVKIDEFVFHWLER
FT                   KPGKRSRLGVPGAATTMAVDGFLGDRIPDRQYRFRIVIGPVDMEDYQRFTPQGSDLLRL
FT                   VEWVRAFVGQEIHWELELKIRPHSAPPAVVGGPQQLGWSGWLGQSPSPEPVTGMIFEPE
FT                   RYVPQLKQDAETRAARVKQIEP"
FT   gene            674034..675119
FT                   /locus_tag="Bphy_6121"
FT   CDS_pept        674034..675119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6121"
FT                   /product="ImpA domain protein"
FT                   /note="PFAM: ImpA domain protein; KEGG: bxe:Bxe_A2098
FT                   conserved hypothetical cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6121"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75178"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW51"
FT                   /protein_id="ACC75178.1"
FT                   /translation="MSNNRKKSQDKPENRGTTHDWMALISTESPCGSDLEYDPEFVVLS
FT                   ASVAAKATAQYGDFVGTPEPVNWSDVDRDCRRLMVRSKDVRLAVLFIRCRTRLAAATGF
FT                   AEGLGLLAGWLMTFPDLVHPQLGVDEDRSAALEIRMNALQSLTDTDGLISDLREIALTR
FT                   STATRLQLRDVERAFAHPRPSDALTPDSVTRQLEELRMQRPSVLSGFDDALESLTAIEG
FT                   WCREHLSVYAPDLTALKRLLRHVAIPPGSRQTDDVPEEASDAQPDSEESAALAELPTAP
FT                   DESEASTLSEPSTPRTTGKAYDRHAALNLIREARQWFEQHEPSSPIPVLLKRAEQFVGK
FT                   RYVDVVKAIPAELLAQWEQEE"
FT   gene            675123..675779
FT                   /locus_tag="Bphy_6122"
FT   CDS_pept        675123..675779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6122"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75179"
FT                   /db_xref="GOA:B2JW52"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW52"
FT                   /protein_id="ACC75179.1"
FT                   /translation="MNWQIFSCFKNKALRYIILAIFIAYVMVLAQYHPILFFIVSVIFA
FT                   GYLVTLLVGACFILISKQKRATHGRRLVRHLAIAICVFLWEALLVFNHAGGWTDILAIK
FT                   LDTKKYDACKNSGVAFDGNRLSVCDTNDKWWRAGFTEAIVYDSSGQILREHPPHSDDWL
FT                   NAALSPNIHAPFGVVGFEARRLTGDFYLITFYDDLSDELIPECRSIHDRCVLREK"
FT   gene            675769..676455
FT                   /locus_tag="Bphy_6123"
FT   CDS_pept        675769..676455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6123"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75180"
FT                   /db_xref="GOA:B2JW53"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW53"
FT                   /protein_id="ACC75180.1"
FT                   /translation="MKNRARKVVRACFLSYRGRYLSDPNTAIAREAGIFSDTAGSVVLD
FT                   NANPNAYFIVPANYSIDKAIDFSNAIAAMFVCNGMSSAFGIMTGAFWPKGSQDLQRTYP
FT                   GNDGLDAGQAFVPAFTNAASFHFGLVSELSGIGEDTALHGGGALNRSHLYLNTIKNGFI
FT                   NLADRFGAKYGPTPLPDTRGVDGNNPNNVKSIHAGVLFARELRQRYGIHSPDLECSLTS
FT                   PFTSSN"
FT   gene            676639..678783
FT                   /locus_tag="Bphy_6124"
FT   CDS_pept        676639..678783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6124"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; PFAM: Rhs element Vgr protein; KEGG: bxe:Bxe_A3024
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6124"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75181"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW54"
FT                   /protein_id="ACC75181.1"
FT                   /translation="MLQFLTNRTLTIDGPAIPLSSTGDPVLQLQSIAGTEILSRIYRYV
FT                   LDCVTVSDLLMTDAASLDLKSMIGKELTVTVQLDGMGSFVPGMTGLSGAANIGKGIREI
FT                   SGIVTEARFVGQSNRQGHYRLLLQPWITLADQQSTYRIFQNKTVVEIVDQVFGSYMFSW
FT                   DKRLSAEYKELEYQVQYGETDFIFAQRLMQEHGIYWFFEHSNKIHRMVLVDQLGAHKPV
FT                   DSAAYQTLQYYPPGHKIDMEYIDSFDASESIQSGRWTTSDFNFKKPRARLGTENALPRD
FT                   TEFNELERYEWPGDYSDTAVGEDFARIRMQELYAPGTRAWGSGNLRDVVCGTTFTLAGY
FT                   PQQSANCEYLVVSASFAASELGESTGAGEFSVRSSFVVQPATVVFRPPRTVPKPRTTGP
FT                   QTAIVTGPDGQEIWTDQYGRVKLKFHWDRSPVRNQKSSCWVRVAYPWAGNNFGTINIPR
FT                   IGQEVIVDFENGDPDRPIVTGRVYNGANMPPWPLPDNATQSGTLSRSEDGNYETANAIR
FT                   FEDKKGREEVWIHAEKDMRTEVENDEVHAVEHDQTITINHDHTKHVGNDEQVDIGHDRT
FT                   HRITQDDSLAVGRSLTLTVSKDYTGNVGNNRTEKVAADYQIQTGGNVQHTVQGRHQLQA
FT                   GQGIARKTQVYELVAGERLVLKAPGGSLTIDSSGITLNGISIHLKGAVTQENGTGGAPT
FT                   LNGIPVPAQLPDPTHLPLSD"
FT   gene            678826..681066
FT                   /locus_tag="Bphy_6125"
FT   CDS_pept        678826..681066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6125"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: ypk:y3360 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6125"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75182"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW55"
FT                   /protein_id="ACC75182.1"
FT                   /translation="MLISLPFLRAGTQEDDPTQPVTTLGERAGKGAFPVSREFSWHGGI
FT                   HLDAPGSGDNVEPVRAIADGQVVFARNSDEIPQHSDDPTVIAAHPLLYYAGWTSNGVVI
FT                   LKHTTEIGDRVNVEFYSIYQHMHKVNVSRGQKVYRKDRIGSPGAIYGQPNRIHFEIVAD
FT                   AANVAALMGRSSGPLTAPQGRTNSLWGDTHIVLPAGTPLYATDPSAITAGHPAWQVPVQ
FT                   ATTTAPAIVTISEAAGLITLTTRSTRGTVLGTATPEDGYGLYQRALQRYPGCPSAGYEM
FT                   LRFGRVIGPDAPAAGDLHQGRLPHIRQIRSPVDHTAVYADLNGPGVRVYSDADFPDWLG
FT                   WTYIDDDTDGNSRCDSDVLIDMLDPSAPPAAGQPAPASGAVAQTPARQQAQKRRERIAR
FT                   AYARSLDGPMRERLSYCVVKMPTDWSRDDFDTRWGWVKGTDPNDLPANVLLTTCMSDEA
FT                   YTKFKQHHSALAFWEDAQAQGLALDKLHYHFHPGRFIQTFRKCMWLSEAELSRVYPDNQ
FT                   YNHRETPDPSGLRERYRKQLNQVTRKYFINTATRLTHFLGQGAVESFSLARMVEASTTH
FT                   FHASIQPETDGYYNDLHDTYFNYLENRLGNVDTGDGIKYRGRGMKQLTGLANYASYWVY
FT                   RGWLDKSTYDPSWWLKTHGHIRKPNIADPQRVSTDPYNCIDTGGWYWTAGATRLQNKTI
FT                   NSVISEGELSHQAVFDVSAAINGINSHTHEPNGLGDRENQTLRISKIIVDKP"
FT   gene            681063..681656
FT                   /locus_tag="Bphy_6126"
FT   CDS_pept        681063..681656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6126"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75183"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW56"
FT                   /protein_id="ACC75183.1"
FT                   /translation="MKKLIVNGIWLLTCVLAVSGSAYTKTIVELKSGMRIKTSGFSSSW
FT                   NIPNRGTCVDAKKDRWRLTACFYDKAFDNAAHAEGFLQYGSLSQENKEMVGEDLPDNAL
FT                   VYVSGNWTYPTHNIEIGDFDVYEADRVLCHDDPPSGPDQGDDCYFSAARYKPTGSSSIA
FT                   TFISTRYLKSGDQSKQILWIREFIRSIKFLPQSH"
FT   sig_peptide     681063..681137
FT                   /locus_tag="Bphy_6126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.913 at
FT                   residue 25"
FT   gene            681696..681950
FT                   /locus_tag="Bphy_6127"
FT   CDS_pept        681696..681950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6127"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bxe:Bxe_A3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6127"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75184"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW57"
FT                   /protein_id="ACC75184.1"
FT                   /translation="MRPVVLVGHRHSCPIHGMGTVTNGTSGVTVNGRAVARIGDGTSCG
FT                   ATISTGSASTFGGAGAARKGDTTSHGGTLIDGDDGWLLD"
FT   gene            681982..682656
FT                   /locus_tag="Bphy_6128"
FT   CDS_pept        681982..682656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS03734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6128"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW58"
FT                   /protein_id="ACC75185.1"
FT                   /translation="MTYQVIAANELVPETFRNHDRHGFNVYLQTAFAARQGQLLAGPDG
FT                   RPLGFIRRLRQEIAAPSVFSVDSAATAEIAHLYEHAGLFAWQETSENVATWDASRILQS
FT                   VVQASMSLQLCEDGDYDRLAIFDPFLRAGAQEDDPTQPVTTLGERAGKGAFPVSREFSW
FT                   HGGIHLDAPGSGDNVEPVRAIADGQVVFARNSDEIPQHSDDPTVIAPTRCCTTRAGPAM
FT                   AW"
FT   gene            682650..684685
FT                   /pseudo
FT                   /locus_tag="Bphy_6129"
FT                   /note="M23 peptidase domain protein"
FT   gene            684745..685413
FT                   /locus_tag="Bphy_6131"
FT   CDS_pept        684745..685413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6131"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75186"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW59"
FT                   /protein_id="ACC75186.1"
FT                   /translation="MRSSSCFRFVFQCFLLVAISLASLWAIAGDSSPVKSGTKELVTSV
FT                   LQNQIDGFSDGKMAVTKECHVHYADQKIPQSISSRFTLNSICFDIDIDQQKEAISNRYG
FT                   GSYNESTKKWTAYYVDDRDKRLLAPVTHIYPINNGNNSGFARTTDEVIGDPDQRVRFFS
FT                   YCLFHGSDALCGDGQVLKLRDPKVTLLPYALGFLRSVDFVDPAAVLPAGPANPASATDQ
FT                   "
FT   sig_peptide     684745..684831
FT                   /locus_tag="Bphy_6131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.826 at
FT                   residue 29"
FT   gene            685480..686142
FT                   /locus_tag="Bphy_6132"
FT   CDS_pept        685480..686142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75187"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW60"
FT                   /protein_id="ACC75187.1"
FT                   /translation="MYKQICATMLLSCLICPPSFASTTATEKPATAGAKLAVNMGEGCA
FT                   ISVADLFAGHLASGMAMNASYWTDRPPVKTTIGDFAVNFVCSHATETSKEQVANQHGAT
FT                   YDNSANRWTLYFESARDRHMLSPVTHIHIIKALNSSGFYTTQDDVDGDPKQRVRFFSYC
FT                   LFHDSLAICGSGQVMRLSEPKGNLLPYVLDILRTVEFVDPATVKPASLDDAASATTQ"
FT   sig_peptide     685480..685545
FT                   /locus_tag="Bphy_6132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            686269..686934
FT                   /locus_tag="Bphy_6133"
FT   CDS_pept        686269..686934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW61"
FT                   /protein_id="ACC75188.1"
FT                   /translation="MVFKFLLTFLFGVASVGALADESALATAGHGFPELVTVQSCQFRI
FT                   TDKYHGSILTPRAENDFKFAGYSTTITTDGKSRDFGFSIGCDSDIASTDAVANQHDGSY
FT                   DAKTKKWVAHYDDASDRQLLSRVTHVYPLKTVNGSGFARTTDEITGDPNQRIRFFSYCI
FT                   FHGAKALCGDGKDMKLSDPKGNLLPYELDVLRTVEFIDPDTAKPAGPANAVSDASATP"
FT   sig_peptide     686269..686331
FT                   /locus_tag="Bphy_6133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            687105..688211
FT                   /locus_tag="Bphy_6134"
FT   CDS_pept        687105..688211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6134"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   bxe:Bxe_A1803 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75189"
FT                   /db_xref="GOA:B2JW62"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW62"
FT                   /protein_id="ACC75189.1"
FT                   /translation="MRGADGYTESMFTMSRLDDFVPANHPLRPIRLWLNEALTRMDSVF
FT                   SRMYESDAKGGRPSIAPEKLIRALLLQVLYSIRSERMLMEQISYNMLFRWFVGLAMDDV
FT                   VWDHSTFSKNRDRLMAHDVMVSLFNETVETARVRGHLSGEHFSVDGTLIQAWAGHKSFV
FT                   PKVKSDDDSPPDGGAGSHENWHGEKRSNDTHESSTDSQARLFRKSRGTGAMLCYMGHVL
FT                   TDNRHGLVVNAQVTQANGTAERDTAAEMLADAAQFADTSITVGADKNYDTAGFVATCRA
FT                   HGVTPHVAQNNGRAGGSAIDGRTTRWAGYAVSQRKRKCIEQVFGWSKTVGRIRQAMFRG
FT                   LQRVDQIFLLTQAAYNLTRMRTLAAKAA"
FT   gene            complement(688367..688747)
FT                   /locus_tag="Bphy_6135"
FT   CDS_pept        complement(688367..688747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6135"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   reu:Reut_C6290 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75190"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW63"
FT                   /protein_id="ACC75190.1"
FT                   /translation="MVAADARTAITFALSPGQAGDAPEGRALLQSLGSPNRPLHLLMDK
FT                   AYEGDETRQLALDLGFIPVVPPKSNRLEPWEYDREMYKRRNEVERLFRRLKGFRRIFSR
FT                   FDKLDVMFLAFINFALIVDGLK"
FT   gene            complement(688717..689124)
FT                   /locus_tag="Bphy_6136"
FT   CDS_pept        complement(688717..689124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6136"
FT                   /product="transposase, putative"
FT                   /note="KEGG: bte:BTH_II2277 transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75191"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW64"
FT                   /protein_id="ACC75191.1"
FT                   /translation="MEITEAQYQRIEHCLPRQRGNVSLTNLQVLNAILYVAEHGCKWRG
FT                   LPKRFGRWHTIYTRMNRWSRNGVLDRVFTELQREQIVRIRIEAVSLDSTMVKVHPDGTG
FT                   ALKKTDLKQSENPEVDGPPRFIWLPRMLEQP"
FT   gene            689178..689537
FT                   /locus_tag="Bphy_6137"
FT   CDS_pept        689178..689537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6137"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75192"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW65"
FT                   /protein_id="ACC75192.1"
FT                   /translation="MDAKKDRWRLTACFYDKAFDNAAHAEGFLQYGSLSQENKEMVGED
FT                   LPDNALVYVSGNWTYPTHNIEIGDFDVYEADRALCHDAPPPFRGRIKATIAISPLLVIN
FT                   QQVRAQLPLLSRQDT"
FT   gene            689653..689937
FT                   /locus_tag="Bphy_6138"
FT   CDS_pept        689653..689937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6138"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bxe:Bxe_A3019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6138"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75193"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW66"
FT                   /protein_id="ACC75193.1"
FT                   /translation="MRPVVLVGHRHSCPVHGMGTVISGTAGVTVSGRQVARIGDTTSCG
FT                   AIIATGSSATFGGSGVARKGDTTSHGGTLIEGDDGWVIDLPQQTVPAGT"
FT   gene            689968..690231
FT                   /locus_tag="Bphy_6139"
FT   CDS_pept        689968..690231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6139"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bpd:BURPS668_2134 transposase subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6139"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75194"
FT                   /db_xref="GOA:B2JW67"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW67"
FT                   /protein_id="ACC75194.1"
FT                   /translation="MKTRFTEEQIIGYLKEAEAGMPVKDLCRKHGFSDASFYTWRAKFG
FT                   GMEVSEARRLKDLESENARLKKLLADAMLDMEALKVVMKGKH"
FT   gene            690255..690816
FT                   /pseudo
FT                   /locus_tag="Bphy_6140"
FT   gene            complement(690806..690898)
FT                   /pseudo
FT                   /locus_tag="Bphy_6141"
FT   gene            690959..691537
FT                   /locus_tag="Bphy_6142"
FT   CDS_pept        690959..691537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A4428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6142"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75195"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW68"
FT                   /protein_id="ACC75195.1"
FT                   /translation="MTSLDIAGHPSGEIDARKMAEIASAYQYKPAGLGVTGRAWAPRLQ
FT                   NASTYDEAWLKKLWPYLPKDFDFRYWNGAPADQQISWPSSDLRLDLMNLAAPEHTFSGR
FT                   LSARLPGHRAVFALRYASGATMPVTTHLDTVLIDAEEMQVMLTWRAVFPRTPEVRVCEA
FT                   RFETDPAAPQLRLNRDGLSTKQEAVWQTN"
FT   gene            complement(692309..693001)
FT                   /locus_tag="Bphy_6143"
FT   CDS_pept        complement(692309..693001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6143"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75196"
FT                   /db_xref="GOA:B2JW69"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW69"
FT                   /protein_id="ACC75196.1"
FT                   /translation="MDWSKVASNIGSSAPLLAGLVGGPIGVGVTAAAAIISHALGTPSD
FT                   PGVVELALNDPSALEKVRQAENANALQLQQLMVTAAQASLAHESDMARIQAADRADARA
FT                   MGISNKDWVPKVLAMAVTAGFFGILLLMAFQPMPGTNKDLVNVVVGALGTAWISIIGYY
FT                   FGTSVGSMRKTELLAKPSVPITADSALTLREPAPASAARPQAAPAPSHSEAFQQFTPGG
FT                   QGPVFSGS"
FT   sig_peptide     complement(692906..693001)
FT                   /locus_tag="Bphy_6143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.305 at
FT                   residue 32"
FT   gene            complement(693001..693483)
FT                   /locus_tag="Bphy_6144"
FT   CDS_pept        complement(693001..693483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6144"
FT                   /product="protein of unknown function DUF847"
FT                   /note="PFAM: protein of unknown function DUF847; KEGG:
FT                   bxe:Bxe_B0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6144"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75197"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW70"
FT                   /protein_id="ACC75197.1"
FT                   /translation="MDGFEDAFRALIGSEGGYSFNPHDPGGETMWGVTARVARSAGYAG
FT                   AMKDLPLDTAKQIAKQKYWDPLHLDELDPRVAFQIFDANYNGGLVVLWMQKASGAKEDG
FT                   KFGPDTLDAVKSADPLKFVMRFAAYRLRYLRNLHAWPNFSRGWTERMAANLLLGAA"
FT   gene            complement(693566..694999)
FT                   /locus_tag="Bphy_6145"
FT   CDS_pept        complement(693566..694999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6145"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bxe:Bxe_B0492
FT                   putative TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6145"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75198"
FT                   /db_xref="GOA:B2JW71"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW71"
FT                   /protein_id="ACC75198.1"
FT                   /translation="MSSVQSQRRAVNWRRRTFRVDGRSKRHRARRDFSVGFVPLGLRAA
FT                   GFIGRGPKQLWPYVLPWVFAVLTIGFFCLVVRGVLTRQLLVPPVETPQSLVERGYTSSF
FT                   LAERIMSSMRAIGQDAESIPHDTMTDNDAQPDIQIPGQEMSYATTVRFIKGVINRTDVV
FT                   VHVGITKVNDRADSYVAHVQIEGGPFNSRESTVWFEGRDLEKFVHDIAVKAMRLAEPNI
FT                   LASHLYSQVQKTKCSLAQCDYGEIVAIYDEVLALPASEQGEWALAGKAWLLADQGLSKE
FT                   AEQQTREALTVYQHSAVLHASLGIALEQQHRIDDALDALRAGASEKSKTAENLRLLGDV
FT                   LLHARRYSEALDAFKQADRMKSDFVDNLHDWGEALVTVGRYDEAIEKLSRAVALRPDLA
FT                   PSYAEWGRALDRKGDLSGASRKYAQALQLDAGTLSVRESHLARLARAAQEGNRPDASKP
FT                   NDGVRPVAIPPAALALQTA"
FT   gene            complement(695700..695948)
FT                   /locus_tag="Bphy_6146"
FT   CDS_pept        complement(695700..695948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6146"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75199"
FT                   /db_xref="GOA:B2JW72"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW72"
FT                   /protein_id="ACC75199.1"
FT                   /translation="MMQPSANGSTAERNGYRDPKTLMDLKQCWSGYFSRSNAQLVALLL
FT                   CCSAALLLCCSAALLLCCSAALQIIHCPQQACKSWGD"
FT   gene            complement(695996..696883)
FT                   /locus_tag="Bphy_6147"
FT   CDS_pept        complement(695996..696883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6147"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: mlo:mll2153 probable dyhydroflavanol-4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6147"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75200"
FT                   /db_xref="GOA:B2JW73"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW73"
FT                   /protein_id="ACC75200.1"
FT                   /translation="MRIFLTGATGFIGSALVPELIRAGHEVIGMTRSDAGAYALRQAGA
FT                   QPHHGTLEDVDSLRRGAANADAVIHLAFDHDFSRFQENCEKDKHAIAALGSALRGSDRP
FT                   LLITSGTGVGSGEHGEPAREDVFNVSHPNPRIGSELAGQALLDAGVNVSVLRLPQVHDS
FT                   RKQGLITPLIAIAREKDAVAYVGEGRNRWPAGHLSDVVKLYRLAIEKAEPGARYHAVGE
FT                   EGVSSRDIAEALGRGLGLPVVSIPAGEAQAHFDWMGMFVGMDMPASSALTQTRLSWKPT
FT                   GPSLLSDLEHAQYA"
FT   gene            696990..697844
FT                   /locus_tag="Bphy_6148"
FT   CDS_pept        696990..697844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6148"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mlo:mlr2155 probable DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6148"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75201"
FT                   /db_xref="GOA:B2JW74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW74"
FT                   /protein_id="ACC75201.1"
FT                   /translation="MPVSLPASLGDFLKSRRARLDPASFGFSGRRRTPGLRREEVAQRA
FT                   NISPTWYTWLEQGRGGAPSASVLERIASALMLTDAEREHLFLLALGRPPEVRYRAVSYV
FT                   NPRLQRFLDSLASSPAIVKNPVWDVVAWNRAATVVLTDYGALPPDGRNLLRFLFTDPHV
FT                   RAKQHDWHSVARFVVGAFRADVARAGLVSEAGALVEELCSRSAEFEALWRENGLHNHAD
FT                   GGVKRLSHPTLGPIELEYSAFSVDGRPDLGLIVYTPLDAATAQRIKALAENAPQAAQGA
FT                   EAA"
FT   gene            698060..698533
FT                   /pseudo
FT                   /locus_tag="Bphy_6149"
FT   gene            698855..700999
FT                   /locus_tag="Bphy_6150"
FT   CDS_pept        698855..700999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6150"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   reu:Reut_C6172
FT                   hydantoinase/oxoprolinase:hydantoinaseoxoprolina se,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6150"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75202"
FT                   /db_xref="GOA:B2JW75"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW75"
FT                   /protein_id="ACC75202.1"
FT                   /translation="MEGHSQVQVLGIDAGGTMTDTFFVRDDGRFVVGKAQSNPEDESLA
FT                   IFNSSQDALAHWTRDVDDVYPQLVTCVYSGTAMLNRVVQRKGLDVGLLVNKGFEHVHSM
FT                   GRAIQSYLGYALEERIHLNTHRYDEPLVPLSRTRGVTERTDVQGDIVIPLREGEVRQAT
FT                   RELVASGSKAIVICLLQSHKNGTSEQQARDLVRDELKALGVDIPVFASVDYYPQRKESH
FT                   RMNTTVLEAYAAEPSRQTLKKVSDRFRKHGAKFDLRVMATHGGTISWKAKELARTIVSG
FT                   PIGGVIGSKLLGEALGYDNIACSDIGGTSFDMALITKGNFAIASDPDMARLVLSLPLVT
FT                   MDSVGAGAGSFVRLDPYSGAIKLGPDSAGYRVGTCWPDSGLTTVSVSDCHVVLGYLNPD
FT                   NFLGGQIKLDVSRAREHIKTQVADPLGLSVEDAAAGVIELLDLQLREYLRSNVSAKGYN
FT                   PTEFVCFSYGGAGPVHTYGYTEGLGFKDVVVPAWAAGFSAFGCACADFEYRYDKSVDLA
FT                   LPQSAPDDDKTGAAQTIQKAWSELAAKVIEEFRINGFSEKDVILRPGFRMQYMGQLNDL
FT                   EIESPVAGASSAQDWDRIVEAFEDTYGRVYASAARSPELGFSVTGAIMRGMVVTQKPVL
FT                   PEDPEGGPTPPQEARVGTRKLYRHKQWHDAQLWKMEALKPGNEITGPAIIESDATTFVV
FT                   PKGFATTLDKHRLFHLREVK"
FT   gene            701019..703343
FT                   /locus_tag="Bphy_6151"
FT   CDS_pept        701019..703343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6151"
FT                   /product="Hydantoinase B/oxoprolinase"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG:
FT                   rme:Rmet_4106 hydantoinase B/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6151"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75203"
FT                   /db_xref="GOA:B2JW76"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW76"
FT                   /protein_id="ACC75203.1"
FT                   /translation="MNMMSSQEVGFADLLKNGQTLKQFRDAIIARTAQSGHYNGLERLE
FT                   LRESDPIRYEKMFSKLRGGLVHARETAKKIAASPIVEQEGELCFTLYNAAGDCVLTSTG
FT                   IIIHVGTMGAAIKYMIENNWEANPGIHPGDMFTNNDCSIGNVHPCDIATIVPIFSGGKL
FT                   VGWVGGVTHVIDTGAVTPGSMSTGQVQRFGDGYMITCRKTGVNDTPLRDWLHESQRSVR
FT                   TPKYWILDERTRIAGCHMIRDLIEEVIEDEGLDAYEKFSYEVIEEGRRGLQTRIKAMTL
FT                   PGKYRKVAFVDVPYNHPDVQTSSAFAKLDSIMHSPVEMEIRKDGSWRLDFDGASRWGWH
FT                   SYNAHQVAFTSGIWVMMTQTLVPTQRINDGAYYGTEFHLPKGAWMNPDDRRTGHAYAWH
FT                   FLVSGWSAMWRGLSQAYFSRGYLEEVNAGNANTSNWLQGGGINQDGDIHAVNSFEASSC
FT                   GTGACAIKDGLNHAAAIWNPEGDMGDIEIWEMAEPLLYLGRNVKANSGGYGKYRGGCGF
FT                   ETLRMVWKAQDWTMFFMGNGYMNSDWGLMGGYPPATGYRFEAHRTGLKERIALGESLPL
FT                   GGDTNPDFPDYENHLNAGSVVKRDQQCMTTEDCYSNYDLYLNYLRGGPGFGDPLDRETE
FT                   AIERDLNNALLLPEYAQKVYGAVATKDTHGVWKVDAKETALLRVEIRNQRLARSQPTRE
FT                   WMKGERERILVKHASTQVRHMFATSFGLSKKFEQQFRAFWELPDSWTLVEDELDVPTYG
FT                   SKFRMDLSKMPDVNTVVLVEE"
FT   gene            703382..703900
FT                   /locus_tag="Bphy_6152"
FT   CDS_pept        703382..703900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6152"
FT                   /product="Acetone carboxylase gamma subunit"
FT                   /note="PFAM: Acetone carboxylase gamma subunit; KEGG:
FT                   dar:Daro_1020 acetone carboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6152"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75204"
FT                   /db_xref="InterPro:IPR016750"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW77"
FT                   /protein_id="ACC75204.1"
FT                   /translation="MSTYTKEQVRNMVEGKLDWDTTLRMLSMPKDSERFQMYIDALQQK
FT                   MGWKDRIVLPLAPHLYIVQQSATKKWVTQCDCGHVFCDYRENWKLHANIFVRESEEAMD
FT                   EVYPRLMAPDTQWQVYREYYCPTCGTMHDVEAPTPWYPVIHDFEPDIDAFYTEWVKLPV
FT                   PERVDQSAV"
FT   gene            704224..706293
FT                   /locus_tag="Bphy_6153"
FT   CDS_pept        704224..706293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6153"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: xau:Xaut_1337 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6153"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75205"
FT                   /db_xref="GOA:B2JW78"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW78"
FT                   /protein_id="ACC75205.1"
FT                   /translation="MQQTGTPMDWFSSPQHDASIMAAWEHLVGGGEWHSADVRSVVDDS
FT                   WQRCLVGHVNPGVDRAPPAVAETQLMQWRDANARLVSASLPLMQQTRELLSQTGTVMLL
FT                   ADPDGLILQHEGDMRILEPASEVGLVPGCNWTELNCGTNAIGTALTLKQAVQIHGAEHF
FT                   CAGIKRWTCSATVIRDPMDGHVLGVIDVSGLADTYSRYSLALTVSLAGRIESRLAKDAM
FT                   ERRLRLLDRCASGFGSHASDAMLVIDDKGRLVKANPQVVPTLRRLGFDVNLDAGFVLPG
FT                   LDTTADHPLTANAPPWLHYAKVETLREGSTVLGFVVVIPGTGNVRGAISPSGGRDKLRS
FT                   VHSGAGAFERIIGDSRTLRAAVDKARQLAPSKVPVLLLGDTGVGKELFAQGIHQASERA
FT                   EGPFVALNCGGLSRDLLASELFGYAEGAFTGARKSGAAGKIEAADGGTLFLDEIGEMPL
FT                   DIQPHLLRVLQENEIYRLGENTPRKVNFRLVAATHRDLKDAIAKGSFRMDLFYRIAVTT
FT                   VSIPSLRERGEDLPTLISYWLGYLCDCYGLTPRSFDAEAYACMLKYEWPGNVRELRNAI
FT                   EGALLLAEGTTITVEKLPVEVAAAAATAVHLAQGEMTEPVMATGDSLKTAEAEYIRRAL
FT                   ARCGGNLTQAAAQLGIAKSTLYEKLRRYDLIAAVSDVRRREARGALRAEAGRSG"
FT   gene            complement(706386..706634)
FT                   /locus_tag="Bphy_6154"
FT   CDS_pept        complement(706386..706634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6154"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75206"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW79"
FT                   /protein_id="ACC75206.1"
FT                   /translation="MKDDTYSLRRQVEKWFGSSQPISIDVSRVPRTMAARSGYKCVRVS
FT                   QPSMTFEIIFFRHGDKSWRVYPPGIERPTLDVLARAA"
FT   gene            complement(707249..707629)
FT                   /locus_tag="Bphy_6155"
FT   CDS_pept        complement(707249..707629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6155"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; KEGG: reh:H16_A2475
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6155"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75207"
FT                   /db_xref="GOA:B2JW80"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW80"
FT                   /protein_id="ACC75207.1"
FT                   /translation="MSSSSARIRTRAFIRQSGRCYYCRCLMWNDIIGLTAMAKNFALPL
FT                   RQVRYLQCTAEHLNPRMNGGSNSHRNIVAACRTCNARRHRAKAPRDPISHQRHVQNRMR
FT                   RKKWHPAWVYESAICAVQGNCF"
FT   gene            complement(708092..709018)
FT                   /locus_tag="Bphy_6156"
FT   CDS_pept        complement(708092..709018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6156"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_2584 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6156"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75208"
FT                   /db_xref="GOA:B2JW81"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW81"
FT                   /protein_id="ACC75208.1"
FT                   /translation="MSYNLHQLHAFTTIVSSGSLGRAAALLNVTQPALSRTIKRLEEDV
FT                   GASLFERHVKGMQLTDIGAALLPHAQLLLREAENAREEIDAMRGLAKGTIKVGAVGSLA
FT                   AHFLPLAIDRVLGKWGNLHVEIIEGVWDRLAEGLINYEIDLALSTATNDSDGIVAVPDC
FT                   RWEDNSFVVAAFGHPLRKKPKLTLADTLTARWAIPPKGTAPYEHMRETFLSRNLDMPDI
FT                   AVQTRSVTVLKSLVAECSFLSWMPEPMYDSESKAGIMGTLPIPGISAARTLTAFRRRDG
FT                   ILPRPAARLLDELRSLTERGMAMQTTR"
FT   gene            709303..710916
FT                   /locus_tag="Bphy_6157"
FT   CDS_pept        709303..710916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6157"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: bam:Bamb_2631 thiamine pyrophosphate enzyme TPP
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6157"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75209"
FT                   /db_xref="GOA:B2JW82"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW82"
FT                   /protein_id="ACC75209.1"
FT                   /translation="MTGSDKQGEGSSPSTRATVRDVVIELVRELGMTSIFANPGSTELP
FT                   MFRDFPADFRYVLGLQEAAVVGMADGYAQATGNAALVNLHSAAGVGNAMGNIFTAFKNQ
FT                   TPLVITAGQQARSILPFDPFLSAAQAVELPKPYVKWAIEPARAQDVPRALERAYHIAMQ
FT                   EPRGPVFVSIPVDDWDQPAEFHERATVSNSVRPDPQALAKLGAALDASRTPALVVGAGV
FT                   DRAGAWKEVVQLAERHNARVFVAPMSARCSFPEDHRLFAGFLPAMREKIVSLLDGHDVI
FT                   FVLGAPAFSYHVEGTGPHVPPGTALYQLIDDPNVAAWTPAGAAVVGNVRLGVLDLLARA
FT                   APGARPLPEPRPRPPRAEPSPVMSVAFALQTLAELRDPNDVVVEEAPSSRPVMQRYLPF
FT                   TRSVTFFTMASGGLGYGMPAAVGVALALPNRRVIGLIGDGSSMYSIQAIYSAVQMRLPI
FT                   TFVILNNQRYAALQEFAPVFGFASDDPVQGTDLPGLDFVSLAQGMGCKGLRVTDAAELA
FT                   EKLKQALEAGEPRLVEVVVA"
FT   gene            710957..712408
FT                   /locus_tag="Bphy_6158"
FT   CDS_pept        710957..712408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6158"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   bur:Bcep18194_A5913 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6158"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75210"
FT                   /db_xref="GOA:B2JW83"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW83"
FT                   /protein_id="ACC75210.1"
FT                   /translation="MKTILMLINGAHVGASNGATFQRSNPLDQDVASVAPACTLDDVRD
FT                   AVDSAAVAFSHWSQLGPARRRSYLLNAAQALEAKADAFASAMAAETGASRIWADFNVRL
FT                   AADGLREAASLTTQISGEVIPSDVPGSLAMAVRQPAGVCLGIAPWNAPVILGVRAVALP
FT                   LACGNTVVLKGSEICPATHALIAEAFMDAGLPAGVVNFVTNAPADAGTVVEALISHPAI
FT                   RRVNFTGSTKVGKIIAESCARHLKPSVLELGGKAPLIVLEDADIASAVDGAAFGAFANS
FT                   GQICMSTERIIVDRSIADDFVRQLGEKAKTLPLGDPRTGPVVLGSVVDIATVQRCNALI
FT                   DDALLKGATLVCGGKADSTLMPATLVDNVGPDMRIYSEETFGPVKAIVRVDGEEEAIRC
FT                   ANDNEYGLAAAVFSRDVARAMRVASRIQSGICHVNGPTVHDEAQMPFGGVKGSGFGHFG
FT                   GHAGIAAFTDLRWVTVQTSPRHYPF"
FT   gene            712473..713417
FT                   /locus_tag="Bphy_6159"
FT   CDS_pept        712473..713417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6159"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: bur:Bcep18194_A5912 2-dehydropantoate
FT                   2-reductase; TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75211"
FT                   /db_xref="GOA:B2JW84"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW84"
FT                   /protein_id="ACC75211.1"
FT                   /translation="MSTMEIAVLGAGAMGSMFGGRLAEAGHSVTLIDINQPHLEAIRAN
FT                   GLCVETDGNTRAIKNIAAMRPGATDKTPELLLVFTKSMHTRAALSGIEHLLGETTAVLT
FT                   LQNGLGNVEAIRDFVPLANVLIGVTTWPADLVGPGSVSSHGEGNIRMMSADGERTSKVS
FT                   AVAEALNSAGLNCQVDDNVWAAIWEKVAFNAALNSICAVTGTTVDQLGLLDDSKSLALT
FT                   VAAEVVSVANASGVSADLNTCSTNIVHAIEQHRGHKPSMLQDVLAGRKTEIEGINGAVV
FT                   DVARTLNVSVPHTETLAKLVRLIDARNASAVAK"
FT   sig_peptide     712473..712544
FT                   /locus_tag="Bphy_6159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.773 at
FT                   residue 24"
FT   gene            713606..714982
FT                   /locus_tag="Bphy_6160"
FT   CDS_pept        713606..714982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_6160"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pfl:PFL_3477
FT                   4-hydroxybenzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_6160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC75212"
FT                   /db_xref="GOA:B2JW85"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JW85"
FT                   /protein_id="ACC75212.1"
FT                   /translation="MNSQTFSTSKTADIGSLLDDGPFTLIQKLIVCLAALSIVMDGFDG
FT                   QLIGYAIPTIIKEWGITRNAFAPAVAAGLVGMGVGSACAGLFADRFGRRWALIGSVVVF
FT                   GAATCAIGLAQNITMIAALRFIAGLGIGGALPSATTMTAEFTPARRRTLAVTSTIVCVP
FT                   LGGMLAGFFAGAVLPTFGWRGLFFIGGTIPLALGILLFFVFPESPRFLARKEQRWTELR
FT                   ALLAKMSRPISAQTIFVDAAEQRLEQRDGFGSLFEPGQRRNTIAIWGAFFMCLLAVYAA
FT                   FSWLPTMLASEGLPVTLAGSGLTAYNSGGVFGALICALAITRFGSRWPLLVCCAGGCAS
FT                   AFFLRGVDVATHTRVLVIGLGVHGLFVNAVQSTMYALCAYVYPTRVRAT